NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|29826282|ref|NP_817092.1|]
View 

protein phosphatase 1G [Homo sapiens]

Protein Classification

PP2Cc domain-containing protein (domain architecture ID 10646353)

PP2Cc domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
324-505 8.26e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 209.49  E-value: 8.26e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 324 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 403
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 404 FYKrnknlppeeQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDengelrlLSSIVEELLDQC 483
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-------LQEAAQELVDLA 238
                       170       180
                ....*....|....*....|..
gi 29826282 484 LAPDtsgdgtGCDNMTCIIICF 505
Cdd:cd00143 239 LRRG------SHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
25-110 2.54e-22

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 214625  Cd Length: 252  Bit Score: 97.06  E-value: 2.54e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282     25 LPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQK---ALEDAFLAI 101
Cdd:smart00332   9 LRYGLSSMQGVRKPMEDAHVITPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDveeALRKAFLST 88

                   ....*....
gi 29826282    102 DAKLTTEEV 110
Cdd:smart00332  89 DEEILEELE 97
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
324-505 8.26e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 209.49  E-value: 8.26e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 324 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 403
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 404 FYKrnknlppeeQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDengelrlLSSIVEELLDQC 483
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-------LQEAAQELVDLA 238
                       170       180
                ....*....|....*....|..
gi 29826282 484 LAPDtsgdgtGCDNMTCIIICF 505
Cdd:cd00143 239 LRRG------SHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
318-503 8.22e-62

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 206.46  E-value: 8.22e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    318 EGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLS 397
Cdd:smart00332  91 EILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFV-INGRVNGVLALS 169
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    398 RAIGDHFYKrnknlppeeQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISqrdengelRLLSSIVE 477
Cdd:smart00332 170 RAIGDFFLK---------PYVSAEPDVTVVELTEKDDFLILASDGLWDVLSNQEVVDIVRKHLS--------KDPKEAAK 232
                          170       180
                   ....*....|....*....|....*.
gi 29826282    478 ELLDQCLAPdtsgdgTGCDNMTCIII 503
Cdd:smart00332 233 RLIDLALAR------GSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
325-492 1.74e-58

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 197.57  E-value: 1.74e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   325 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALD-MSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDH 403
Cdd:pfam00481  96 LSSGCTAVVALISGNKLYVANVGDSRAVLCRNGNAIKrLTKDHKPSDEDERRRIRAAGGFVSRNGRVNGVLAVSRAFGDF 175
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   404 FYKrnknlpPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQskiSQRDENGELRLLSsivEELLDQC 483
Cdd:pfam00481 176 ELK------PGEQPVSAEPDITSHTITEDDEFLILACDGLWDVLSDQEVVDLVR---SELSDGGSPMEAA---EELRDEA 243

                  ....*....
gi 29826282   484 LAPDTSGDG 492
Cdd:pfam00481 244 IAYGSEDNI 252
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
327-533 4.26e-35

Protein phosphatase 2c; Provisional


Pssm-ID: 215603  Cd Length: 365  Bit Score: 135.81  E-value: 4.26e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  327 SGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGDHFYK 406
Cdd:PLN03145 166 SGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSKERKRIEASGGYV-YDGYLNGQLNVARALGDWHME 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  407 --RNKNLPPeeqmISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIsqRDENGELRLLSSIVEELLDQcl 484
Cdd:PLN03145 245 gmKGSDGGP----LSAEPELMTTQLTEEDEFLIIGCDGIWDVFRSQNAVDFARRRL--QEHNDPVMCSKELVDEALKR-- 316
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 29826282  485 apdTSGdgtgcDNMTCIIICFKPRNTAELQpeSGKRKLEEVLSTEGAEE 533
Cdd:PLN03145 317 ---KSG-----DNLAVVVVCFQSQPPPNLV--APRPRVQRSISAEGLRE 355
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
325-503 4.48e-30

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 119.00  E-value: 4.48e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 325 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRvnggLNLSRAIGDHF 404
Cdd:COG0631 106 RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRR----NALTRALGDFD 181
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 405 YkrnknlppeeqmisALPDIKVLTLTDDhEFMVIACDGIWNVMSSQEVVDFIQSkisqrdengelrllSSIVEELLDQCL 484
Cdd:COG0631 182 L--------------LEPDITELELEPG-DFLLLCSDGLWDVVSDDEIVDILKN--------------SETPQEAADKLI 232
                       170
                ....*....|....*....
gi 29826282 485 APDTSGDgtGCDNMTCIII 503
Cdd:COG0631 233 ELALEGG--GPDNITVVLV 249
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
25-110 2.54e-22

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 97.06  E-value: 2.54e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282     25 LPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQK---ALEDAFLAI 101
Cdd:smart00332   9 LRYGLSSMQGVRKPMEDAHVITPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDveeALRKAFLST 88

                   ....*....
gi 29826282    102 DAKLTTEEV 110
Cdd:smart00332  89 DEEILEELE 97
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-119 1.01e-17

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 83.14  E-value: 1.01e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  27 YGFSAMQGWRVSMEDAHNCIPELDSE-TAMFSVYDGHGGEEVALYCAKYLPDIIKDQK----AYKEGKLQKALEDAFLAI 101
Cdd:cd00143   3 AGVSDKGGDRKTNEDAVVIKPNLNNEdGGLFGVFDGHGGHAAGEFASKLLVEELLEELeetlTLSEEDIEEALRKAFLRA 82
                        90
                ....*....|....*...
gi 29826282 102 DAKLTTEEVIKELAQIAG 119
Cdd:cd00143  83 DEEILEEAQDEPDDARSG 100
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
27-100 7.15e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 74.69  E-value: 7.15e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    27 YGFSAMQGWRVSMEDAHNCIP-----ELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEG-KLQKALEDAFLA 100
Cdd:pfam00481   3 LGGPRMQGWRKSMEDAHIDLPnlnssSGKDSRSFFAVFDGHGGSEAAKYCGKHLHTILALRRSFLGLeKLEDALRKSFLE 82
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
34-103 3.07e-05

Protein phosphatase 2c; Provisional


Pssm-ID: 215603  Cd Length: 365  Bit Score: 46.06  E-value: 3.07e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   34 GWRVSMEDAHNCIPEL----------DSETAMFSVYDGHGGEEVALYCAKYLPD-IIKDQKAYKEgkLQKALEDAFLAID 102
Cdd:PLN03145  74 GSRSSMEDVYICVDNFmsdfglknseDGPSAFYGVFDGHGGKHAADFACYHLPRfIVEDEDFPRE--IEKVVSSAFLQTD 151

                 .
gi 29826282  103 A 103
Cdd:PLN03145 152 T 152
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
324-505 8.26e-63

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 209.49  E-value: 8.26e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 324 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 403
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 404 FYKrnknlppeeQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDengelrlLSSIVEELLDQC 483
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-------LQEAAQELVDLA 238
                       170       180
                ....*....|....*....|..
gi 29826282 484 LAPDtsgdgtGCDNMTCIIICF 505
Cdd:cd00143 239 LRRG------SHDNITVVVVRL 254
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
318-503 8.22e-62

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 206.46  E-value: 8.22e-62
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    318 EGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLS 397
Cdd:smart00332  91 EILEELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFV-INGRVNGVLALS 169
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    398 RAIGDHFYKrnknlppeeQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISqrdengelRLLSSIVE 477
Cdd:smart00332 170 RAIGDFFLK---------PYVSAEPDVTVVELTEKDDFLILASDGLWDVLSNQEVVDIVRKHLS--------KDPKEAAK 232
                          170       180
                   ....*....|....*....|....*.
gi 29826282    478 ELLDQCLAPdtsgdgTGCDNMTCIII 503
Cdd:smart00332 233 RLIDLALAR------GSKDNITVVVV 252
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
325-492 1.74e-58

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 197.57  E-value: 1.74e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   325 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALD-MSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDH 403
Cdd:pfam00481  96 LSSGCTAVVALISGNKLYVANVGDSRAVLCRNGNAIKrLTKDHKPSDEDERRRIRAAGGFVSRNGRVNGVLAVSRAFGDF 175
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   404 FYKrnknlpPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQskiSQRDENGELRLLSsivEELLDQC 483
Cdd:pfam00481 176 ELK------PGEQPVSAEPDITSHTITEDDEFLILACDGLWDVLSDQEVVDLVR---SELSDGGSPMEAA---EELRDEA 243

                  ....*....
gi 29826282   484 LAPDTSGDG 492
Cdd:pfam00481 244 IAYGSEDNI 252
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
327-533 4.26e-35

Protein phosphatase 2c; Provisional


Pssm-ID: 215603  Cd Length: 365  Bit Score: 135.81  E-value: 4.26e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  327 SGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGDHFYK 406
Cdd:PLN03145 166 SGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSKERKRIEASGGYV-YDGYLNGQLNVARALGDWHME 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  407 --RNKNLPPeeqmISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIsqRDENGELRLLSSIVEELLDQcl 484
Cdd:PLN03145 245 gmKGSDGGP----LSAEPELMTTQLTEEDEFLIIGCDGIWDVFRSQNAVDFARRRL--QEHNDPVMCSKELVDEALKR-- 316
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 29826282  485 apdTSGdgtgcDNMTCIIICFKPRNTAELQpeSGKRKLEEVLSTEGAEE 533
Cdd:PLN03145 317 ---KSG-----DNLAVVVVCFQSQPPPNLV--APRPRVQRSISAEGLRE 355
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
325-503 4.48e-30

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 119.00  E-value: 4.48e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 325 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRvnggLNLSRAIGDHF 404
Cdd:COG0631 106 RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRR----NALTRALGDFD 181
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282 405 YkrnknlppeeqmisALPDIKVLTLTDDhEFMVIACDGIWNVMSSQEVVDFIQSkisqrdengelrllSSIVEELLDQCL 484
Cdd:COG0631 182 L--------------LEPDITELELEPG-DFLLLCSDGLWDVVSDDEIVDILKN--------------SETPQEAADKLI 232
                       170
                ....*....|....*....
gi 29826282 485 APDTSGDgtGCDNMTCIII 503
Cdd:COG0631 233 ELALEGG--GPDNITVVLV 249
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
324-506 4.27e-25

protein phosphatase 2C; Provisional


Pssm-ID: 240318  Cd Length: 381  Bit Score: 107.16  E-value: 4.27e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  324 GSDSGTTAVVALIRGK-QLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVtMDGRVNGGLNLSRAIGD 402
Cdd:PTZ00224 101 GREGGSTGTFCVIMKDvHLQVGNVGDSRVLVCRDGKLVFATEDHKPNNPGERQRIEACGGRV-VSNRVDGDLAVSRAFGD 179
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  403 HFYKRNKNLPPEEQMISALPDIKVLTLtDDHEFMVIACDGIWN-VMSSQEVVDFIQSKISQRDENGELRllSSIVEELLD 481
Cdd:PTZ00224 180 RSFKVKGTGDYLEQKVIAVPDVTHLTC-QSNDFIILACDGVFEgNFSNEEVVAFVKEQLETCDDLAVVA--GRVCDEAIR 256
                        170       180
                 ....*....|....*....|....*
gi 29826282  482 QclapdtsgdGTGcDNMTCIIICFK 506
Cdd:PTZ00224 257 R---------GSK-DNISCLIVQLK 271
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
25-110 2.54e-22

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 97.06  E-value: 2.54e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282     25 LPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQK---ALEDAFLAI 101
Cdd:smart00332   9 LRYGLSSMQGVRKPMEDAHVITPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDveeALRKAFLST 88

                   ....*....
gi 29826282    102 DAKLTTEEV 110
Cdd:smart00332  89 DEEILEELE 97
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
27-119 1.01e-17

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 83.14  E-value: 1.01e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282  27 YGFSAMQGWRVSMEDAHNCIPELDSE-TAMFSVYDGHGGEEVALYCAKYLPDIIKDQK----AYKEGKLQKALEDAFLAI 101
Cdd:cd00143   3 AGVSDKGGDRKTNEDAVVIKPNLNNEdGGLFGVFDGHGGHAAGEFASKLLVEELLEELeetlTLSEEDIEEALRKAFLRA 82
                        90
                ....*....|....*...
gi 29826282 102 DAKLTTEEVIKELAQIAG 119
Cdd:cd00143  83 DEEILEEAQDEPDDARSG 100
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
27-100 7.15e-15

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 306885  Cd Length: 252  Bit Score: 74.69  E-value: 7.15e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282    27 YGFSAMQGWRVSMEDAHNCIP-----ELDSETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEG-KLQKALEDAFLA 100
Cdd:pfam00481   3 LGGPRMQGWRKSMEDAHIDLPnlnssSGKDSRSFFAVFDGHGGSEAAKYCGKHLHTILALRRSFLGLeKLEDALRKSFLE 82
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
34-103 3.07e-05

Protein phosphatase 2c; Provisional


Pssm-ID: 215603  Cd Length: 365  Bit Score: 46.06  E-value: 3.07e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29826282   34 GWRVSMEDAHNCIPEL----------DSETAMFSVYDGHGGEEVALYCAKYLPD-IIKDQKAYKEgkLQKALEDAFLAID 102
Cdd:PLN03145  74 GSRSSMEDVYICVDNFmsdfglknseDGPSAFYGVFDGHGGKHAADFACYHLPRfIVEDEDFPRE--IEKVVSSAFLQTD 151

                 .
gi 29826282  103 A 103
Cdd:PLN03145 152 T 152
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH