NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|564376312|ref|XP_006248199.1|]
View 

PREDICTED: ATP-sensitive inward rectifier potassium channel 15 isoform X2 [Rattus norvegicus]

Protein Classification

IRK domain-containing protein (domain architecture ID 10470165)

IRK domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IRK pfam01007
Inward rectifier potassium channel;
55-381 0e+00

Inward rectifier potassium channel;


:

Pssm-ID: 307239  Cd Length: 329  Bit Score: 526.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312   55 MSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLELGESNSNHTPCIM 134
Cdd:pfam01007   1 VSKNGHCNVVFTNIPEKSLRYLQDIFTTLVDIKWRYMLLIFSLSFVLSWLLFGLIWYLIAYAHGDLDGERNDDGHTPCVY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  135 KVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVISKQ 214
Cdd:pfam01007  81 NVHSFTGAFLFSIETQTTIGYGFRYVTEECPEAIFLLVIQSIVGCIIDAFMIGIVFAKMARPKKRAETLKFSKKAVICLR 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  215 NGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTP 294
Cdd:pfam01007 161 DGKLCLMFRVGDLRKSHLIEAHVRAQLLKPRVTKEGEVIPLDQVDLDLGNDTGSDRIFLVWPLTVVHVIDEESPLYDLSA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  295 QNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRK--SPDCTFYCADSE 372
Cdd:pfam01007 241 KDLLEEDFEIVVILEGTVESTGMTTQARTSYLPSEILWGHRFEPVVSYDKNGRYVVDYSNFHKTYEvpTPLCSARELDEK 320

                  ....*....
gi 564376312  373 KQKLEEQYR 381
Cdd:pfam01007 321 KQKLEESLN 329
 
Name Accession Description Interval E-value
IRK pfam01007
Inward rectifier potassium channel;
55-381 0e+00

Inward rectifier potassium channel;


Pssm-ID: 307239  Cd Length: 329  Bit Score: 526.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312   55 MSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLELGESNSNHTPCIM 134
Cdd:pfam01007   1 VSKNGHCNVVFTNIPEKSLRYLQDIFTTLVDIKWRYMLLIFSLSFVLSWLLFGLIWYLIAYAHGDLDGERNDDGHTPCVY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  135 KVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVISKQ 214
Cdd:pfam01007  81 NVHSFTGAFLFSIETQTTIGYGFRYVTEECPEAIFLLVIQSIVGCIIDAFMIGIVFAKMARPKKRAETLKFSKKAVICLR 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  215 NGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTP 294
Cdd:pfam01007 161 DGKLCLMFRVGDLRKSHLIEAHVRAQLLKPRVTKEGEVIPLDQVDLDLGNDTGSDRIFLVWPLTVVHVIDEESPLYDLSA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  295 QNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRK--SPDCTFYCADSE 372
Cdd:pfam01007 241 KDLLEEDFEIVVILEGTVESTGMTTQARTSYLPSEILWGHRFEPVVSYDKNGRYVVDYSNFHKTYEvpTPLCSARELDEK 320

                  ....*....
gi 564376312  373 KQKLEEQYR 381
Cdd:pfam01007 321 KQKLEESLN 329
 
Name Accession Description Interval E-value
IRK pfam01007
Inward rectifier potassium channel;
55-381 0e+00

Inward rectifier potassium channel;


Pssm-ID: 307239  Cd Length: 329  Bit Score: 526.77  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312   55 MSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHGDLELGESNSNHTPCIM 134
Cdd:pfam01007   1 VSKNGHCNVVFTNIPEKSLRYLQDIFTTLVDIKWRYMLLIFSLSFVLSWLLFGLIWYLIAYAHGDLDGERNDDGHTPCVY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  135 KVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVISKQ 214
Cdd:pfam01007  81 NVHSFTGAFLFSIETQTTIGYGFRYVTEECPEAIFLLVIQSIVGCIIDAFMIGIVFAKMARPKKRAETLKFSKKAVICLR 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  215 NGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTP 294
Cdd:pfam01007 161 DGKLCLMFRVGDLRKSHLIEAHVRAQLLKPRVTKEGEVIPLDQVDLDLGNDTGSDRIFLVWPLTVVHVIDEESPLYDLSA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 564376312  295 QNLKEKEFELVVLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRK--SPDCTFYCADSE 372
Cdd:pfam01007 241 KDLLEEDFEIVVILEGTVESTGMTTQARTSYLPSEILWGHRFEPVVSYDKNGRYVVDYSNFHKTYEvpTPLCSARELDEK 320

                  ....*....
gi 564376312  373 KQKLEEQYR 381
Cdd:pfam01007 321 KQKLEESLN 329
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH