NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|16758120|ref|NP_445842.1|]
View 

interleukin-12 subunit alpha precursor [Rattus norvegicus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IL12 super family cl03854
Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer ...
17-215 1.59e-109

Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer consisting of a 35kDa alpha subunit and a 40kDa beta subunit. It is involved in the stimulation and maintenance of Th1 cellular immune responses, including the normal host defense against various intracellular pathogens, such as Leishmania, Toxoplasma, measles virus and HIV. IL-12 also has an important role in pathological Th1 responses, such as in inflammatory bowel disease and multiple sclerosis. Suppression of IL-12 activity in such diseases may have therapeutic benefit. On the other hand, administration of recombinant IL-12 may have therapeutic benefit in conditions associated with pathological Th2 responses.


The actual alignment was detected with superfamily member pfam03039:

Pssm-ID: 308594  Cd Length: 214  Bit Score: 317.15  E-value: 1.59e-109
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    17 NHLTSARVIPVSGP----AKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESC 92
Cdd:pfam03039  12 SHLSLARNLPVSTPepgmFQCLNHSQNLLEAVSETLQKAREKLEHYSCTSEEIDHEDITKDKTSTVKACLPLELIKNESC 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    93 LATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGET 172
Cdd:pfam03039  92 LASRETSFITNGSCLTSGKTSFMMTLCLSSIYEDLKMYQVEFKAINATLLMDPKRQISLDQNMLAAIDELMQALNFNSET 171
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16758120   173 LHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS 215
Cdd:pfam03039 172 VPQKPSPEEPDFYKTKVKLCILLHAFRIRAVTIDRVMSYLNSS 214
 
Name Accession Description Interval E-value
IL12 pfam03039
Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer ...
17-215 1.59e-109

Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer consisting of a 35kDa alpha subunit and a 40kDa beta subunit. It is involved in the stimulation and maintenance of Th1 cellular immune responses, including the normal host defense against various intracellular pathogens, such as Leishmania, Toxoplasma, measles virus and HIV. IL-12 also has an important role in pathological Th1 responses, such as in inflammatory bowel disease and multiple sclerosis. Suppression of IL-12 activity in such diseases may have therapeutic benefit. On the other hand, administration of recombinant IL-12 may have therapeutic benefit in conditions associated with pathological Th2 responses.


Pssm-ID: 308594  Cd Length: 214  Bit Score: 317.15  E-value: 1.59e-109
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    17 NHLTSARVIPVSGP----AKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESC 92
Cdd:pfam03039  12 SHLSLARNLPVSTPepgmFQCLNHSQNLLEAVSETLQKAREKLEHYSCTSEEIDHEDITKDKTSTVKACLPLELIKNESC 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    93 LATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGET 172
Cdd:pfam03039  92 LASRETSFITNGSCLTSGKTSFMMTLCLSSIYEDLKMYQVEFKAINATLLMDPKRQISLDQNMLAAIDELMQALNFNSET 171
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16758120   173 LHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS 215
Cdd:pfam03039 172 VPQKPSPEEPDFYKTKVKLCILLHAFRIRAVTIDRVMSYLNSS 214
 
Name Accession Description Interval E-value
IL12 pfam03039
Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer ...
17-215 1.59e-109

Interleukin-12 alpha subunit; Interleukin 12 (IL-12) is a disulphide-bonded heterodimer consisting of a 35kDa alpha subunit and a 40kDa beta subunit. It is involved in the stimulation and maintenance of Th1 cellular immune responses, including the normal host defense against various intracellular pathogens, such as Leishmania, Toxoplasma, measles virus and HIV. IL-12 also has an important role in pathological Th1 responses, such as in inflammatory bowel disease and multiple sclerosis. Suppression of IL-12 activity in such diseases may have therapeutic benefit. On the other hand, administration of recombinant IL-12 may have therapeutic benefit in conditions associated with pathological Th2 responses.


Pssm-ID: 308594  Cd Length: 214  Bit Score: 317.15  E-value: 1.59e-109
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    17 NHLTSARVIPVSGP----AKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESC 92
Cdd:pfam03039  12 SHLSLARNLPVSTPepgmFQCLNHSQNLLEAVSETLQKAREKLEHYSCTSEEIDHEDITKDKTSTVKACLPLELIKNESC 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16758120    93 LATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGET 172
Cdd:pfam03039  92 LASRETSFITNGSCLTSGKTSFMMTLCLSSIYEDLKMYQVEFKAINATLLMDPKRQISLDQNMLAAIDELMQALNFNSET 171
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 16758120   173 LHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS 215
Cdd:pfam03039 172 VPQKPSPEEPDFYKTKVKLCILLHAFRIRAVTIDRVMSYLNSS 214
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH