NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|568961122|ref|XP_006511057|]
View 

PREDICTED: transcription factor 12 isoform X1 [Mus musculus]

Protein Classification

helix-loop-helix domain-containing protein (domain architecture ID 10646839)

helix-loop-helix (HLH) domain-containing protein is a DNA-binding protein that may act as a transcription factor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HLH smart00353
helix loop helix domain;
607-660 4.96e-13

helix loop helix domain;


:

Pssm-ID: 197674 [Multi-domain]  Cd Length: 53  Bit Score: 63.78  E-value: 4.96e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 568961122   607 NARERLRVRDINEAFKELGRMCQLHLKSEKPqTKLLILHQAVAVILSLEQQVRE 660
Cdd:smart00353   1 NARERRRRRKINEAFDELRSLLPTLPKNKKL-SKAEILRLAIEYIKSLQEELQK 53
 
Name Accession Description Interval E-value
HLH smart00353
helix loop helix domain;
607-660 4.96e-13

helix loop helix domain;


Pssm-ID: 197674 [Multi-domain]  Cd Length: 53  Bit Score: 63.78  E-value: 4.96e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 568961122   607 NARERLRVRDINEAFKELGRMCQLHLKSEKPqTKLLILHQAVAVILSLEQQVRE 660
Cdd:smart00353   1 NARERRRRRKINEAFDELRSLLPTLPKNKKL-SKAEILRLAIEYIKSLQEELQK 53
HLH pfam00010
Helix-loop-helix DNA-binding domain;
602-655 1.32e-10

Helix-loop-helix DNA-binding domain;


Pssm-ID: 333763  Cd Length: 52  Bit Score: 56.78  E-value: 1.32e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 568961122  602 RRMANNARERLRVRDINEAFKELgRMCQLHLKSEKPqTKLLILHQAVAVILSLE 655
Cdd:pfam00010   1 RRRAHNERERRRRDRINDAFDEL-RELLPTPPSKKL-SKAEILRLAIEYIKHLQ 52
HLH cd00083
Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription ...
599-659 4.36e-10

Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long. A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins.


Pssm-ID: 238036  Cd Length: 60  Bit Score: 55.68  E-value: 4.36e-10
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568961122 599 EKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPqTKLLILHQAVAVILSLEQQVR 659
Cdd:cd00083    1 RKSRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKL-SKAEILRKAVDYIKSLQELLQ 60
 
Name Accession Description Interval E-value
HLH smart00353
helix loop helix domain;
607-660 4.96e-13

helix loop helix domain;


Pssm-ID: 197674 [Multi-domain]  Cd Length: 53  Bit Score: 63.78  E-value: 4.96e-13
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....
gi 568961122   607 NARERLRVRDINEAFKELGRMCQLHLKSEKPqTKLLILHQAVAVILSLEQQVRE 660
Cdd:smart00353   1 NARERRRRRKINEAFDELRSLLPTLPKNKKL-SKAEILRLAIEYIKSLQEELQK 53
HLH pfam00010
Helix-loop-helix DNA-binding domain;
602-655 1.32e-10

Helix-loop-helix DNA-binding domain;


Pssm-ID: 333763  Cd Length: 52  Bit Score: 56.78  E-value: 1.32e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 568961122  602 RRMANNARERLRVRDINEAFKELgRMCQLHLKSEKPqTKLLILHQAVAVILSLE 655
Cdd:pfam00010   1 RRRAHNERERRRRDRINDAFDEL-RELLPTPPSKKL-SKAEILRLAIEYIKHLQ 52
HLH cd00083
Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription ...
599-659 4.36e-10

Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long. A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins.


Pssm-ID: 238036  Cd Length: 60  Bit Score: 55.68  E-value: 4.36e-10
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 568961122 599 EKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPqTKLLILHQAVAVILSLEQQVR 659
Cdd:cd00083    1 RKSRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKL-SKAEILRKAVDYIKSLQELLQ 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH