NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|187960086|ref|NP_997235.3|]
View 

cytochrome P450 4V2 [Homo sapiens]

Protein Classification

cytochrome P450 (domain architecture ID 10441782)

cytochrome P450 catalyzes the oxidation of organic species by molecular oxygen, by the oxidative addition of atomic oxygen into an unactivated C-H or C-C bond

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
55-517 1.57e-121

Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


:

Pssm-ID: 306555  Cd Length: 461  Bit Score: 368.53  E-value: 1.57e-121
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086   55 RAYPLVGHaLLMKPDGREFFQQIIEYTEEYRhmPLLKLWVGPVPMVALYNAENVEVIL-----TSSKQIDKSSMYKFLEP 129
Cdd:pfam00067   5 PPLPLFGN-LLQLGRKGNLHSVFTKLQKKYG--PIFRLYLGPKPVVVLSGPEAVKEVLikkgeEFSGRPDEPWFASLRGP 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  130 WLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQ-EAFNCFFYITLCALDIICETAMGKN 208
Cdd:pfam00067  82 FLGKGIVFANGPRWRQLRRFLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTAGEpGVIDITDLLFRAALNVICSILFGER 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  209 IGA-QSNDDSEYVRAVYRMSEMIFRRIKMPWLWL-DLWYLMFKEGWEHKKSLQILHTFTNSVIAERanemNANEDcrgdg 286
Cdd:pfam00067 162 FGSlEDPKFLELVKAVQELSSLLSSPSPQLLDLFpILKYFPGPHGRKLKRARKKIKDLLDKLIEER----RETLD----- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  287 rgsaPSKNKRRAFLD-LLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGK 365
Cdd:pfam00067 233 ----SAKKSPRDFLDaLLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGD 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  366 SDRPaTVEDLKKLRYLECVIKETLRLFPSVPLF-ARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF 444
Cdd:pfam00067 309 KRSP-TYDDLQNMPYLDAVIKETLRLHPVVPLLlPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERF 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 187960086  445 FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKREELGLEGQLILRPSNGIWIKL 517
Cdd:pfam00067 388 LDENGKFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFeVELPPGTDPPDIDETPGLLLPPKPYKLKF 461
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
55-517 1.57e-121

Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 306555  Cd Length: 461  Bit Score: 368.53  E-value: 1.57e-121
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086   55 RAYPLVGHaLLMKPDGREFFQQIIEYTEEYRhmPLLKLWVGPVPMVALYNAENVEVIL-----TSSKQIDKSSMYKFLEP 129
Cdd:pfam00067   5 PPLPLFGN-LLQLGRKGNLHSVFTKLQKKYG--PIFRLYLGPKPVVVLSGPEAVKEVLikkgeEFSGRPDEPWFASLRGP 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  130 WLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQ-EAFNCFFYITLCALDIICETAMGKN 208
Cdd:pfam00067  82 FLGKGIVFANGPRWRQLRRFLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTAGEpGVIDITDLLFRAALNVICSILFGER 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  209 IGA-QSNDDSEYVRAVYRMSEMIFRRIKMPWLWL-DLWYLMFKEGWEHKKSLQILHTFTNSVIAERanemNANEDcrgdg 286
Cdd:pfam00067 162 FGSlEDPKFLELVKAVQELSSLLSSPSPQLLDLFpILKYFPGPHGRKLKRARKKIKDLLDKLIEER----RETLD----- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  287 rgsaPSKNKRRAFLD-LLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGK 365
Cdd:pfam00067 233 ----SAKKSPRDFLDaLLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGD 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  366 SDRPaTVEDLKKLRYLECVIKETLRLFPSVPLF-ARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF 444
Cdd:pfam00067 309 KRSP-TYDDLQNMPYLDAVIKETLRLHPVVPLLlPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERF 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 187960086  445 FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKREELGLEGQLILRPSNGIWIKL 517
Cdd:pfam00067 388 LDENGKFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFeVELPPGTDPPDIDETPGLLLPPKPYKLKF 461
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
113-521 7.03e-62

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035  Cd Length: 411  Bit Score: 211.13  E-value: 7.03e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 113 TSSKQIDKSSMYKFLEPWLGLG-LLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEkhiNQEAFNCFFY 191
Cdd:COG2124   68 FFSSALGAGLRPRLLRPVLGDGsLLTLDGPEHTRLRKLLAPAFTPRALRGYRPLIREIADRLLDDLW---QGGADLVLDF 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 192 ITLCALDIICEtAMGKNIGaqsnDDSEYVRAVYRMSEMifrrikmpwlwLDLWYLMFKEGWEHKKSLQILHTFTNSVIAE 271
Cdd:COG2124  145 AAELTLRVIAE-LLGVPLE----DRPQLLRWSDALLLR-----------LDPDLGPEEPWRRARAARRELDAYLRALIAE 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 272 RanemnanedcRGDGRGsapsknkrrAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEV 351
Cdd:COG2124  209 R----------RAAPRD---------DLLSLLLSAEDDGGGRLSDDEIRDELITLLVAGHETTANALAWALYALLRHPDQ 269
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 352 QKKVDHELDdvfgksdrpatvedlkkLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPR 431
Cdd:COG2124  270 LAKLRAEPD-----------------RPLLEAVVEETLRLYPPVPLARRVATEDVELGGYRIPAGTVVLLSIGAANRDPE 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 432 YFPNPEEFQPERFfpenaqgrhPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKREELGLegqLILRPS 510
Cdd:COG2124  333 VFPDPDEFDPERF---------NNAHLPFGGGPHRCLGAALARLELKVALAELLRRFpLLLLAEPPPLVRR---PTLVPR 400
                        410
                 ....*....|.
gi 187960086 511 NGIWIKLKRRN 521
Cdd:COG2124  401 GGERLPVRRRR 411
PLN02738 PLN02738
carotene beta-ring hydroxylase
98-488 8.57e-47

carotene beta-ring hydroxylase


Pssm-ID: 215393  Cd Length: 633  Bit Score: 173.56  E-value: 8.57e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  98 PMVALYnaenveVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKL 177
Cdd:PLN02738 183 PSIAKH------ILRDNSKAYSKGILAEILEFVMGKGLIPADGEIWRVRRRAIVPALHQKYVAAMISLFGQASDRLCQKL 256
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 178 EKHINQ----EAFNCFFYITLcalDIICETAMGKNIGAQSNDDS--EYVRAVYRMSEMifRRIK-MPWLWLDLWYLMFKE 250
Cdd:PLN02738 257 DAAASDgedvEMESLFSRLTL---DIIGKAVFNYDFDSLSNDTGivEAVYTVLREAED--RSVSpIPVWEIPIWKDISPR 331
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 251 GWEHKKSLQILHTFTNSVIAeRANEMNANEDCRGDGRgsapSKNKRR-AFLDLLLSVTDDegnrLSHEDIREEVDTFMFE 329
Cdd:PLN02738 332 QRKVAEALKLINDTLDDLIA-ICKRMVEEEELQFHEE----YMNERDpSILHFLLASGDD----VSSKQLRDDLMTMLIA 402
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 330 GHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGksDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVA 409
Cdd:PLN02738 403 GHETSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLG--DRFPTIEDMKKLKYTTRVINESLRLYPQPPVLIRRSLENDMLG 480
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 410 GYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF---FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILR 486
Cdd:PLN02738 481 GYPIKRGEDIFISVWNLHRSPKHWDDAEKFNPERWpldGPNPNETNQNFSYLPFGGGPRKCVGDMFASFENVVATAMLVR 560

                 ..
gi 187960086 487 HF 488
Cdd:PLN02738 561 RF 562
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
303-476 3.98e-15

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 77.07  E-value: 3.98e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  303 LLSVTDDEGNRLSHEDIREEVDTFMF---EGHDTTAAainWSLYLLGSNPEvqkkvdhELDDVFgkSDRpatvedlkklR 379
Cdd:TIGR04538 199 ILCTSEDEGNAMSDTEILALILNILLaatEPADKTLA---YMIYHLLNNPE-------QLNDVL--DDR----------K 256
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  380 YLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYA-YV 458
Cdd:TIGR04538 257 LLRRAIAETLRLHSPVQLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRKDLVNKSAFTGAArHL 336
                         170
                  ....*....|....*...
gi 187960086  459 PFSAGPRNCIGQKFAVME 476
Cdd:TIGR04538 337 AFGSGVHNCVGAAFAKRQ 354
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
55-517 1.57e-121

Cytochrome P450; Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 306555  Cd Length: 461  Bit Score: 368.53  E-value: 1.57e-121
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086   55 RAYPLVGHaLLMKPDGREFFQQIIEYTEEYRhmPLLKLWVGPVPMVALYNAENVEVIL-----TSSKQIDKSSMYKFLEP 129
Cdd:pfam00067   5 PPLPLFGN-LLQLGRKGNLHSVFTKLQKKYG--PIFRLYLGPKPVVVLSGPEAVKEVLikkgeEFSGRPDEPWFASLRGP 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  130 WLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQ-EAFNCFFYITLCALDIICETAMGKN 208
Cdd:pfam00067  82 FLGKGIVFANGPRWRQLRRFLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTAGEpGVIDITDLLFRAALNVICSILFGER 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  209 IGA-QSNDDSEYVRAVYRMSEMIFRRIKMPWLWL-DLWYLMFKEGWEHKKSLQILHTFTNSVIAERanemNANEDcrgdg 286
Cdd:pfam00067 162 FGSlEDPKFLELVKAVQELSSLLSSPSPQLLDLFpILKYFPGPHGRKLKRARKKIKDLLDKLIEER----RETLD----- 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  287 rgsaPSKNKRRAFLD-LLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGK 365
Cdd:pfam00067 233 ----SAKKSPRDFLDaLLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGD 308
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  366 SDRPaTVEDLKKLRYLECVIKETLRLFPSVPLF-ARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF 444
Cdd:pfam00067 309 KRSP-TYDDLQNMPYLDAVIKETLRLHPVVPLLlPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERF 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 187960086  445 FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKREELGLEGQLILRPSNGIWIKL 517
Cdd:pfam00067 388 LDENGKFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFeVELPPGTDPPDIDETPGLLLPPKPYKLKF 461
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
113-521 7.03e-62

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035  Cd Length: 411  Bit Score: 211.13  E-value: 7.03e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 113 TSSKQIDKSSMYKFLEPWLGLG-LLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEkhiNQEAFNCFFY 191
Cdd:COG2124   68 FFSSALGAGLRPRLLRPVLGDGsLLTLDGPEHTRLRKLLAPAFTPRALRGYRPLIREIADRLLDDLW---QGGADLVLDF 144
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 192 ITLCALDIICEtAMGKNIGaqsnDDSEYVRAVYRMSEMifrrikmpwlwLDLWYLMFKEGWEHKKSLQILHTFTNSVIAE 271
Cdd:COG2124  145 AAELTLRVIAE-LLGVPLE----DRPQLLRWSDALLLR-----------LDPDLGPEEPWRRARAARRELDAYLRALIAE 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 272 RanemnanedcRGDGRGsapsknkrrAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEV 351
Cdd:COG2124  209 R----------RAAPRD---------DLLSLLLSAEDDGGGRLSDDEIRDELITLLVAGHETTANALAWALYALLRHPDQ 269
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 352 QKKVDHELDdvfgksdrpatvedlkkLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPR 431
Cdd:COG2124  270 LAKLRAEPD-----------------RPLLEAVVEETLRLYPPVPLARRVATEDVELGGYRIPAGTVVLLSIGAANRDPE 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 432 YFPNPEEFQPERFfpenaqgrhPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKREELGLegqLILRPS 510
Cdd:COG2124  333 VFPDPDEFDPERF---------NNAHLPFGGGPHRCLGAALARLELKVALAELLRRFpLLLLAEPPPLVRR---PTLVPR 400
                        410
                 ....*....|.
gi 187960086 511 NGIWIKLKRRN 521
Cdd:COG2124  401 GGERLPVRRRR 411
PLN02738 PLN02738
carotene beta-ring hydroxylase
98-488 8.57e-47

carotene beta-ring hydroxylase


Pssm-ID: 215393  Cd Length: 633  Bit Score: 173.56  E-value: 8.57e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  98 PMVALYnaenveVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKL 177
Cdd:PLN02738 183 PSIAKH------ILRDNSKAYSKGILAEILEFVMGKGLIPADGEIWRVRRRAIVPALHQKYVAAMISLFGQASDRLCQKL 256
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 178 EKHINQ----EAFNCFFYITLcalDIICETAMGKNIGAQSNDDS--EYVRAVYRMSEMifRRIK-MPWLWLDLWYLMFKE 250
Cdd:PLN02738 257 DAAASDgedvEMESLFSRLTL---DIIGKAVFNYDFDSLSNDTGivEAVYTVLREAED--RSVSpIPVWEIPIWKDISPR 331
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 251 GWEHKKSLQILHTFTNSVIAeRANEMNANEDCRGDGRgsapSKNKRR-AFLDLLLSVTDDegnrLSHEDIREEVDTFMFE 329
Cdd:PLN02738 332 QRKVAEALKLINDTLDDLIA-ICKRMVEEEELQFHEE----YMNERDpSILHFLLASGDD----VSSKQLRDDLMTMLIA 402
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 330 GHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGksDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVA 409
Cdd:PLN02738 403 GHETSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLG--DRFPTIEDMKKLKYTTRVINESLRLYPQPPVLIRRSLENDMLG 480
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 410 GYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF---FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILR 486
Cdd:PLN02738 481 GYPIKRGEDIFISVWNLHRSPKHWDDAEKFNPERWpldGPNPNETNQNFSYLPFGGGPRKCVGDMFASFENVVATAMLVR 560

                 ..
gi 187960086 487 HF 488
Cdd:PLN02738 561 RF 562
PLN02936 PLN02936
epsilon-ring hydroxylase
70-522 9.44e-47

epsilon-ring hydroxylase


Pssm-ID: 178524  Cd Length: 489  Bit Score: 171.51  E-value: 9.44e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  70 GREFFQQIIEYTEEYRhmPLLKLWVGPVPMVALYNAENVEVILTS--SKQIdKSSMYKFLEPWLGLGLLTSTGNKWRSRR 147
Cdd:PLN02936  35 GGALFLPLFKWMNEYG--PVYRLAAGPRNFVVVSDPAIAKHVLRNygSKYA-KGLVAEVSEFLFGSGFAIAEGELWTARR 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 148 KMLTPTFHFTILEDFLD-IMNEQANILVKKLEKHI-NQEAFNCFFYITLCALDIICETAMGKNIGAQSNDdSEYVRAVYR 225
Cdd:PLN02936 112 RAVVPSLHRRYLSVMVDrVFCKCAERLVEKLEPVAlSGEAVNMEAKFSQLTLDVIGLSVFNYNFDSLTTD-SPVIQAVYT 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 226 -MSEMIFRRIK-MPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIaERANEMNANEDCRGDGR----GSAPSknkrraF 299
Cdd:PLN02936 191 aLKEAETRSTDlLPYWKVDFLCKISPRQIKAEKAVTVIRETVEDLV-DKCKEIVEAEGEVIEGEeyvnDSDPS------V 263
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 300 LDLLLSVTDDegnrLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGksDRPATVEDLKKLR 379
Cdd:PLN02936 264 LRFLLASREE----VSSVQLRDDLLSMLVAGHETTGSVLTWTLYLLSKNPEALRKAQEELDRVLQ--GRPPTYEDIKELK 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 380 YLECVIKETLRLFPSVP-LFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHP---Y 455
Cdd:PLN02936 338 YLTRCINESMRLYPHPPvLIRRAQVEDVLPGGYKVNAGQDIMISVYNIHRSPEVWERAEEFVPERFDLDGPVPNETntdF 417
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 187960086 456 AYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIE--SNQKreeLGLEGQLILRPSNGIWIKLKRRNA 522
Cdd:PLN02936 418 RYIPFSGGPRKCVGDQFALLEAIVALAVLLQRLDLElvPDQD---IVMTTGATIHTTNGLYMTVSRRRV 483
PLN02290 PLN02290
cytokinin trans-hydroxylase
93-518 2.91e-44

cytokinin trans-hydroxylase


Pssm-ID: 215164  Cd Length: 516  Bit Score: 164.99  E-value: 2.91e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  93 WVGPVPMVALYNAENVEVILTSSKQIDKSSmykflepWL---------GLGLLTSTGNKWRSRRKMLTPTFHFTILEDFL 163
Cdd:PLN02290 100 WNGTEPRLCLTETELIKELLTKYNTVTGKS-------WLqqqgtkhfiGRGLLMANGADWYHQRHIAAPAFMGDRLKGYA 172
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 164 DIMNEQANILVKKLEKHIN--QEAFNCFFYITLCALDIICETAMGKNIgaqsnddsEYVRAVYRMSEMIFRRIKMP--WL 239
Cdd:PLN02290 173 GHMVECTKQMLQSLQKAVEsgQTEVEIGEYMTRLTADIISRTEFDSSY--------EKGKQIFHLLTVLQRLCAQAtrHL 244
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 240 WL-DLWYLMFKEGWEHKKSLQILHTFTNSVIAERanemnanEDCRGDGRGSAPSknkrRAFLDLLLSVTD---DEGNRLS 315
Cdd:PLN02290 245 CFpGSRFFPSKYNREIKSLKGEVERLLMEIIQSR-------RDCVEIGRSSSYG----DDLLGMLLNEMEkkrSNGFNLN 313
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 316 HEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGksDRPATVEDLKKLRYLECVIKETLRLFPSV 395
Cdd:PLN02290 314 LQLIMDECKTFFFAGHETTALLLTWTLMLLASNPTWQDKVRAEVAEVCG--GETPSVDHLSKLTLLNMVINESLRLYPPA 391
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 396 PLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYF-PNPEEFQPERFFPEN-AQGRHpyaYVPFSAGPRNCIGQKFA 473
Cdd:PLN02290 392 TLLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWgKDANEFNPDRFAGRPfAPGRH---FIPFAAGPRNCIGQAFA 468
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 187960086 474 VMEEKTILSCILRHF--WIESNQKREELGLegqLILRPSNGIWIKLK 518
Cdd:PLN02290 469 MMEAKIILAMLISKFsfTISDNYRHAPVVV---LTIKPKYGVQVCLK 512
PLN02687 PLN02687
flavonoid 3'-monooxygenase
140-469 4.85e-44

flavonoid 3'-monooxygenase


Pssm-ID: 215371  Cd Length: 517  Bit Score: 164.21  E-value: 4.85e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 140 GNKWRSRRKMLT-PTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDS- 217
Cdd:PLN02687 124 GPRWRALRKICAvHLFSAKALDDFRHVREEEVALLVRELARQHGTAPVNLGQLVNVCTTNALGRAMVGRRVFAGDGDEKa 203
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 218 -EYVRAVYRMSEM--IFRRIK-MPWL-WLDLWYLMFKEGWEHKKslqiLHTFTNSVIAERAnemnanedcrgdgRGSAPS 292
Cdd:PLN02687 204 rEFKEMVVELMQLagVFNVGDfVPALrWLDLQGVVGKMKRLHRR----FDAMMNGIIEEHK-------------AAGQTG 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 293 KNKRRAFLDLLLSVT-----DDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKsD 367
Cdd:PLN02687 267 SEEHKDLLSTLLALKreqqaDGEGGRITDTEIKALLLNLFTAGTDTTSSTVEWAIAELIRHPDILKKAQEELDAVVGR-D 345
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 368 RPATVEDLKKLRYLECVIKETLRLFPSVPL-FARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFP 446
Cdd:PLN02687 346 RLVSESDLPQLTYLQAVIKETFRLHPSTPLsLPRMAAEECEINGYHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLP 425
                        330       340       350
                 ....*....|....*....|....*....|.
gi 187960086 447 enaQGRHP--------YAYVPFSAGPRNCIG 469
Cdd:PLN02687 426 ---GGEHAgvdvkgsdFELIPFGAGRRICAG 453
PLN03195 PLN03195
fatty acid omega-hydroxylase; Provisional
30-488 4.65e-38

fatty acid omega-hydroxylase; Provisional


Pssm-ID: 215627  Cd Length: 516  Bit Score: 146.46  E-value: 4.65e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  30 VLSLLQRVASYA--RKWQQMRPIPtvARAYPLVGHALlmkpDGREFFQQIIEYTEEYrhmpLLKLWVGPVPMVAL---YN 104
Cdd:PLN03195  11 VLFIALAVLSWIfiHRWSQRNRKG--PKSWPIIGAAL----EQLKNYDRMHDWLVEY----LSKDRTVVVKMPFTtytYI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 105 AE--NVEVIL-TSSKQIDKSSMY-KFLEPWLGLGLLTSTGNKWRSRRKmlTPTFHFT--ILEDFLDIMNEQ-----ANIL 173
Cdd:PLN03195  81 ADpvNVEHVLkTNFANYPKGEVYhSYMEVLLGDGIFNVDGELWRKQRK--TASFEFAskNLRDFSTVVFREyslklSSIL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 174 VKKLEKHINQEAFNCFFYITLcalDIICETAMGKNIGAQSND--DSEYVRAVYRMSEMIFRRIKMPwlwldLWYL--MFK 249
Cdd:PLN03195 159 SQASFANQVVDMQDLFMRMTL---DSICKVGFGVEIGTLSPSlpENPFAQAFDTANIIVTLRFIDP-----LWKLkkFLN 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 250 EGWEH--KKSLQILHTFTNSVIAERANEMnanEDCRGDGrgsapsKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFM 327
Cdd:PLN03195 231 IGSEAllSKSIKVVDDFTYSVIRRRKAEM---DEARKSG------KKVKHDILSRFIELGEDPDSNFTDKSLRDIVLNFV 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 328 FEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVED-------------------LKKLRYLECVIKET 388
Cdd:PLN03195 302 IAGRDTTATTLSWFVYMIMMNPHVAEKLYSELKALEKERAKEEDPEDsqsfnqrvtqfaglltydsLGKLQYLHAVITET 381
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 389 LRLFPSVPLFARSVSEDCEVA-GYRVLKGTEAVIIPYALHRDP-RYFPNPEEFQPERFFPENA-QGRHPYAYVPFSAGPR 465
Cdd:PLN03195 382 LRLYPAVPQDPKGILEDDVLPdGTKVKAGGMVTYVPYSMGRMEyNWGPDAASFKPERWIKDGVfQNASPFKFTAFQAGPR 461
                        490       500
                 ....*....|....*....|...
gi 187960086 466 NCIGQKFAVMEEKTILSCILRHF 488
Cdd:PLN03195 462 ICLGKDSAYLQMKMALALLCRFF 484
PTZ00404 PTZ00404
cytochrome P450; Provisional
134-520 1.64e-33

cytochrome P450; Provisional


Pssm-ID: 173595  Cd Length: 482  Bit Score: 132.54  E-value: 1.64e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 134 GLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQ-EAFNCFFYITLCALdiiceTAMGKNIgaq 212
Cdd:PTZ00404 111 GIVTSSGEYWKRNREIVGKAMRKTNLKHIYDLLDDQVDVLIESMKKIESSgETFEPRYYLTKFTM-----SAMFKYI--- 182
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 213 SNDDSEYVRAVYR------MSEM--IFRRIKMPWLW--------LDLWYLMFKEgwehkKSLQILHTFtnsvIAERANEM 276
Cdd:PTZ00404 183 FNEDISFDEDIHNgklaelMGPMeqVFKDLGSGSLFdvieitqpLYYQYLEHTD-----KNFKKIKKF----IKEKYHEH 253
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 277 NANEDcrgdgrgsapsKNKRRAFLDLLLS--VTDDEGNRLShedIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKK 354
Cdd:PTZ00404 254 LKTID-----------PEVPRDLLDLLIKeyGTNTDDDILS---ILATILDFFLAGVDTSATSLEWMVLMLCNYPEIQEK 319
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 355 VDHELDDVFGKSDRpATVEDLKKLRYLECVIKETLRLFPSVPL-FARSVSEDCEVA-GYRVLKGTEAVIIPYALHRDPRY 432
Cdd:PTZ00404 320 AYNEIKSTVNGRNK-VLLSDRQSTPYTVAIIKETLRYKPVSPFgLPRSTSNDIIIGgGHFIPKDAQILINYYSLGRNEKY 398
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 433 FPNPEEFQPERFFPENAqgrhPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIES--NQKREELGLEGqLILRPs 510
Cdd:PTZ00404 399 FENPEQFDPSRFLNPDS----NDAFMPFSIGPRNCVGQQFAQDELYLAFSNIILNFKLKSidGKKIDETEEYG-LTLKP- 472
                        410
                 ....*....|
gi 187960086 511 NGIWIKLKRR 520
Cdd:PTZ00404 473 NKFKVLLEKR 482
PLN02183 PLN02183
ferulate 5-hydroxylase
301-469 5.72e-32

ferulate 5-hydroxylase


Pssm-ID: 165828  Cd Length: 516  Bit Score: 128.43  E-value: 5.72e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 301 DLLLSVTDDEGN--RLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKsDRPATVEDLKKL 378
Cdd:PLN02183 285 EAKVNESDDLQNaiKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELADVVGL-NRRVEESDLEKL 363
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 379 RYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENA---QGRHpY 455
Cdd:PLN02183 364 TYLKCTLKETLRLHPPIPLLLHETAEDAEVAGYFIPARSRVMINAWAIGRDKNSWEDPDTFKPSRFLKPGVpdfKGSH-F 442
                        170
                 ....*....|....
gi 187960086 456 AYVPFSAGPRNCIG 469
Cdd:PLN02183 443 EFIPFGSGRRSCPG 456
PLN00110 PLN00110
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
299-488 2.36e-31

flavonoid 3',5'-hydroxylase (F3'5'H); Provisional


Pssm-ID: 177725  Cd Length: 504  Bit Score: 126.51  E-value: 2.36e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 299 FLDLLLSVTDD-EGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRpaTVE-DLK 376
Cdd:PLN00110 269 FLDVVMANQENsTGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAEMLKNPSILKRAHEEMDQVIGRNRR--LVEsDLP 346
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 377 KLRYLECVIKETLRLFPSVPL-FARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHP- 454
Cdd:PLN00110 347 KLPYLQAICKESFRKHPSTPLnLPRVSTQACEVNGYYIPKNTRLSVNIWAIGRDPDVWENPEEFRPERFLSEKNAKIDPr 426
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 187960086 455 ---YAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF 488
Cdd:PLN00110 427 gndFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSF 463
PLN02426 PLN02426
cytochrome P450, family 94, subfamily C protein
104-491 4.32e-30

cytochrome P450, family 94, subfamily C protein


Pssm-ID: 215235  Cd Length: 502  Bit Score: 122.88  E-value: 4.32e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 104 NAENVEVIL-TSSKQIDKSSMYK-FLEPWLGLGLLTSTGNKWRSRRKMLT--------PTFHFTIledfldIMNEQANIL 173
Cdd:PLN02426  90 NPENVEYMLkTRFDNYPKGKPFSaILGDLLGRGIFNVDGDSWRFQRKMASlelgsvsiRSYAFEI------VASEIESRL 163
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 174 VKKLEKHIN---------QEAFNCFfyitlcALDIICETAMGKNIGA--QSNDDSEYVRAVYRMSEMIFRR--IKMPWLW 240
Cdd:PLN02426 164 LPLLSSAADdgegavldlQDVFRRF------SFDNICKFSFGLDPGCleLSLPISEFADAFDTASKLSAERamAASPLLW 237
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 241 LDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEmnanedcrgdgrGSAPSKnkrraflDLL----LSVTDDEGNRlsh 316
Cdd:PLN02426 238 KIKRLLNIGSERKLKEAIKLVDELAAEVIRQRRKL------------GFSASK-------DLLsrfmASINDDKYLR--- 295
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 317 eDIreeVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVP 396
Cdd:PLN02426 296 -DI---VVSFLLAGRDTVASALTSFFWLLSKHPEVASAIREEADRVMGPNQEAASFEEMKEMHYLHAALYESMRLFPPVQ 371
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 397 L---FARsvSEDCEVAGYRVLKGTEAVIIPYALHRDPRYF-PNPEEFQPER------FFPENaqgrhPYAYVPFSAGPRN 466
Cdd:PLN02426 372 FdskFAA--EDDVLPDGTFVAKGTRVTYHPYAMGRMERIWgPDCLEFKPERwlkngvFVPEN-----PFKYPVFQAGLRV 444
                        410       420
                 ....*....|....*....|....*
gi 187960086 467 CIGQKFAVMEEKTILSCILRHFWIE 491
Cdd:PLN02426 445 CLGKEMALMEMKSVAVAVVRRFDIE 469
PLN02655 PLN02655
ent-kaurene oxidase
286-488 3.66e-29

ent-kaurene oxidase


Pssm-ID: 215354  Cd Length: 466  Bit Score: 119.85  E-value: 3.66e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 286 GRGSApsknkRRAFLDLLLSvtddEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGk 365
Cdd:PLN02655 239 ARGEE-----RDCYLDFLLS----EATHLTDEQLMMLVWEPIIEAADTTLVTTEWAMYELAKNPDKQERLYREIREVCG- 308
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 366 sDRPATVEDLKKLRYLECVIKETLRLFPSVPLF-ARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERF 444
Cdd:PLN02655 309 -DERVTEEDLPNLPYLNAVFHETLRKYSPVPLLpPRFVHEDTTLGGYDIPAGTQIAINIYGCNMDKKRWENPEEWDPERF 387
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 187960086 445 FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF 488
Cdd:PLN02655 388 LGEKYESADMYKTMAFGAGKRVCAGSLQAMLIACMAIARLVQEF 431
PLN02302 PLN02302
ent-kaurenoic acid oxidase
283-496 4.04e-29

ent-kaurenoic acid oxidase


Pssm-ID: 215171  Cd Length: 490  Bit Score: 119.82  E-value: 4.04e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 283 RGDGRGSAPSKNKRraFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDV 362
Cdd:PLN02302 254 RNSRKQNISPRKKD--MLDLLLDAEDENGRKLDDEEIIDLLLMYLNAGHESSGHLTMWATIFLQEHPEVLQKAKAEQEEI 331
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 363 FGKsdRPA-----TVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPE 437
Cdd:PLN02302 332 AKK--RPPgqkglTLKDVRKMEYLSQVIDETLRLINISLTVFREAKTDVEVNGYTIPKGWKVLAWFRQVHMDPEVYPNPK 409
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 187960086 438 EFQPERFFPENAQgrhPYAYVPFSAGPRNCIGQKFAVMEektiLSCILRHFWIESNQKR 496
Cdd:PLN02302 410 EFDPSRWDNYTPK---AGTFLPFGLGSRLCPGNDLAKLE----ISIFLHHFLLGYRLER 461
PLN03112 PLN03112
cytochrome P450 family protein; Provisional
30-474 2.76e-27

cytochrome P450 family protein; Provisional


Pssm-ID: 215583  Cd Length: 514  Bit Score: 114.92  E-value: 2.76e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  30 VLSLLQRVASYARKWQQMRPIPtvaRAYPLVGHALLMKPDGREFFQQIIEyteeyRHMPLLKLWVGPVPMVALYNAENVE 109
Cdd:PLN03112  16 NVLIWRWLNASMRKSLRLPPGP---PRWPIVGNLLQLGPLPHRDLASLCK-----KYGPLVYLRLGSVDAITTDDPELIR 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 110 VILTSSKQIDKSSMYKFLEPWLGLGL----LTSTGNKWRSRRK-----MLTPTFhftiLEDFLDIMNEQANILVKK-LEK 179
Cdd:PLN03112  88 EILLRQDDVFASRPRTLAAVHLAYGCgdvaLAPLGPHWKRMRRicmehLLTTKR----LESFAKHRAEEARHLIQDvWEA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 180 HINQEAFNCFFYITLCALDIICETAMGKN-IGAQSNDDSE------YVRAVYRMSEMIFRRIKMP-WLWLDLwYLMFKEG 251
Cdd:PLN03112 164 AQTGKPVNLREVLGAFSMNNVTRMLLGKQyFGAESAGPKEamefmhITHELFRLLGVIYLGDYLPaWRWLDP-YGCEKKM 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 252 WEHKKSLQILHTftnSVIAERAnemnanedcrgDGRGSAPSKNKRRAFLDLLLSVTDDEGNR-LSHEDIREEVDTFMFEG 330
Cdd:PLN03112 243 REVEKRVDEFHD---KIIDEHR-----------RARSGKLPGGKDMDFVDVLLSLPGENGKEhMDDVEIKALMQDMIAAA 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 331 HDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGkSDRPATVEDLKKLRYLECVIKETLRLFPSVP-LFARSVSEDCEVA 409
Cdd:PLN03112 309 TDTSAVTNEWAMAEVIKNPRVLRKIQEELDSVVG-RNRMVQESDLVHLNYLRCVVRETFRMHPAGPfLIPHESLRATTIN 387
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 410 GYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFP---ENAQGRH--PYAYVPFSAGPRNCIGQKFAV 474
Cdd:PLN03112 388 GYYIPAKTRVFINTHGLGRNTKIWDDVEEFRPERHWPaegSRVEISHgpDFKILPFSAGKRKCPGAPLGV 457
PLN02394 PLN02394
trans-cinnamate 4-monooxygenase
261-469 6.53e-25

trans-cinnamate 4-monooxygenase


Pssm-ID: 215221  Cd Length: 503  Bit Score: 107.90  E-value: 6.53e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 261 LHTFTNSVIAERANEMNANedcrgdgrgsAPSKNKRRAFLDLLLSVtdDEGNRLSHEDIREEVDTFMFEGHDTTAAAINW 340
Cdd:PLN02394 248 LALFKDYFVDERKKLMSAK----------GMDKEGLKCAIDHILEA--QKKGEINEDNVLYIVENINVAAIETTLWSIEW 315
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 341 SLYLLGSNPEVQKKVDHELDDVFGKsDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVS-EDCEVAGYRVLKGTEA 419
Cdd:PLN02394 316 GIAELVNHPEIQKKLRDELDTVLGP-GNQVTEPDTHKLPYLQAVVKETLRLHMAIPLLVPHMNlEDAKLGGYDIPAESKI 394
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 187960086 420 VIIPYALHRDPRYFPNPEEFQPERFFPE----NAQGrHPYAYVPFSAGPRNCIG 469
Cdd:PLN02394 395 LVNAWWLANNPELWKNPEEFRPERFLEEeakvEANG-NDFRFLPFGVGRRSCPG 447
PLN02966 PLN02966
cytochrome P450 83A1
143-473 7.45e-23

cytochrome P450 83A1


Pssm-ID: 178550  Cd Length: 502  Bit Score: 101.75  E-value: 7.45e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 143 WRSRRKM-LTPTFHFTILEDFLDIMNEQANILVKKLEKHINQ-EAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYV 220
Cdd:PLN02966 123 YREIRKMgMNHLFSPTRVATFKHVREEEARRMMDKINKAADKsEVVDISELMLTFTNSVVCRQAFGKKYNEDGEEMKRFI 202
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 221 RAVYRMSEM---IFRRIKMPWLWL--DLWYLM--FKEGWEHKKslqilhTFTNSVIAERANEMNAnedcrgdgrgsapsK 293
Cdd:PLN02966 203 KILYGTQSVlgkIFFSDFFPYCGFldDLSGLTayMKECFERQD------TYIQEVVNETLDPKRV--------------K 262
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 294 NKRRAFLDLLLSVTDDE--GNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFG-KSDRPA 370
Cdd:PLN02966 263 PETESMIDLLMEIYKEQpfASEFTVDNVKAVILDIVVAGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKeKGSTFV 342
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 371 TVEDLKKLRYLECVIKETLRLFPSVPLF-ARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPR-YFPNPEEFQPERFFPEN 448
Cdd:PLN02966 343 TEDDVKNLPYFRALVKETLRIEPVIPLLiPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKeWGPNPDEFRPERFLEKE 422
                        330       340
                 ....*....|....*....|....*.
gi 187960086 449 AQGRHP-YAYVPFSAGPRNCIGQKFA 473
Cdd:PLN02966 423 VDFKGTdYEFIPFGSGRRMCPGMRLG 448
PLN02971 PLN02971
tryptophan N-hydroxylase
299-499 3.13e-22

tryptophan N-hydroxylase


Pssm-ID: 166612  Cd Length: 543  Bit Score: 100.11  E-value: 3.13e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 299 FLDLLLSVTDDEGNRL-SHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKsDRPATVEDLKK 377
Cdd:PLN02971 307 FLDIFISIKDEAGNPLlTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEILHKAMEEIDRVVGK-ERFVQESDIPK 385
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 378 LRYLECVIKETLRLFP----SVPLFARSvseDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQ--- 450
Cdd:PLN02971 386 LNYVKAIIREAFRLHPvaafNLPHVALS---DTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLCFKPERHLNECSEvtl 462
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 187960086 451 GRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-W-IESNQKREEL 499
Cdd:PLN02971 463 TENDLRFISFSTGKRGCAAPALGTAITTMMLARLLQGFkWkLAENETRVEL 513
PLN02169 PLN02169
fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase
319-488 3.32e-22

fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase


Pssm-ID: 177826  Cd Length: 500  Bit Score: 99.70  E-value: 3.32e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 319 IREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKsdrpatvEDLKKLRYLECVIKETLRLFPSVPLF 398
Cdd:PLN02169 302 IRDVIFSLVLAGRDTTSSALTWFFWLLSKHPQVMAKIRHEINTKFDN-------EDLEKLVYLHAALSESMRLYPPLPFN 374
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 399 ARSVSE-DCEVAGYRVLKGTEAVIIPYALHR-DPRYFPNPEEFQPERFFPENAQGRH--PYAYVPFSAGPRNCIGQKFAV 474
Cdd:PLN02169 375 HKAPAKpDVLPSGHKVDAESKIVICIYALGRmRSVWGEDALDFKPERWISDNGGLRHepSYKFMAFNSGPRTCLGKHLAL 454
                        170
                 ....*....|....
gi 187960086 475 MEEKTILSCILRHF 488
Cdd:PLN02169 455 LQMKIVALEIIKNY 468
PLN03234 PLN03234
cytochrome P450 83B1; Provisional
131-467 3.62e-21

cytochrome P450 83B1; Provisional


Pssm-ID: 178773  Cd Length: 499  Bit Score: 96.68  E-value: 3.62e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 131 LGLGLLTSTgnkWRSRRKM-LTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAF----NCFFYITLCaldIICETAM 205
Cdd:PLN03234 113 LGFGQYTAY---YREMRKMcMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTvdlsELLLSFTNC---VVCRQAF 186
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 206 GKNIGAQSNDDSEYVRAVYRMSEMIfrrikMPWLWLDLW-YLMFKEGWEH-----KKSLQILHTFTNSVIAEranEMNAN 279
Cdd:PLN03234 187 GKRYNEYGTEMKRFIDILYETQALL-----GTLFFSDLFpYFGFLDNLTGlsarlKKAFKELDTYLQELLDE---TLDPN 258
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 280 EdcrgdgrgsapSKNKRRAFLDLLLSVTDDE--GNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDH 357
Cdd:PLN03234 259 R-----------PKQETESFIDLLMQIYKDQpfSIKFTHENVKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQD 327
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 358 ELDDVFGKSDRpATVEDLKKLRYLECVIKETLRLFPSVP-LFARSVSEDCEVAGYRVLKGTEAVIIPYALHRD-PRYFPN 435
Cdd:PLN03234 328 EVRNVIGDKGY-VSEEDIPNLPYLKAVIKESLRLEPVIPiLLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDtAAWGDN 406
                        330       340       350
                 ....*....|....*....|....*....|....*.
gi 187960086 436 PEEFQPERFFPENA----QGRHpYAYVPFSAGPRNC 467
Cdd:PLN03234 407 PNEFIPERFMKEHKgvdfKGQD-FELLPFGSGRRMC 441
PLN02196 PLN02196
abscisic acid 8'-hydroxylase
301-488 4.89e-21

abscisic acid 8'-hydroxylase


Pssm-ID: 177847  Cd Length: 463  Bit Score: 95.77  E-value: 4.89e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 301 DLLLSVTDDEGNrLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVF--GKSDRPATVEDLKKL 378
Cdd:PLN02196 248 DLLGSFMGDKEG-LTDEQIADNIIGVIFAARDTTASVLTWILKYLAENPSVLEAVTEEQMAIRkdKEEGESLTWEDTKKM 326
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 379 RYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFfpENAQgrHPYAYV 458
Cdd:PLN02196 327 PLTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSDPGKFDPSRF--EVAP--KPNTFM 402
                        170       180       190
                 ....*....|....*....|....*....|
gi 187960086 459 PFSAGPRNCIGQKFAVMEektiLSCILRHF 488
Cdd:PLN02196 403 PFGNGTHSCPGNELAKLE----ISVLIHHL 428
PLN03018 PLN03018
homomethionine N-hydroxylase
240-502 1.04e-19

homomethionine N-hydroxylase


Pssm-ID: 178592  Cd Length: 534  Bit Score: 92.38  E-value: 1.04e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 240 WLDLWYLmfkEGWEH--KKSLQILHTFTNSVIAERAnemnanEDCRGDGrGSAPSKNkrraFLDLLLSVTDDEGNRL-SH 316
Cdd:PLN03018 247 WLRGWNI---DGQEEraKVNVNLVRSYNNPIIDERV------ELWREKG-GKAAVED----WLDTFITLKDQNGKYLvTP 312
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 317 EDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKsDRPATVEDLKKLRYLECVIKETLRLFPSV- 395
Cdd:PLN03018 313 DEIKAQCVEFCIAAIDNPANNMEWTLGEMLKNPEILRKALKELDEVVGK-DRLVQESDIPNLNYLKACCRETFRIHPSAh 391
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 396 ---PLFARsvsEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRH------PYAYVPFSAGPRN 466
Cdd:PLN03018 392 yvpPHVAR---QDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYEPERHLQGDGITKEvtlvetEMRFVSFSTGRRG 468
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 187960086 467 CIGQKFAVMEEKTILSCILRHFWIESNQKREELGLE 502
Cdd:PLN03018 469 CVGVKVGTIMMVMMLARFLQGFNWKLHQDFGPLSLE 504
PLN00168 PLN00168
Cytochrome P450; Provisional
41-491 1.65e-19

Cytochrome P450; Provisional


Pssm-ID: 215086  Cd Length: 519  Bit Score: 91.55  E-value: 1.65e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  41 ARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEeyRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDK 120
Cdd:PLN00168  27 GRGGKKGRRLPPGPPAVPLLGSLVWLTNSSADVEPLLRRLIA--RYGPVVSLRVGSRLSVFVADRRLAHAALVERGAALA 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 121 SSMYKFLEPWLGLGLLT----STGNKWRS-RRKMLTPTFHFTILEDFLDIMNEQANILVKKL----EKHINQEAFNCFFY 191
Cdd:PLN00168 105 DRPAVASSRLLGESDNTitrsSYGPVWRLlRRNLVAETLHPSRVRLFAPARAWVRRVLVDKLrreaEDAAAPRVVETFQY 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 192 ITLCALDIICetamgknIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWL--WLDLWYLMFKEGWEHKKSL--QILHTFTNS 267
Cdd:PLN00168 185 AMFCLLVLMC-------FGERLDEPAVRAIAAAQRDWLLYVSKKMSVFafFPAVTKHLFRGRLQKALALrrRQKELFVPL 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 268 VIAERANEMNAnedcRGDGRGSAPSKNKRRAFLDLLLSVT-DDEGNR-LSHEDIREEVDTFMFEGHDTTAAAINWSLYLL 345
Cdd:PLN00168 258 IDARREYKNHL----GQGGEPPKKETTFEHSYVDTLLDIRlPEDGDRaLTDDEIVNLCSEFLNAGTDTTSTALQWIMAEL 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 346 GSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPsvP---LFARSVSEDCEVAGYRVLKGTEAVII 422
Cdd:PLN00168 334 VKNPSIQSKLHDEIKAKTGDDQEEVSEEDVHKMPYLKAVVLEGLRKHP--PahfVLPHKAAEDMEVGGYLIPKGATVNFM 411
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 187960086 423 PYALHRDPRYFPNPEEFQPERFFPE------NAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIE 491
Cdd:PLN00168 412 VAEMGRDEREWERPMEFVPERFLAGgdgegvDVTGSREIRMMPFGVGRRICAGLGIAMLHLEYFVANMVREFeWKE 487
PLN02987 PLN02987
Cytochrome P450, family 90, subfamily A
295-496 1.11e-16

Cytochrome P450, family 90, subfamily A


Pssm-ID: 166628  Cd Length: 472  Bit Score: 82.33  E-value: 1.11e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 295 KRRAFLDLLLsvtdDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVE- 373
Cdd:PLN02987 248 KKKDMLAALL----ASDDGFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEw 323
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 374 -DLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGR 452
Cdd:PLN02987 324 sDYKSMPFTQCVVNETLRVANIIGGIFRRAMTDIEVKGYTIPKGWKVFASFRAVHLDHEYFKDARTFNPWRWQSNSGTTG 403
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 187960086 453 HPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHF-WIESNQKR 496
Cdd:PLN02987 404 PSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTRFsWVPAEQDK 448
PLN02500 PLN02500
cytochrome P450 90B1
314-476 2.96e-16

cytochrome P450 90B1


Pssm-ID: 215276  Cd Length: 490  Bit Score: 81.06  E-value: 2.96e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 314 LSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPE-VQKKVDHELDDVFGKSDRPATV---EDLKKLRYLECVIKETL 389
Cdd:PLN02500 275 LSTEQILDLILSLLFAGHETSSVAIALAIFFLQGCPKaVQELREEHLEIARAKKQSGESElnwEDYKKMEFTQCVINETL 354
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 390 RLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQG-------RHPYAYVPFSA 462
Cdd:PLN02500 355 RLGNVVRFLHRKALKDVRYKGYDIPSGWKVLPVIAAVHLDSSLYDQPQLFNPWRWQQNNNRGgssgsssATTNNFMPFGG 434
                        170
                 ....*....|....
gi 187960086 463 GPRNCIGQKFAVME 476
Cdd:PLN02500 435 GPRLCAGSELAKLE 448
PLN02774 PLN02774
brassinosteroid-6-oxidase
295-492 1.59e-15

brassinosteroid-6-oxidase


Pssm-ID: 178373  Cd Length: 463  Bit Score: 78.66  E-value: 1.59e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 295 KRRA----FLDLLLSVTDDEGNR--LSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKS-- 366
Cdd:PLN02774 235 ERRAsgetHTDMLGYLMRKEGNRykLTDEEIIDQIITILYSGYETVSTTSMMAVKYLHDHPKALQELRKEHLAIRERKrp 314
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 367 DRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFp 446
Cdd:PLN02774 315 EDPIDWNDYKSMRFTRAVIFETSRLATIVNGVLRKTTQDMELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWL- 393
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 187960086 447 ENAQGRHPYAYVpFSAGPRNCIGQKFAVMEEKTILS-CILRHFWIES 492
Cdd:PLN02774 394 DKSLESHNYFFL-FGGGTRLCPGKELGIVEISTFLHyFVTRYRWEEV 439
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
303-476 3.98e-15

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 77.07  E-value: 3.98e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  303 LLSVTDDEGNRLSHEDIREEVDTFMF---EGHDTTAAainWSLYLLGSNPEvqkkvdhELDDVFgkSDRpatvedlkklR 379
Cdd:TIGR04538 199 ILCTSEDEGNAMSDTEILALILNILLaatEPADKTLA---YMIYHLLNNPE-------QLNDVL--DDR----------K 256
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  380 YLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYA-YV 458
Cdd:TIGR04538 257 LLRRAIAETLRLHSPVQLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRKDLVNKSAFTGAArHL 336
                         170
                  ....*....|....*...
gi 187960086  459 PFSAGPRNCIGQKFAVME 476
Cdd:TIGR04538 337 AFGSGVHNCVGAAFAKRQ 354
P450_rel_GT_act TIGR04515
P450-derived glycosyltranferase activator; Members of this family resemble cytochrome P450 by ...
384-454 2.11e-10

P450-derived glycosyltranferase activator; Members of this family resemble cytochrome P450 by homolog, but lack a critical heme-binding Cys residue. Members in general are encoded next to a glycosyltransferase gene in a natural products biosynthesis cluster, physically interact with it, and help the glycosyltransferase achieve high specificity while retaining high activity. Many members of this family assist in the attachment of a sugar moiety to a natural product such as a polyketide.


Pssm-ID: 275308  Cd Length: 384  Bit Score: 62.36  E-value: 2.11e-10
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 187960086  384 VIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHP 454
Cdd:TIGR04515 262 AVEETLRHAPPVRLESRVAREDLELAGQRIPAGDHVVVLVAAANRDPAVFADPDRFDPDRPDAAAPLALLP 332
PLN02648 PLN02648
allene oxide synthase
342-475 1.48e-09

allene oxide synthase


Pssm-ID: 215350  Cd Length: 480  Bit Score: 59.95  E-value: 1.48e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 342 LYLLGS-NPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPL-FARSvSEDCEV----AGYRVLK 415
Cdd:PLN02648 296 LKWVGRaGEELQARLAEEVRSAVKAGGGGVTFAALEKMPLVKSVVYEALRIEPPVPFqYGRA-REDFVIeshdAAFEIKK 374
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 187960086 416 GTeavII----PYALhRDPRYFPNPEEFQPERFFPEnaQGRHPYAYVPFSAGP---------RNCIGQKFAVM 475
Cdd:PLN02648 375 GE---MLfgyqPLVT-RDPKVFDRPEEFVPDRFMGE--EGEKLLKYVFWSNGRetesptvgnKQCAGKDFVVL 441
PLN03141 PLN03141
3-epi-6-deoxocathasterone 23-monooxygenase; Provisional
268-488 1.17e-08

3-epi-6-deoxocathasterone 23-monooxygenase; Provisional


Pssm-ID: 215600  Cd Length: 452  Bit Score: 57.06  E-value: 1.17e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 268 VIAERANEMNANEDcrgDGRGSApsknkrRAFLDLLLSvtdDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGS 347
Cdd:PLN03141 213 IIEEKRRAMKNKEE---DETGIP------KDVVDVLLR---DGSDELTDDLISDNMIDMMIPGEDSVPVLMTLAVKFLSD 280
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086 348 NPEVQKKVDHEldDVFGKSDRPATVEDLKKLRYL-----ECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVII 422
Cdd:PLN03141 281 CPVALQQLTEE--NMKLKRLKADTGEPLYWTDYMslpftQNVITETLRMGNIINGVMRKAMKDVEIKGYLIPKGWCVLAY 358
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 187960086 423 PYALHRDPRYFPNPEEFQPERFFPENAQGRhpyAYVPFSAGPRNCIGQKFAVMEektiLSCILRHF 488
Cdd:PLN03141 359 FRSVHLDEENYDNPYQFNPWRWQEKDMNNS---SFTPFGGGQRLCPGLDLARLE----ASIFLHHL 417
CYP450_TxtE TIGR04458
4-nitrotryptophan synthase; Members of this family are cytochrome P450 enzymes that convert ...
387-488 9.81e-04

4-nitrotryptophan synthase; Members of this family are cytochrome P450 enzymes that convert L-tryptophan into L-4-nitrotryptophan. In thaxtomin gene clusters, this enzyme (TxtE) uses nitric acid (NO) derived from arginine by the nitric oxide synthase TxtD, and O2, to perform the tryptophan nitration. L-4-nitrotryptophan is then used as a non-proteinogenic amino acid by non-ribosomal peptide synthases (NRPS).


Pssm-ID: 275251  Cd Length: 403  Bit Score: 41.40  E-value: 9.81e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187960086  387 ETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERffPENaqGRHpyayVPFSAGPRN 466
Cdd:TIGR04458 282 EVVRYNASNQFTWRVATTDVDMGGVRIKAGQAVALFLGAANRDPEVFERPNDFDLDR--PNS--GRH----LSFGQGVHA 353
                          90       100
                  ....*....|....*....|..
gi 187960086  467 CIGQKFAVMEEKTILSCILRHF 488
Cdd:TIGR04458 354 CLGRQIASLQLKWFFVALLGRF 375
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH