NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|256985213|ref|NP_084372.2|]
View 

probable ATP-dependent RNA helicase DDX52 [Mus musculus]

Protein Classification

DEAD/DEAH box helicase (domain architecture ID 12783038)

DEAD/DEAH box containing ATP-dependent helicase catalyzes the unwinding of DNA or RNA; such as Bacillus cereus ATP-dependent RNA helicase DbpA that is involved in the assembly of the 50S ribosomal subunit

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DEADc_DDX52 cd17957
DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ...
177-378 2.96e-113

DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ubiquitously expressed in testis, endometrium, and other tissues in humans. DDX52 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


:

Pssm-ID: 350715 [Multi-domain]  Cd Length: 198  Bit Score: 336.10  E-value: 2.96e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQP-TNKGFRALVISPTRELASQIHREL 255
Cdd:cd17957    1 LLNNLEESGYREPTPIQMQAIPILLHGRDLLACAPTGSGKTLAFLIPILQKLGKPrKKKGLRALILAPTRELASQIYREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 256 IKISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQ 335
Cdd:cd17957   81 LKLSKGTGLRIVLLSKSLEAKAKDGPKSITKYDILVSTPLRLVFLLKQGP--IDLSSVEYLVLDEADKLFE---PGFREQ 155
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 256985213 336 LASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIG 378
Cdd:cd17957  156 TDEILAACTNPNLQRSLFSATIPSEVEELARSVMKDPIRIIVG 198
SrmB COG0513
Superfamily II DNA and RNA helicase [Replication, recombination and repair];
137-597 1.72e-108

Superfamily II DNA and RNA helicase [Replication, recombination and repair];


:

Pssm-ID: 223587 [Multi-domain]  Cd Length: 513  Bit Score: 335.22  E-value: 1.72e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 137 RKEKVNFFRNKHKIHV-QGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSG 215
Cdd:COG0513    3 REDYDRFVKLKSAHNVaLSRGEEKTPPEFA----SLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 216 KTLAFSIPILMQL-KQPTNKGFRALVISPTRELASQIHRELIKISEGT-GFRIHMIH-----KAAIAAKKFGPksskkfD 288
Cdd:COG0513   79 KTAAFLLPLLQKIlKSVERKYVSALILAPTRELAVQIAEELRKLGKNLgGLRVAVVYggvsiRKQIEALKRGV------D 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 289 ILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDGktgFREQLASIFLACtSPKVRRAMFSATFAYDVEQWCKLN 368
Cdd:COG0513  153 IVVATPGRLLDLIKRG--KLDLSGVETLVLDEADRMLDMG---FIDDIEKILKAL-PPDRQTLLFSATMPDDIRELARRY 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 369 LDNVVSVSIGARNS--AVETVEQELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAE 446
Cdd:COG0513  227 LNDPVEIEVSVEKLerTLKKIKQFYLEVESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGD 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 447 RTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTED-DKPLL 525
Cdd:COG0513  307 LPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEeEVKKL 386
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 256985213 526 RSVANVIQQAGcPVPEYIKGFQKLLSKQKKKMIKKPLERESICTTPKYFLEQAKQKKVAGQNSKKKETLKEK 597
Cdd:COG0513  387 KRIEKRLERKL-PSAVLLPLDEPEDAKLLKTTRPGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLAN 457
 
Name Accession Description Interval E-value
DEADc_DDX52 cd17957
DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ...
177-378 2.96e-113

DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ubiquitously expressed in testis, endometrium, and other tissues in humans. DDX52 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350715 [Multi-domain]  Cd Length: 198  Bit Score: 336.10  E-value: 2.96e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQP-TNKGFRALVISPTRELASQIHREL 255
Cdd:cd17957    1 LLNNLEESGYREPTPIQMQAIPILLHGRDLLACAPTGSGKTLAFLIPILQKLGKPrKKKGLRALILAPTRELASQIYREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 256 IKISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQ 335
Cdd:cd17957   81 LKLSKGTGLRIVLLSKSLEAKAKDGPKSITKYDILVSTPLRLVFLLKQGP--IDLSSVEYLVLDEADKLFE---PGFREQ 155
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 256985213 336 LASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIG 378
Cdd:cd17957  156 TDEILAACTNPNLQRSLFSATIPSEVEELARSVMKDPIRIIVG 198
SrmB COG0513
Superfamily II DNA and RNA helicase [Replication, recombination and repair];
137-597 1.72e-108

Superfamily II DNA and RNA helicase [Replication, recombination and repair];


Pssm-ID: 223587 [Multi-domain]  Cd Length: 513  Bit Score: 335.22  E-value: 1.72e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 137 RKEKVNFFRNKHKIHV-QGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSG 215
Cdd:COG0513    3 REDYDRFVKLKSAHNVaLSRGEEKTPPEFA----SLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 216 KTLAFSIPILMQL-KQPTNKGFRALVISPTRELASQIHRELIKISEGT-GFRIHMIH-----KAAIAAKKFGPksskkfD 288
Cdd:COG0513   79 KTAAFLLPLLQKIlKSVERKYVSALILAPTRELAVQIAEELRKLGKNLgGLRVAVVYggvsiRKQIEALKRGV------D 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 289 ILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDGktgFREQLASIFLACtSPKVRRAMFSATFAYDVEQWCKLN 368
Cdd:COG0513  153 IVVATPGRLLDLIKRG--KLDLSGVETLVLDEADRMLDMG---FIDDIEKILKAL-PPDRQTLLFSATMPDDIRELARRY 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 369 LDNVVSVSIGARNS--AVETVEQELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAE 446
Cdd:COG0513  227 LNDPVEIEVSVEKLerTLKKIKQFYLEVESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGD 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 447 RTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTED-DKPLL 525
Cdd:COG0513  307 LPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEeEVKKL 386
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 256985213 526 RSVANVIQQAGcPVPEYIKGFQKLLSKQKKKMIKKPLERESICTTPKYFLEQAKQKKVAGQNSKKKETLKEK 597
Cdd:COG0513  387 KRIEKRLERKL-PSAVLLPLDEPEDAKLLKTTRPGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLAN 457
PLN00206 PLN00206
DEAD-box ATP-dependent RNA helicase; Provisional
130-540 4.21e-79

DEAD-box ATP-dependent RNA helicase; Provisional


Pssm-ID: 215103 [Multi-domain]  Cd Length: 518  Bit Score: 258.95  E-value: 4.21e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 130 SGKLEHLRKEKVNFFRNKHKIHVQGTDLPDPIATFQQLdqeyKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLAS 209
Cdd:PLN00206  89 PGSTSGLSSSQAELLRRKLEIHVKGEAVPPPILSFSSC----GLPPKLLLNLETAGYEFPTPIQMQAIPAALSGRSLLVS 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 210 APTGSGKTLAFSIPILMQLKQ------PTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFgPKS 283
Cdd:PLN00206 165 ADTGSGKTASFLVPIISRCCTirsghpSEQRNPLAMVLTPTRELCVQVEDQAKVLGKGLPFKTALVVGGDAMPQQL-YRI 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 284 SKKFDILVTTPNRLIYLL-KQDppgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSPKVrrAMFSATFAYDVE 362
Cdd:PLN00206 244 QQGVELIVGTPGRLIDLLsKHD---IELDNVSVLVLDEVDCMLE---RGFRDQVMQIFQALSQPQV--LLFSATVSPEVE 315
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 363 QWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKG-FKPPVLVFVQSIERAkELFHELI--YEGIN 439
Cdd:PLN00206 316 KFASSLAKDIILISIGNPNRPNKAVKQLAIWVETKQKKQKLFDILKSKQhFKPPAVVFVSSRLGA-DLLANAItvVTGLK 394
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 440 VDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTE 519
Cdd:PLN00206 395 ALSIHGEKSMKERREVMKSFLVGEVPVIVATGVLGRGVDLLRVRQVIIFDMPNTIKEYIHQIGRASRMGEKGTAIVFVNE 474
                        410       420
                 ....*....|....*....|.
gi 256985213 520 DDKPLLRSVANVIQQAGCPVP 540
Cdd:PLN00206 475 EDRNLFPELVALLKSSGAAIP 495
PRK10590 PRK10590
ATP-dependent RNA helicase RhlE; Provisional
173-534 4.80e-66

ATP-dependent RNA helicase RhlE; Provisional


Pssm-ID: 236722 [Multi-domain]  Cd Length: 456  Bit Score: 222.38  E-value: 4.80e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL--KQPTNKG---FRALVISPTREL 247
Cdd:PRK10590   8 LSPDILRAVAEQGYREPTPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLLQHLitRQPHAKGrrpVRALILTPTREL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIHMIhkaaiaakkFG-----PKSSK---KFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVD 319
Cdd:PRK10590  88 AAQIGENVRDYSKYLNIRSLVV---------FGgvsinPQMMKlrgGVDVLVATPGRLLDLEHQN--AVKLDQVEILVLD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 320 ESDKLFEdgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETG 399
Cdd:PRK10590 157 EADRMLD---MGFIHDIRRV-LAKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEIEVARRNTASEQVTQHVHFVDKKRK 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 400 KLLaMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDF 479
Cdd:PRK10590 233 REL-LSQMIGKGNWQQVLVFTRTKHGANHLAEQLNKDGIRSAAIHGNKSQGARTRALADFKSGDIRVLVATDIAARGLDI 311
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 256985213 480 KGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVANVIQQ 534
Cdd:PRK10590 312 EELPHVVNYELPNVPEDYVHRIGRTGRAAATGEALSLVCVDEHKLLRDIEKLLKK 366
SF2_C_DEAD cd18787
C-terminal helicase domain of the DEAD box helicases; DEAD-box helicases comprise a diverse ...
387-517 2.69e-55

C-terminal helicase domain of the DEAD box helicases; DEAD-box helicases comprise a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis, and RNA degradation. They are superfamily (SF)2 helicases that, similar to SF1, do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350174 [Multi-domain]  Cd Length: 131  Bit Score: 183.09  E-value: 2.69e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 387 VEQELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWV 466
Cdd:cd18787    1 IKQLYVVVEEEEKKLLLLLLLLEKLKPGKAIIFVNTKKRVDRLAELLEELGIKVAALHGDLSQEERERALKKFRSGKVRV 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 256985213 467 LICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFF 517
Cdd:cd18787   81 LVATDVAARGLDIPGVDHVINYDLPRDAEDYVHRIGRTGRAGRKGTAITFV 131
DEAD pfam00270
DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. ...
190-363 7.14e-45

DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.


Pssm-ID: 333969 [Multi-domain]  Cd Length: 165  Bit Score: 156.62  E-value: 7.14e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  190 TPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKqPTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMI 269
Cdd:pfam00270   1 TPIQAQAIPAILEGRDVLVQAPTGSGKTLAFLLPALEALN-KKDNGPQALVLAPTRELAEQIYEELKKLGKGLGLKVASL 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  270 HKAAIAAKKFgpKSSKKFDILVTTPNRLIYLLKQDPPgidLTNVEWLVVDESDKLFEDgktGFREQLASIfLACTSPKVR 349
Cdd:pfam00270  80 LGGDSRKEQL--EKLKGPDILVGTPGRLLDLLRERKL---LKNLKLLVLDEAHRLLDM---GFGPDLEEI-LRRLPKKRQ 150
                         170
                  ....*....|....
gi 256985213  350 RAMFSATFAYDVEQ 363
Cdd:pfam00270 151 ILLLSATLPRNLED 164
DEXDc smart00487
DEAD-like helicases superfamily;
181-390 8.58e-44

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 154.96  E-value: 8.58e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   181 ILDAGFQVPTPIQMQAIPVMLHG-RELLASAPTGSGKTLAFSIPILMQLKQptNKGFRALVISPTRELASQIHRELIKIS 259
Cdd:smart00487   1 IEKFGFEPLRPYQKEAIEALLSGlRDVILAAPTGSGKTLAALLPALEALKR--GKGGRVLVLVPTRELAEQWAEELKKLG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   260 EGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEDgktGFREQLASI 339
Cdd:smart00487  79 PSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDK--LSLSNVDLVILDEAHRLLDG---GFGDQLEKL 153
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 256985213   340 fLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGarNSAVETVEQE 390
Cdd:smart00487 154 -LKLLPKNVQLLLLSATPPEEIENLLELFLNDPVFIDVG--FTPLEPIEQF 201
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
399-508 3.85e-34

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 333970 [Multi-domain]  Cd Length: 111  Bit Score: 125.01  E-value: 3.85e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  399 GKLLAMRELVK-KGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGI 477
Cdd:pfam00271   1 EKLEALLELLKlKERGGKVLIFSNTKKRLELLELLLEKEGIKVARLHGDLSQEEREEILEDFRNGKIDVLVATDVAARGL 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 256985213  478 DFKGVNLVINYDFPTSSVEYIHRIGRTGRAG 508
Cdd:pfam00271  81 DLPDVNLVINYDLPWNPASYIQRIGRAGRAG 111
Lhr COG1201
Lhr-like helicase [Replication, recombination and repair];
177-529 9.78e-31

Lhr-like helicase [Replication, recombination and repair];


Pssm-ID: 224122 [Multi-domain]  Cd Length: 814  Bit Score: 127.76  E-value: 9.78e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL----KQPTNKGFRALVISPTRELASQIH 252
Cdd:COG1201   11 RVREWFKRKFTSLTPPQRYAIPEIHSGENVLIIAPTGSGKTEAAFLPVINELlslgKGKLEDGIYALYISPLKALNNDIR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTGFRIHMIHKAAIAAKKfgPKSSKKF-DILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDESDKLFEDgKTG 331
Cdd:COG1201   91 RRLEEPLRELGIEVAVRHGDTPQSEK--QKMLKNPpHILITTPESLAILLNSPKFRELLRDVRYVIVDEIHALAES-KRG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 332 frEQLASIF--LACTSPKVRRAMFSATFA--YDVEQWckLNLDN----VVSVSIGARNS-AVETVEQELLFVGSET-GKL 401
Cdd:COG1201  168 --VQLALSLerLRELAGDFQRIGLSATVGppEEVAKF--LVGFGdpceIVDVSAAKKLEiKVISPVEDLIYDEELWaALY 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 402 LAMRELVKKgfKPPVLVFVQSIERAKELFHELIYEG-INVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFK 480
Cdd:COG1201  244 ERIAELVKK--HRTTLIFTNTRSGAERLAFRLKKLGpDIIEVHHGSLSRELRLEVEERLKEGELKAVVATSSLELGIDIG 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 256985213 481 GVNLVINYDFPTSSVEYIHRIGRTG-RAGNRGKAVtFFTEDDKPLLRSVA 529
Cdd:COG1201  322 DIDLVIQLGSPKSVNRFLQRIGRAGhRLGEVSKGI-IIAEDRDDLLECLV 370
HELICc smart00490
helicase superfamily c-terminal domain;
427-508 1.67e-27

helicase superfamily c-terminal domain;


Pssm-ID: 197757 [Multi-domain]  Cd Length: 82  Bit Score: 105.37  E-value: 1.67e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   427 KELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGR 506
Cdd:smart00490   1 EELAELLKELGIKVARLHGGLSQEEREEILDKFNNGKIKVLVATDVAERGLDLPGVDLVIIYDLPWSPASYIQRIGRAGR 80

                   ..
gi 256985213   507 AG 508
Cdd:smart00490  81 AG 82
DEXH_lig_assoc TIGR04121
DEXH box helicase, DNA ligase-associated; Members of this protein family are DEAD/DEAH box ...
189-516 7.43e-20

DEXH box helicase, DNA ligase-associated; Members of this protein family are DEAD/DEAH box helicases found associated with a bacterial ATP-dependent DNA ligase, part of a four-gene system that occurs in about 12 % of prokaryotic reference genomes. The actual motif in this family is DE[VILW]H.


Pssm-ID: 274994 [Multi-domain]  Cd Length: 804  Bit Score: 93.77  E-value: 7.43e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  189 PTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPTNKGFRALVISPTRELASQIHRELIKISEGTG-- 263
Cdd:TIGR04121  14 PRPFQLEMWAAALEGRSGLLIAPTGSGKTLAGFLPSLIDLagpEAPKEKGLHTLYITPLRALAVDIARNLQAPIEELGlp 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  264 FRIHM------IHKAAiAAKKFGPksskkfDILVTTPNRLIYLLKQ-DPPGIdLTNVEWLVVDESDKLFEdGKTGFREQL 336
Cdd:TIGR04121  94 IRVETrtgdtsSSERA-RQRKKPP------DILLTTPESLALLLSYpDAARL-FKDLRCVVVDEWHELAG-SKRGDQLEL 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  337 ASIFLACTSPKVRRAMFSATFAyDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSET-----GKL-LAMRELVKK 410
Cdd:TIGR04121 165 ALARLRRLAPGLRRWGLSATIG-NLEEARRVLLGVGGAPAVLVRGKLPKAIEVISLLPESEErfpwaGHLgLRALPEVYA 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  411 GFKP--PVLVFVQSIERAKELFHELIYegINVD---VI---HAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGV 482
Cdd:TIGR04121 244 EIDQarTTLVFTNTRSQAELWFQALWE--ANPEfalPIalhHGSLDREQRRWVEAAMAAGRLRAVVCTSSLDLGVDFGPV 321
                         330       340       350
                  ....*....|....*....|....*....|....
gi 256985213  483 NLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTF 516
Cdd:TIGR04121 322 DLVIQIGSPKGVARLLQRAGRSNHRPGEPSRALL 355
mfd TIGR00580
transcription-repair coupling factor (mfd); All proteins in this family for which functions ...
420-524 3.22e-07

transcription-repair coupling factor (mfd); All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273152 [Multi-domain]  Cd Length: 926  Bit Score: 53.13  E-value: 3.22e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  420 VQSIERAKELFHELIYEgINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIH 499
Cdd:TIGR00580 670 IESIEKLATQLRELVPE-ARIAIAHGQMTENELEEVMLEFYKGEFQVLVCTTIIETGIDIPNANTIIIERADKFGLAQLY 748
                          90       100
                  ....*....|....*....|....*.
gi 256985213  500 RI-GRTGRAGNRGKAVtFFTEDDKPL 524
Cdd:TIGR00580 749 QLrGRVGRSKKKAYAY-LLYPHQKAL 773
 
Name Accession Description Interval E-value
DEADc_DDX52 cd17957
DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ...
177-378 2.96e-113

DEAD-box helicase domain of DEAD box protein 52; DDX52 (also called ROK1 and HUSSY19) is ubiquitously expressed in testis, endometrium, and other tissues in humans. DDX52 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350715 [Multi-domain]  Cd Length: 198  Bit Score: 336.10  E-value: 2.96e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQP-TNKGFRALVISPTRELASQIHREL 255
Cdd:cd17957    1 LLNNLEESGYREPTPIQMQAIPILLHGRDLLACAPTGSGKTLAFLIPILQKLGKPrKKKGLRALILAPTRELASQIYREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 256 IKISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQ 335
Cdd:cd17957   81 LKLSKGTGLRIVLLSKSLEAKAKDGPKSITKYDILVSTPLRLVFLLKQGP--IDLSSVEYLVLDEADKLFE---PGFREQ 155
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 256985213 336 LASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIG 378
Cdd:cd17957  156 TDEILAACTNPNLQRSLFSATIPSEVEELARSVMKDPIRIIVG 198
SrmB COG0513
Superfamily II DNA and RNA helicase [Replication, recombination and repair];
137-597 1.72e-108

Superfamily II DNA and RNA helicase [Replication, recombination and repair];


Pssm-ID: 223587 [Multi-domain]  Cd Length: 513  Bit Score: 335.22  E-value: 1.72e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 137 RKEKVNFFRNKHKIHV-QGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSG 215
Cdd:COG0513    3 REDYDRFVKLKSAHNVaLSRGEEKTPPEFA----SLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 216 KTLAFSIPILMQL-KQPTNKGFRALVISPTRELASQIHRELIKISEGT-GFRIHMIH-----KAAIAAKKFGPksskkfD 288
Cdd:COG0513   79 KTAAFLLPLLQKIlKSVERKYVSALILAPTRELAVQIAEELRKLGKNLgGLRVAVVYggvsiRKQIEALKRGV------D 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 289 ILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDGktgFREQLASIFLACtSPKVRRAMFSATFAYDVEQWCKLN 368
Cdd:COG0513  153 IVVATPGRLLDLIKRG--KLDLSGVETLVLDEADRMLDMG---FIDDIEKILKAL-PPDRQTLLFSATMPDDIRELARRY 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 369 LDNVVSVSIGARNS--AVETVEQELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAE 446
Cdd:COG0513  227 LNDPVEIEVSVEKLerTLKKIKQFYLEVESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGD 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 447 RTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTED-DKPLL 525
Cdd:COG0513  307 LPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEeEVKKL 386
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 256985213 526 RSVANVIQQAGcPVPEYIKGFQKLLSKQKKKMIKKPLERESICTTPKYFLEQAKQKKVAGQNSKKKETLKEK 597
Cdd:COG0513  387 KRIEKRLERKL-PSAVLLPLDEPEDAKLLKTTRPGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLAN 457
PLN00206 PLN00206
DEAD-box ATP-dependent RNA helicase; Provisional
130-540 4.21e-79

DEAD-box ATP-dependent RNA helicase; Provisional


Pssm-ID: 215103 [Multi-domain]  Cd Length: 518  Bit Score: 258.95  E-value: 4.21e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 130 SGKLEHLRKEKVNFFRNKHKIHVQGTDLPDPIATFQQLdqeyKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLAS 209
Cdd:PLN00206  89 PGSTSGLSSSQAELLRRKLEIHVKGEAVPPPILSFSSC----GLPPKLLLNLETAGYEFPTPIQMQAIPAALSGRSLLVS 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 210 APTGSGKTLAFSIPILMQLKQ------PTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFgPKS 283
Cdd:PLN00206 165 ADTGSGKTASFLVPIISRCCTirsghpSEQRNPLAMVLTPTRELCVQVEDQAKVLGKGLPFKTALVVGGDAMPQQL-YRI 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 284 SKKFDILVTTPNRLIYLL-KQDppgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSPKVrrAMFSATFAYDVE 362
Cdd:PLN00206 244 QQGVELIVGTPGRLIDLLsKHD---IELDNVSVLVLDEVDCMLE---RGFRDQVMQIFQALSQPQV--LLFSATVSPEVE 315
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 363 QWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKG-FKPPVLVFVQSIERAkELFHELI--YEGIN 439
Cdd:PLN00206 316 KFASSLAKDIILISIGNPNRPNKAVKQLAIWVETKQKKQKLFDILKSKQhFKPPAVVFVSSRLGA-DLLANAItvVTGLK 394
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 440 VDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTE 519
Cdd:PLN00206 395 ALSIHGEKSMKERREVMKSFLVGEVPVIVATGVLGRGVDLLRVRQVIIFDMPNTIKEYIHQIGRASRMGEKGTAIVFVNE 474
                        410       420
                 ....*....|....*....|.
gi 256985213 520 DDKPLLRSVANVIQQAGCPVP 540
Cdd:PLN00206 475 EDRNLFPELVALLKSSGAAIP 495
PTZ00110 PTZ00110
helicase; Provisional
136-540 3.41e-69

helicase; Provisional


Pssm-ID: 240273 [Multi-domain]  Cd Length: 545  Bit Score: 233.51  E-value: 3.41e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 136 LRKEKVNFFRNKHKIH-VQGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGS 214
Cdd:PTZ00110 103 LSSKEVDEIRKEKEITiIAGENVPKPVVSFE----YTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGS 178
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 215 GKTLAFSIPILMQLK-QPTNK---GFRALVISPTRELASQIHRELIKIseGTGFRIHmiHKAAiaakkFG--PKSSKKF- 287
Cdd:PTZ00110 179 GKTLAFLLPAIVHINaQPLLRygdGPIVLVLAPTRELAEQIREQCNKF--GASSKIR--NTVA-----YGgvPKRGQIYa 249
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 288 -----DILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVE 362
Cdd:PTZ00110 250 lrrgvEILIACPGRLIDFLESNV--TNLRRVTYLVLDEADRMLD---MGFEPQIRKI-VSQIRPDRQTLMWSATWPKEVQ 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 363 QWCK-LNLDNVVSVSIGARN-SAVETVEQELlFVGSETGKLLAMRELVKKGFKP--PVLVFVQSIERAKELFHELIYEGI 438
Cdd:PTZ00110 324 SLARdLCKEEPVHVNVGSLDlTACHNIKQEV-FVVEEHEKRGKLKMLLQRIMRDgdKILIFVETKKGADFLTKELRLDGW 402
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 439 NVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFT 518
Cdd:PTZ00110 403 PALCIHGDKKQEERTWVLNEFKTGKSPIMIATDVASRGLDVKDVKYVINFDFPNQIEDYVHRIGRTGRAGAKGASYTFLT 482
                        410       420
                 ....*....|....*....|..
gi 256985213 519 EDDKPLLRSVANVIQQAGCPVP 540
Cdd:PTZ00110 483 PDKYRLARDLVKVLREAKQPVP 504
PRK10590 PRK10590
ATP-dependent RNA helicase RhlE; Provisional
173-534 4.80e-66

ATP-dependent RNA helicase RhlE; Provisional


Pssm-ID: 236722 [Multi-domain]  Cd Length: 456  Bit Score: 222.38  E-value: 4.80e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL--KQPTNKG---FRALVISPTREL 247
Cdd:PRK10590   8 LSPDILRAVAEQGYREPTPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLLQHLitRQPHAKGrrpVRALILTPTREL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIHMIhkaaiaakkFG-----PKSSK---KFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVD 319
Cdd:PRK10590  88 AAQIGENVRDYSKYLNIRSLVV---------FGgvsinPQMMKlrgGVDVLVATPGRLLDLEHQN--AVKLDQVEILVLD 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 320 ESDKLFEdgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETG 399
Cdd:PRK10590 157 EADRMLD---MGFIHDIRRV-LAKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEIEVARRNTASEQVTQHVHFVDKKRK 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 400 KLLaMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDF 479
Cdd:PRK10590 233 REL-LSQMIGKGNWQQVLVFTRTKHGANHLAEQLNKDGIRSAAIHGNKSQGARTRALADFKSGDIRVLVATDIAARGLDI 311
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 256985213 480 KGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVANVIQQ 534
Cdd:PRK10590 312 EELPHVVNYELPNVPEDYVHRIGRTGRAAATGEALSLVCVDEHKLLRDIEKLLKK 366
DEADc cd00268
DEAD-box helicase domain of DEAD box helicases; DEAD-box helicases comprise a diverse family ...
177-376 7.75e-65

DEAD-box helicase domain of DEAD box helicases; DEAD-box helicases comprise a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350669 [Multi-domain]  Cd Length: 196  Bit Score: 210.76  E-value: 7.75e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPTNKGFRALVISPTRELASQIHR 253
Cdd:cd00268    1 LLKALKKLGFEKPTPIQAQAIPLILSGRDVIGQAQTGSGKTLAFLLPILEKLlpePKKKGRGPQALVLAPTRELAMQIAE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 254 ELIKISEGTGFRIHMI-----HKAAIAAKKfgpkssKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEDg 328
Cdd:cd00268   81 VARKLGKGTGLKVAAIyggapIKKQIEALK------KGPDIVVGTPGRLLDLIERGK--LDLSNVKYLVLDEADRMLDM- 151
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 329 ktGFREQLASIFLACtSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd00268  152 --GFEEDVEKILSAL-PKDRQTLLFSATLPEEVKELAKKFLKNPVRIE 196
PRK01297 PRK01297
ATP-dependent RNA helicase RhlB; Provisional
169-540 7.09e-63

ATP-dependent RNA helicase RhlB; Provisional


Pssm-ID: 234938 [Multi-domain]  Cd Length: 475  Bit Score: 214.78  E-value: 7.09e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 169 QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQ--PTNKGF----RALVIS 242
Cdd:PRK01297  90 HDFNLAPELMHAIHDLGFPYCTPIQAQVLGYTLAGHDAIGRAQTGTGKTAAFLISIINQLLQtpPPKERYmgepRALIIA 169
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 243 PTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLtnVEWLVVDESD 322
Cdd:PRK01297 170 PTRELVVQIAKDAAALTKYTGLNVMTFVGGMDFDKQLKQLEARFCDILVATPGRLLDFNQRGEVHLDM--VEVMVLDEAD 247
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 323 KLFEdgkTGFREQLASIfLACTSPKVRRA--MFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFV-GSETG 399
Cdd:PRK01297 248 RMLD---MGFIPQVRQI-IRQTPRKEERQtlLFSATFTDDVMNLAKQWTTDPAIVEIEPENVASDTVEQHVYAVaGSDKY 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 400 KLLamRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDF 479
Cdd:PRK01297 324 KLL--YNLVTQNPWERVMVFANRKDEVRRIEERLVKDGINAAQLSGDVPQHKRIKTLEGFREGKIRVLVATDVAGRGIHI 401
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 256985213 480 KGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVANVI-QQAGCPVP 540
Cdd:PRK01297 402 DGISHVINFTLPEDPDDYVHRIGRTGRAGASGVSISFAGEDDAFQLPEIEELLgRKISCEMP 463
PRK11192 PRK11192
ATP-dependent RNA helicase SrmB; Provisional
163-597 1.04e-59

ATP-dependent RNA helicase SrmB; Provisional


Pssm-ID: 236877 [Multi-domain]  Cd Length: 434  Bit Score: 204.79  E-value: 1.04e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 163 TFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-----KQPtnkGF- 236
Cdd:PRK11192   2 TFSELE----LDESLLEALQDKGYTRPTAIQAEAIPPALDGRDVLGSAPTGTGKTAAFLLPALQHLldfprRKS---GPp 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 237 RALVISPTRELASQIHRELIKISEGTGFRIHMIhKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDppGIDLTNVEWL 316
Cdd:PRK11192  75 RILILTPTRELAMQVADQARELAKHTHLDIATI-TGGVAYMNHAEVFSENQDIVVATPGRLLQYIKEE--NFDCRAVETL 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 317 VVDESDKLFEdgkTGFREQLASIFLACTSPKvRRAMFSAT--------FAYDVeqwcklnLDNVVSVSIGARNSAVETVE 388
Cdd:PRK11192 152 ILDEADRMLD---MGFAQDIETIAAETRWRK-QTLLFSATlegdavqdFAERL-------LNDPVEVEAEPSRRERKKIH 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 389 QELLFVGSETGK--LLA---MRELVKKGFkppvlVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGK 463
Cdd:PRK11192 221 QWYYRADDLEHKtaLLChllKQPEVTRSI-----VFVRTRERVHELAGWLRKAGINCCYLEGEMVQAKRNEAIKRLTDGR 295
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 464 IWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVANVIQQagcPV-PEY 542
Cdd:PRK11192 296 VNVLVATDVAARGIDIDDVSHVINFDMPRSADTYLHRIGRTGRAGRKGTAISLVEAHDHLLLGKIERYIEE---PLkARV 372
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 256985213 543 IKGFqkllskqkkkmikKPLEREsicttPKYFLEQAKQKKVAGQNSKKKETLKEK 597
Cdd:PRK11192 373 IDEL-------------RPKTKA-----PSEKKTGKPSKKVLAKRAEKKEKEKEK 409
PRK11776 PRK11776
ATP-dependent RNA helicase DbpA; Provisional
177-521 8.75e-57

ATP-dependent RNA helicase DbpA; Provisional


Pssm-ID: 236977 [Multi-domain]  Cd Length: 460  Bit Score: 197.72  E-value: 8.75e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRELASQIHREL- 255
Cdd:PRK11776  15 LLANLNELGYTEMTPIQAQSLPAILAGKDVIAQAKTGSGKTAAFGLGLLQKL-DVKRFRVQALVLCPTRELADQVAKEIr 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 256 --------IKI---SEGTGFRIHmihkaaIAAKKFGPKsskkfdILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKL 324
Cdd:PRK11776  94 rlarfipnIKVltlCGGVPMGPQ------IDSLEHGAH------IIVGTPGRILDHLRKG--TLDLDALNTLVLDEADRM 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 325 FEdgkTGFREQLASIFLACtsPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVSIGARNSAvETVEQELLFVgSETGKLLA 403
Cdd:PRK11776 160 LD---MGFQDAIDAIIRQA--PARRQTLlFSATYPEGIAAISQRFQRDPVEVKVESTHDL-PAIEQRFYEV-SPDERLPA 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 404 MRELVKKgFKP-PVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGV 482
Cdd:PRK11776 233 LQRLLLH-HQPeSCVVFCNTKKECQEVADALNAQGFSALALHGDLEQRDRDQVLVRFANRSCSVLVATDVAARGLDIKAL 311
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 256985213 483 NLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDD 521
Cdd:PRK11776 312 EAVINYELARDPEVHVHRIGRTGRAGSKGLALSLVAPEE 350
SF2_C_DEAD cd18787
C-terminal helicase domain of the DEAD box helicases; DEAD-box helicases comprise a diverse ...
387-517 2.69e-55

C-terminal helicase domain of the DEAD box helicases; DEAD-box helicases comprise a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis, and RNA degradation. They are superfamily (SF)2 helicases that, similar to SF1, do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350174 [Multi-domain]  Cd Length: 131  Bit Score: 183.09  E-value: 2.69e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 387 VEQELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWV 466
Cdd:cd18787    1 IKQLYVVVEEEEKKLLLLLLLLEKLKPGKAIIFVNTKKRVDRLAELLEELGIKVAALHGDLSQEERERALKKFRSGKVRV 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 256985213 467 LICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFF 517
Cdd:cd18787   81 LVATDVAARGLDIPGVDHVINYDLPRDAEDYVHRIGRTGRAGRKGTAITFV 131
PRK11634 PRK11634
ATP-dependent RNA helicase DeaD; Provisional
173-528 1.72e-47

ATP-dependent RNA helicase DeaD; Provisional


Pssm-ID: 236941 [Multi-domain]  Cd Length: 629  Bit Score: 175.81  E-value: 1.72e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKqPTNKGFRALVISPTRELASQIH 252
Cdd:PRK11634  13 LKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLHNLD-PELKAPQILVLAPTRELAVQVA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELikisegTGFRIHMIHKAAIA------------AKKFGPKsskkfdILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDE 320
Cdd:PRK11634  92 EAM------TDFSKHMRGVNVVAlyggqrydvqlrALRQGPQ------IVVGTPGRLLDHLKRGT--LDLSKLSGLVLDE 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 321 SDKLFedgKTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETGK 400
Cdd:PRK11634 158 ADEML---RMGFIEDVETI-MAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWGMRKN 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 401 LLAMRELVKKGFKPPVlVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFK 480
Cdd:PRK11634 234 EALVRFLEAEDFDAAI-IFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVE 312
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 481 GVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSV 528
Cdd:PRK11634 313 RISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNI 360
PRK04837 PRK04837
ATP-dependent RNA helicase RhlB; Provisional
173-520 2.51e-46

ATP-dependent RNA helicase RhlB; Provisional


Pssm-ID: 235314 [Multi-domain]  Cd Length: 423  Bit Score: 168.61  E-value: 2.51e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAF-----------SIPILMQLKQPtnkgfRALVI 241
Cdd:PRK04837  15 LHPQVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFltatfhyllshPAPEDRKVNQP-----RALIM 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 242 SPTRELASQIHRELIKISEGTGFrihmihKAAIAakkFGPKSSKK--------FDILVTTPNRLIYLLKQDPpgIDLTNV 313
Cdd:PRK04837  90 APTRELAVQIHADAEPLAQATGL------KLGLA---YGGDGYDKqlkvlesgVDILIGTTGRLIDYAKQNH--INLGAI 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 314 EWLVVDESDKLFEdgkTGFREQLASIFLACTSPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELl 392
Cdd:PRK04837 159 QVVVLDEADRMFD---LGFIKDIRWLFRRMPPANQRLNMlFSATLSYRVRELAFEHMNNPEYVEVEPEQKTGHRIKEEL- 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 393 FVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTAL 472
Cdd:PRK04837 235 FYPSNEEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILEEFTRGDLDILVATDV 314
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 473 LARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTED 520
Cdd:PRK04837 315 AARGLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLACEE 362
PTZ00424 PTZ00424
helicase 45; Provisional
172-530 2.88e-46

helicase 45; Provisional


Pssm-ID: 185609 [Multi-domain]  Cd Length: 401  Bit Score: 167.70  E-value: 2.88e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 172 KINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILmQLKQPTNKGFRALVISPTRELASQI 251
Cdd:PTZ00424  34 KLNEDLLRGIYSYGFEKPSAIQQRGIKPILDGYDTIGQAQSGTGKTATFVIAAL-QLIDYDLNACQALILAPTRELAQQI 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 252 HRELIKISEGTGFRIHMIHKAAIAAKKFGpKSSKKFDILVTTPNRLIYLLKQDPPGIDltNVEWLVVDESDKLFEdgkTG 331
Cdd:PTZ00424 113 QKVVLALGDYLKVRCHACVGGTVVRDDIN-KLKAGVHMVVGTPGRVYDMIDKRHLRVD--DLKLFILDEADEMLS---RG 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 332 FREQLASIFLAcTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKG 411
Cdd:PTZ00424 187 FKGQIYDVFKK-LPPDVQVALFSATMPNEILELTTKFMRDPKRILVKKDELTLEGIRQFYVAVEKEEWKFDTLCDLYETL 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 412 FKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFP 491
Cdd:PTZ00424 266 TITQAIIYCNTRRKVDYLTKKMHERDFTVSCMHGDMDQKDRDLIMREFRSGSTRVLITTDLLARGIDVQQVSLVINYDLP 345
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 256985213 492 TSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSVAN 530
Cdd:PTZ00424 346 ASPENYIHRIGRSGRFGRKGVAINFVTPDDIEQLKEIER 384
PRK04537 PRK04537
ATP-dependent RNA helicase RhlB; Provisional
155-519 4.03e-46

ATP-dependent RNA helicase RhlB; Provisional


Pssm-ID: 235307 [Multi-domain]  Cd Length: 572  Bit Score: 171.29  E-value: 4.03e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 155 TDLPDPIATFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL------ 228
Cdd:PRK04537   2 SDKPLTDLTFSSFD----LHPALLAGLESAGFTRCTPIQALTLPVALPGGDVAGQAQTGTGKTLAFLVAVMNRLlsrpal 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 229 --KQPTNKgfRALVISPTRELASQIHRELIKISEGTGFRIHMIHkAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPP 306
Cdd:PRK04537  78 adRKPEDP--RALILAPTRELAIQIHKDAVKFGADLGLRFALVY-GGVDYDKQRELLQQGVDVIIATPGRLIDYVKQHKV 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 307 gIDLTNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVSIGARNSAVE 385
Cdd:PRK04537 155 -VSLHACEICVLDEADRMFD---LGFIKDIRFLLRRMPERGTRQTLlFSATLSHRVLELAYEHMNEPEKLVVETETITAA 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 386 TVEQELLFVGSETGKLLAMRELVK-KGFKPPVLV----FVQSIERAKElfheliYEGINVDVIHAERTQQQRDNTVHSFR 460
Cdd:PRK04537 231 RVRQRIYFPADEEKQTLLLGLLSRsEGARTMVFVntkaFVERVARTLE------RHGYRVGVLSGDVPQKKRESLLNRFQ 304
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 256985213 461 AGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTE 519
Cdd:PRK04537 305 KGQLEILVATDVAARGLHIDGVKYVYNYDLPFDAEDYVHRIGRTARLGEEGDAISFACE 363
DEADc_DDX27 cd17947
DEAD-box helicase domain of DEAD box protein 27; DDX27 (also called RHLP, deficiency of ...
177-376 4.97e-46

DEAD-box helicase domain of DEAD box protein 27; DDX27 (also called RHLP, deficiency of ribosomal subunits protein 1 homolog, and probable ATP-dependent RNA helicase DDX27) is involved in the processing of 5.8S and 28S ribosomal RNAs. More specifically, the encoded protein localizes to the nucleolus, where it interacts with the PeBoW complex to ensure proper 3' end formation of 47S rRNA. DDX27 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350705 [Multi-domain]  Cd Length: 196  Bit Score: 160.88  E-value: 4.97e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL--KQPTNKGFRALVISPTRELASQIHRE 254
Cdd:cd17947    1 LLRALSSLGFTKPTPIQAAAIPLALLGKDICASAVTGSGKTAAFLLPILERLlyRPKKKAATRVLVLVPTRELAMQCFSV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 255 LIKISEGTGFRIHMI-----HKAAIAAKKFGPksskkfDILVTTPNRLIYLLKqDPPGIDLTNVEWLVVDESDKLFEDgk 329
Cdd:cd17947   81 LQQLAQFTDITFALAvgglsLKAQEAALRARP------DIVIATPGRLIDHLR-NSPSFDLDSIEILVLDEADRMLEE-- 151
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 330 tGFREQLASIFLACtsPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17947  152 -GFADELKEILRLC--PRTRQTMlFSATMTDEVKDLAKLSLNKPVRVF 196
DEAD pfam00270
DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. ...
190-363 7.14e-45

DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.


Pssm-ID: 333969 [Multi-domain]  Cd Length: 165  Bit Score: 156.62  E-value: 7.14e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  190 TPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKqPTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMI 269
Cdd:pfam00270   1 TPIQAQAIPAILEGRDVLVQAPTGSGKTLAFLLPALEALN-KKDNGPQALVLAPTRELAEQIYEELKKLGKGLGLKVASL 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  270 HKAAIAAKKFgpKSSKKFDILVTTPNRLIYLLKQDPPgidLTNVEWLVVDESDKLFEDgktGFREQLASIfLACTSPKVR 349
Cdd:pfam00270  80 LGGDSRKEQL--EKLKGPDILVGTPGRLLDLLRERKL---LKNLKLLVLDEAHRLLDM---GFGPDLEEI-LRRLPKKRQ 150
                         170
                  ....*....|....
gi 256985213  350 RAMFSATFAYDVEQ 363
Cdd:pfam00270 151 ILLLSATLPRNLED 164
DEADc_DDX54 cd17959
DEAD-box helicase domain of DEAD box protein 54; DDX54 interacts in a hormone-dependent manner ...
163-356 1.03e-44

DEAD-box helicase domain of DEAD box protein 54; DDX54 interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. DDX54 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350717 [Multi-domain]  Cd Length: 205  Bit Score: 157.47  E-value: 1.03e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 163 TFQQLDQEYKinsrLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQP-TNKGFRALVI 241
Cdd:cd17959    2 GFQSMGLSPP----LLRAIKKKGYKVPTPIQRKTIPLILDGRDVVAMARTGSGKTAAFLIPMIEKLKAHsPTVGARALIL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 242 SPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFGPKSSKKfDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDES 321
Cdd:cd17959   78 SPTRELALQTLKVTKELGKFTDLRTALLVGGDSLEEQFEALASNP-DIIIATPGRLLHLLVEM--NLKLSSVEYVVFDEA 154
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 256985213 322 DKLFEdgkTGFREQLASIfLACTSPKVRRAMFSAT 356
Cdd:cd17959  155 DRLFE---MGFAEQLHEI-LSRLPENRQTLLFSAT 185
DEXDc smart00487
DEAD-like helicases superfamily;
181-390 8.58e-44

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 154.96  E-value: 8.58e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   181 ILDAGFQVPTPIQMQAIPVMLHG-RELLASAPTGSGKTLAFSIPILMQLKQptNKGFRALVISPTRELASQIHRELIKIS 259
Cdd:smart00487   1 IEKFGFEPLRPYQKEAIEALLSGlRDVILAAPTGSGKTLAALLPALEALKR--GKGGRVLVLVPTRELAEQWAEELKKLG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   260 EGTGFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEDgktGFREQLASI 339
Cdd:smart00487  79 PSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDK--LSLSNVDLVILDEAHRLLDG---GFGDQLEKL 153
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|.
gi 256985213   340 fLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGarNSAVETVEQE 390
Cdd:smart00487 154 -LKLLPKNVQLLLLSATPPEEIENLLELFLNDPVFIDVG--FTPLEPIEQF 201
DEADc_DDX3_DDX4 cd17967
DEAD-box helicase domain of ATP-dependent RNA helicases DDX3 and DDX4; This subfamily includes ...
163-378 2.45e-43

DEAD-box helicase domain of ATP-dependent RNA helicases DDX3 and DDX4; This subfamily includes Drosophila melanogaster Vasa, which is essential for development. DEAD box protein 3 (DDX3) has been reported to display a high level of RNA-independent ATPase activity stimulated by both RNA and DNA. DEAD box protein 4 (DDX4, also known as VASA homolog) is an ATP-dependent RNA helicase required during spermatogenesis and is essential for the germline integrity. DDX3 and DDX4 are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350725 [Multi-domain]  Cd Length: 221  Bit Score: 154.18  E-value: 2.45e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 163 TFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPTNKGFR-- 237
Cdd:cd17967    1 SFEEAG----LRELLLENIKRAGYTKPTPVQKYAIPIILAGRDLMACAQTGSGKTAAFLLPIISKLledGPPSVGRGRrk 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 238 ----ALVISPTRELASQIHRELIKISEGTGFRI-------HMIHKAAiaakkfgpKSSKKFDILVTTPNRLIYLLKQDPp 306
Cdd:cd17967   77 aypsALILAPTRELAIQIYEEARKFSYRSGVRSvvvyggaDVVHQQL--------QLLRGCDILVATPGRLVDFIERGR- 147
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256985213 307 gIDLTNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSPKV--RR-AMFSATFAYDVEQWCKLNLDNVVSVSIG 378
Cdd:cd17967  148 -ISLSSIKFLVLDEADRMLD---MGFEPQIRKIVEHPDMPPKgeRQtLMFSATFPREIQRLAADFLKNYIFLTVG 218
DEADc_DDX46 cd17953
DEAD-box helicase domain of DEAD box protein 46; DDX46 (also called Prp5-like DEAD-box protein) ...
152-375 6.58e-40

DEAD-box helicase domain of DEAD box protein 46; DDX46 (also called Prp5-like DEAD-box protein) is a component of the 17S U2 snRNP complex. It plays an important role in pre-mRNA splicing and has a role in antiviral innate immunity. DDX46 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350711 [Multi-domain]  Cd Length: 222  Bit Score: 144.83  E-value: 6.58e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 152 VQGTDLPDPIATFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLK-Q 230
Cdd:cd17953    2 VRGKDCPKPIQKWSQCG----LSEKVLDLIKKLGYEKPTPIQAQALPAIMSGRDVIGIAKTGSGKTLAFLLPMFRHIKdQ 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 231 PTNK---GFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAA-----IAAKKFGPksskkfDILVTTPNRLIYLLK 302
Cdd:cd17953   78 RPVKpgeGPIGLIMAPTRELALQIYVECKKFSKALGLRVVCVYGGSgiseqIAELKRGA------EIVVCTPGRMIDILT 151
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 256985213 303 QDPPGI-DLTNVEWLVVDESDKLFEdgkTGFREQLASIFLAcTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSV 375
Cdd:cd17953  152 ANNGRVtNLRRVTYVVLDEADRMFD---MGFEPQIMKIVNN-IRPDRQTVLFSATFPRKVEALARKVLHKPIEI 221
DEADc_DDX10 cd17941
DEAD-box helicase domain of DEAD box protein 10; Fusion of the DDX10 gene and the nucleoporin ...
183-377 8.01e-39

DEAD-box helicase domain of DEAD box protein 10; Fusion of the DDX10 gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies. Diseases associated with DDX10 (also known as DDX10-NUP98 Fusion Protein Type 2) include myelodysplastic syndrome and leukemia, acute myeloid. DDX10 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350699 [Multi-domain]  Cd Length: 198  Bit Score: 141.27  E-value: 8.01e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 183 DAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPTNKGFRALVISPTRELASQIHRELIKIS 259
Cdd:cd17941    7 EAGFIKMTEIQRDSIPHALQGRDILGAAKTGSGKTLAFLVPLLEKLyreRWTPEDGLGALIISPTRELAMQIFEVLRKVG 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 260 EGTGFRIHMIhkaaIAAKKFGPKSSK--KFDILVTTPNRLIYLLKQDpPGIDLTNVEWLVVDESDKLFEdgkTGFREQLA 337
Cdd:cd17941   87 KYHSFSAGLI----IGGKDVKEEKERinRMNILVCTPGRLLQHMDET-PGFDTSNLQMLVLDEADRILD---MGFKETLD 158
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 256985213 338 SIFlaCTSPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVSI 377
Cdd:cd17941  159 AIV--ENLPKSRQTLlFSATQTKSVKDLARLSLKNPEYISV 197
DEADc_DDX55 cd17960
DEAD-box helicase domain of DEAD box protein 55; DDX55 is a member of the DEAD-box helicases, ...
177-376 6.10e-37

DEAD-box helicase domain of DEAD box protein 55; DDX55 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350718 [Multi-domain]  Cd Length: 202  Bit Score: 136.17  E-value: 6.10e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL----KQPTNKGFRALVISPTRELASQIH 252
Cdd:cd17960    1 ILDVVAELGFTSMTPVQAATIPLFLSNKDVVVEAVTGSGKTLAFLIPVLEILlkrkANLKKGQVGALIISPTRELATQIY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTGFRIH---MIHKAAIAA--KKFgpkSSKKFDILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDESDKLFEd 327
Cdd:cd17960   81 EVLQSFLEHHLPKLKcqlLIGGTNVEEdvKKF---KRNGPNILVGTPGRLEELLSRKADKVKVKSLEVLVLDEADRLLD- 156
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|
gi 256985213 328 gkTGFREQLASIfLACTsPKVRR-AMFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17960  157 --LGFEADLNRI-LSKL-PKQRRtGLFSATQTDAVEELIKAGLRNPVRVV 202
DEADc_DDX51 cd17956
DEAD-box helicase domain of DEAD box protein 51; DDX51 aids cell cancer proliferation by ...
177-371 1.80e-36

DEAD-box helicase domain of DEAD box protein 51; DDX51 aids cell cancer proliferation by regulating multiple signalling pathways. Mammalian DEAD box protein Ddx51 acts in 3' end maturation of 28S rRNA by promoting the release of U8 snoRNA.It is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350714 [Multi-domain]  Cd Length: 231  Bit Score: 135.84  E-value: 1.80e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVML---------HGRELLASAPTGSGKTLAFSIPILMQLKQPTNKGFRALVISPTREL 247
Cdd:cd17956    1 LLKNLQNNGITSAFPVQAAVIPWLLpsskstppyRPGDLCVSAPTGSGKTLAYVLPIVQALSKRVVPRLRALIVVPTKEL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIHMI-------HKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQdPPGIDLTNVEWLVVDE 320
Cdd:cd17956   81 VQQVYKVFESLCKGTGLKVVSLsgqksfkKEQKLLLVDTSGRYLSRVDILVATPGRLVDHLNS-TPGFTLKHLRFLVIDE 159
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256985213 321 SDKL----------------FEDGKTGFREQLASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDN 371
Cdd:cd17956  160 ADRLlnqsfqdwletvmkalGRPTAPDLGSFGDANLLERSVRPLQKLLFSATLTRDPEKLSSLKLHR 226
DEADc_DDX4 cd18052
DEAD-box helicase domain of DEAD box protein 4; DEAD box protein 4 (DDX4, also known as VASA ...
141-363 1.50e-35

DEAD-box helicase domain of DEAD box protein 4; DEAD box protein 4 (DDX4, also known as VASA homolog) is an ATP-dependent RNA helicase required during spermatogenesis and is essential for the germline integrity. DEAD-box helicases are a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350810 [Multi-domain]  Cd Length: 264  Bit Score: 134.32  E-value: 1.50e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 141 VNFFRNKH-KIHVQGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLA 219
Cdd:cd18052   21 INFDKYDEiPVEVTGRNPPPAILTFE----EANLCETLLKNIRKAGYEKPTPVQKYAIPIILAGRDLMACAQTGSGKTAA 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 220 FSIPILMQLKQ-----PTNKGFR---ALVISPTRELASQIHRELIKISEGTGFR-------IHMIHKAAiaakkfgpKSS 284
Cdd:cd18052   97 FLLPVLTGMMKegltaSSFSEVQepqALIVAPTRELANQIFLEARKFSYGTCIRpvvvyggVSVGHQIR--------QIE 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 285 KKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSP-KVRRA--MFSATFAYDV 361
Cdd:cd18052  169 KGCHILVATPGRLLDFIGRGK--ISLSKLKYLILDEADRMLD---MGFGPEIRKLVSEPGMPsKEDRQtlMFSATFPEEI 243

                 ..
gi 256985213 362 EQ 363
Cdd:cd18052  244 QR 245
DEADc_DDX3 cd18051
DEAD-box helicase domain of DEAD box protein 3; DDX3 (also called helicase-like protein, DEAD ...
154-378 2.74e-35

DEAD-box helicase domain of DEAD box protein 3; DDX3 (also called helicase-like protein, DEAD box, X isoform, or DDX14) has been reported to display a high level of RNA-independent ATPase activity stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. Diseases associated with DDX3 include mental retardation, X-linked 102 and agenesis of the corpus callosum, with facial anomalies and robin sequence. DDX3 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350809 [Multi-domain]  Cd Length: 249  Bit Score: 133.24  E-value: 2.74e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 154 GTDLPDPIATFQQLDQEYKINSrllqNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQ------ 227
Cdd:cd18051   13 GENCPPHIETFSDLDLGEIIRN----NIELARYTKPTPVQKHAIPIIKSKRDLMACAQTGSGKTAAFLLPILSQiyeqgp 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 228 ---LKQPTNKGFR------ALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFgpkssKKFD----ILVTTP 294
Cdd:cd18051   89 gesLPSESGYYGRrkqyplALVLAPTRELASQIYDEARKFAYRSRVRPCVVYGGADIGQQM-----RDLErgchLLVATP 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 295 NRLIYLLKQDPPGIDltNVEWLVVDESDKLFEdgkTGFREQLASIFLACTSPK--VRRA-MFSATFAYDVEQWCKLNLDN 371
Cdd:cd18051  164 GRLVDMLERGKIGLD--YCKYLVLDEADRMLD---MGFEPQIRRIVEQDTMPPtgERQTlMFSATFPKEIQMLARDFLDN 238

                 ....*..
gi 256985213 372 VVSVSIG 378
Cdd:cd18051  239 YIFLAVG 245
DEADc_DDX24 cd17946
DEAD-box helicase domain of DEAD box protein 24; The human DDX24 gene encodes a DEAD box ...
177-368 3.99e-35

DEAD-box helicase domain of DEAD box protein 24; The human DDX24 gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level. MDM2 mediates nonproteolytic polyubiquitylation of the DEAD-Box RNA helicase DDX24. DDX24 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region.


Pssm-ID: 350704 [Multi-domain]  Cd Length: 235  Bit Score: 132.36  E-value: 3.99e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPV-MLHGRELLASAPTGSGKTLAFSIPIL---MQLKQ-----PTNKGFRALVISPTREL 247
Cdd:cd17946    1 ILRALADLGFSEPTPIQALALPAaIRDGKDVIGAAETGSGKTLAFGIPILerlLSQKSsngvgGKQKPLRALILTPTREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIhMIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGID-LTNVEWLVVDESDKLFE 326
Cdd:cd17946   81 AVQVKDHLKAIAKYTNIKI-ASIVGGLAVQKQERLLKKRPEIVVATPGRLWELIQEGNEHLAnLKSLRFLVLDEADRMLE 159
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 327 DGKtgFREqLASIF------LACTSPKVRRAMFSATFAYDVEQWCKLN 368
Cdd:cd17946  160 KGH--FAE-LEKILellnkdRAGKKRKRQTFVFSATLTLDHQLPLKLN 204
DEADc_DDX42 cd17952
DEAD-box helicase domain of DEAD box protein 42; DDX42 (also called Splicing Factor ...
177-376 1.27e-34

DEAD-box helicase domain of DEAD box protein 42; DDX42 (also called Splicing Factor 3B-Associated 125 kDa Protein, RHELP, or RNAHP) is an NTPase with a preference for ATP, the hydrolysis of which is enhanced by various RNA substrates. It acts as a non-processive RNA helicase with protein displacement and RNA annealing activities. DDX42 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350710 [Multi-domain]  Cd Length: 197  Bit Score: 129.46  E-value: 1.27e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-KQPT---NKGFRALVISPTRELASQIH 252
Cdd:cd17952    1 LLNAIRKQEYEQPTPIQAQALPVALSGRDMIGIAKTGSGKTAAFIWPMLVHImDQRElekGEGPIAVIVAPTRELAQQIY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTGFRIHMIHKAaiAAKKFGPKSSKK-FDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEdgkTG 331
Cdd:cd17952   81 LEAKKFGKAYNLRVVAVYGG--GSKWEQAKALQEgAEIVVATPGRLIDMVKKK--ATNLQRVTYLVLDEADRMFD---MG 153
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 256985213 332 FREQLASIfLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17952  154 FEYQVRSI-VGHVRPDRQTLLFSATFKKKIEQLARDILSDPIRVV 197
DEADc_DDX56 cd17961
DEAD-box helicase domain of DEAD box protein 56; DDX56 is a helicase required for assembly of ...
173-375 1.35e-34

DEAD-box helicase domain of DEAD box protein 56; DDX56 is a helicase required for assembly of infectious West Nile virus particles. New research suggests that DDX56 relocalizes to the site of virus assembly during WNV infection and that its interaction with WNV capsid in the cytoplasm may occur transiently during virion morphogenesis. DDX56 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350719 [Multi-domain]  Cd Length: 206  Bit Score: 129.63  E-value: 1.35e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPIL---MQLKQ--PTNKGFRALVISPTREL 247
Cdd:cd17961    1 LDPRLLKAIAKLGWEKPTLIQSKAIPLALEGKDILARARTGSGKTAAYALPIIqkiLKAKAesGEEQGTRALILVPTREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIHMIH---KAAIAAKKfgPKSSKKFDILVTTPNRLIYLLKQDPPgIDLTNVEWLVVDESDKL 324
Cdd:cd17961   81 AQQVSKVLEQLTAYCRKDVRVVNlsaSSSDSVQR--ALLAEKPDIVVSTPARLLSHLESGSL-LLLSTLKYLVIDEADLV 157
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 256985213 325 FedgKTGFREQLasIFLACTSPKVRRA-MFSATFAYDVEQWCKLNLDNVVSV 375
Cdd:cd17961  158 L---SYGYEEDL--KSLLSYLPKNYQTfLMSATLSEDVEALKKLVLHNPAIL 204
DEADc_DDX23 cd17945
DEAD-box helicase domain of DEAD box protein 23; DDX23 (also called U5 snRNP 100kD protein and ...
177-376 2.53e-34

DEAD-box helicase domain of DEAD box protein 23; DDX23 (also called U5 snRNP 100kD protein and PRP28 homolog) is involved in pre-mRNA splicing and its phosphorylated form (by SRPK2) is required for spliceosomal B complex formation. Diseases associated with DDX23 include distal hereditary motor neuropathy, type II. DDX23 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350703 [Multi-domain]  Cd Length: 220  Bit Score: 129.36  E-value: 2.53e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-KQP------TNKGFRALVISPTRELAS 249
Cdd:cd17945    1 LLRVIRKLGYKEPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVYIsRLPpldeetKDDGPYALILAPTRELAQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 250 QIHRELIKISEGTGFR-IHMIHKAAIAAKKFgpKSSKKFDILVTTPNRLIYLLkqDPPGIDLTNVEWLVVDESDKLFEdg 328
Cdd:cd17945   81 QIEEETQKFAKPLGIRvVSIVGGHSIEEQAF--SLRNGCEILIATPGRLLDCL--ERRLLVLNQCTYVVLDEADRMID-- 154
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256985213 329 kTGFREQLASIF-----------------LACTSPKVRRA--MFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17945  155 -MGFEPQVTKILdampvsnkkpdteeaekLAASGKHRYRQtmMFTATMPPAVEKIAKGYLRRPVVVT 220
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
399-508 3.85e-34

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 333970 [Multi-domain]  Cd Length: 111  Bit Score: 125.01  E-value: 3.85e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  399 GKLLAMRELVK-KGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGI 477
Cdd:pfam00271   1 EKLEALLELLKlKERGGKVLIFSNTKKRLELLELLLEKEGIKVARLHGDLSQEEREEILEDFRNGKIDVLVATDVAARGL 80
                          90       100       110
                  ....*....|....*....|....*....|.
gi 256985213  478 DFKGVNLVINYDFPTSSVEYIHRIGRTGRAG 508
Cdd:pfam00271  81 DLPDVNLVINYDLPWNPASYIQRIGRAGRAG 111
DEADc_DDX59 cd17962
DEAD-box helicase domain of DEAD box protein 59; DDX59 plays an important role in lung cancer ...
177-376 2.02e-33

DEAD-box helicase domain of DEAD box protein 59; DDX59 plays an important role in lung cancer development by promoting DNA replication. DDX59 knockdown mice showed reduced cell proliferation, anchorage-independent cell growth, and reduction of tumor formation. Recent work shows that EGFR and Ras regulate DDX59 during lung cancer development.Diseases associated with DDX59 (also called zinc finger HIT domain-containing protein 5) include orofaciodigital syndrome V and orofaciodigital syndrome. DDX59 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350720 [Multi-domain]  Cd Length: 193  Bit Score: 126.12  E-value: 2.02e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL----KQPTnkgfrALVISPTRELASQIH 252
Cdd:cd17962    1 LSSNLKKAGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIRCltehRNPS-----ALILTPTRELAVQIE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTgfrIHMIHKAAIAAKKFGP---KSSKKFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFedgK 329
Cdd:cd17962   76 DQAKELMKGL---PPMKTALLVGGLPLPPqlyRLQQGVKVIIATPGRLLDILKQS--SVELDNIKIVVVDEADTML---K 147
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 256985213 330 TGFREQLASIFLAcTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17962  148 MGFQQQVLDILEN-ISHDHQTILVSATIPRGIEQLAGQLLQNPVRIT 193
DEADc_MSS116 cd17964
DEAD-box helicase domain of DEAD-box helicase Mss116; Mss116 is an RNA chaperone important for ...
173-369 3.00e-33

DEAD-box helicase domain of DEAD-box helicase Mss116; Mss116 is an RNA chaperone important for mitochondrial group I and II intron splicing, translational activation, and RNA end processing. Mss116 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350722 [Multi-domain]  Cd Length: 211  Bit Score: 126.16  E-value: 3.00e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVML-HGRELLASAPTGSGKTLAFSIP----ILMQLKQPTNKGFRALVISPTREL 247
Cdd:cd17964    1 LDPSLLKALTRMGFETMTPVQQKTLKPILsTGDDVLARAKTGTGKTLAFLLPaiqsLLNTKPAGRRSGVSALIISPTREL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEG-TGFRIHM------IHKAAIAAKKFGPksskkfDILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDE 320
Cdd:cd17964   81 ALQIAAEAKKLLQGlRKLRVQSavggtsRRAELNRLRRGRP------DILVATPGRLIDHLENPGVAKAFTDLDYLVLDE 154
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 256985213 321 SDKLFEDgktGFREQLASIfLACTSPKVRR----AMFSATFAYDVEQWCKLNL 369
Cdd:cd17964  155 ADRLLDM---GFRPDLEQI-LRHLPEKNADprqtLLFSATVPDEVQQIARLTL 203
DEADc_DDX6 cd17940
DEAD-box helicase domain of DEAD box protein 6; DEAD box protein 6 (DDX6, also known as Rck or ...
169-361 6.62e-33

DEAD-box helicase domain of DEAD box protein 6; DEAD box protein 6 (DDX6, also known as Rck or p54) participates in mRNA regulation mediated by miRNA-mediated silencing. It also plays a role in global and transcript-specific messenger RNA (mRNA) storage, translational repression, and decay. It is a member of the DEAD-box helicase family, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350698 [Multi-domain]  Cd Length: 201  Bit Score: 124.72  E-value: 6.62e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 169 QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRELA 248
Cdd:cd17940    2 EDYGLKRELLMGIFEKGFEKPSPIQEESIPIALSGRDILARAKNGTGKTGAYLIPILEKI-DPKKDVIQALILVPTRELA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 249 SQIHRELIKISEGTGfrihmihkaAIAAKKFGPKSSK--------KFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDE 320
Cdd:cd17940   81 LQTSQVCKELGKHMG---------VKVMVTTGGTSLRddimrlyqTVHVLVGTPGRILDLAKKGV--ADLSHCKTLVLDE 149
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|..
gi 256985213 321 SDKLFEDGKTGFREQLASIFlactsPKVRRAM-FSATFAYDV 361
Cdd:cd17940  150 ADKLLSQDFQPIIEKILNFL-----PKERQILlFSATFPLTV 186
DEADc_DDX47 cd17954
DEAD-box helicase domain of DEAD box protein 47; DDX47 (also called E4-DEAD box protein) can ...
163-376 1.60e-32

DEAD-box helicase domain of DEAD box protein 47; DDX47 (also called E4-DEAD box protein) can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. DX47 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350712 [Multi-domain]  Cd Length: 203  Bit Score: 123.97  E-value: 1.60e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 163 TFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPtnkgFRAL 239
Cdd:cd17954    1 TFKELG----VCEELCEACEKLGWKKPTKIQEEAIPVALQGRDIIGLAETGSGKTAAFALPILQALlenPQR----FFAL 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 240 VISPTRELASQIHRELIKISEGTGFRIHMI------HKAAIAAkkfgpksSKKFDILVTTPNRLIYLLkQDPPGIDLTNV 313
Cdd:cd17954   73 VLAPTRELAQQISEQFEALGSSIGLKSAVLvggmdmMAQAIAL-------AKKPHVIVATPGRLVDHL-ENTKGFSLKSL 144
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 256985213 314 EWLVVDESDKLFEdgkTGFREQLASIFLacTSPKVRRAM-FSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17954  145 KFLVMDEADRLLN---MDFEPEIDKILK--VIPRERTTYlFSATMTTKVAKLQRASLKNPVKIE 203
DEADc_DDX49 cd17955
DEAD-box helicase domain of DEAD box protein 49; DDX49 (also called Dbp8) is a member of the ...
169-356 4.92e-32

DEAD-box helicase domain of DEAD box protein 49; DDX49 (also called Dbp8) is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350713 [Multi-domain]  Cd Length: 204  Bit Score: 122.72  E-value: 4.92e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 169 QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQ-PTnkGFRALVISPTREL 247
Cdd:cd17955    2 EDLGLSSWLVKQCASLGIKEPTPIQKLCIPEILAGRDVIGGAKTGSGKTAAFALPILQRLSEdPY--GIFALVLTPTREL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFR-------IHMIHKAAIAAKKfgPKsskkfdILVTTPNRLIYLLKQDPPGI-DLTNVEWLVVD 319
Cdd:cd17955   80 AYQIAEQFRALGAPLGLRccvivggMDMVKQALELSKR--PH------IVVATPGRLADHLRSSDDTTkVLSRVKFLVLD 151
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 256985213 320 ESDKLFEDgktGFREQLASIFLACtsPKVRR-AMFSAT 356
Cdd:cd17955  152 EADRLLTG---SFEDDLATILSAL--PPKRQtLLFSAT 184
Lhr COG1201
Lhr-like helicase [Replication, recombination and repair];
177-529 9.78e-31

Lhr-like helicase [Replication, recombination and repair];


Pssm-ID: 224122 [Multi-domain]  Cd Length: 814  Bit Score: 127.76  E-value: 9.78e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL----KQPTNKGFRALVISPTRELASQIH 252
Cdd:COG1201   11 RVREWFKRKFTSLTPPQRYAIPEIHSGENVLIIAPTGSGKTEAAFLPVINELlslgKGKLEDGIYALYISPLKALNNDIR 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTGFRIHMIHKAAIAAKKfgPKSSKKF-DILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDESDKLFEDgKTG 331
Cdd:COG1201   91 RRLEEPLRELGIEVAVRHGDTPQSEK--QKMLKNPpHILITTPESLAILLNSPKFRELLRDVRYVIVDEIHALAES-KRG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 332 frEQLASIF--LACTSPKVRRAMFSATFA--YDVEQWckLNLDN----VVSVSIGARNS-AVETVEQELLFVGSET-GKL 401
Cdd:COG1201  168 --VQLALSLerLRELAGDFQRIGLSATVGppEEVAKF--LVGFGdpceIVDVSAAKKLEiKVISPVEDLIYDEELWaALY 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 402 LAMRELVKKgfKPPVLVFVQSIERAKELFHELIYEG-INVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFK 480
Cdd:COG1201  244 ERIAELVKK--HRTTLIFTNTRSGAERLAFRLKKLGpDIIEVHHGSLSRELRLEVEERLKEGELKAVVATSSLELGIDIG 321
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|
gi 256985213 481 GVNLVINYDFPTSSVEYIHRIGRTG-RAGNRGKAVtFFTEDDKPLLRSVA 529
Cdd:COG1201  322 DIDLVIQLGSPKSVNRFLQRIGRAGhRLGEVSKGI-IIAEDRDDLLECLV 370
DEADc_DDX18 cd17942
DEAD-box helicase domain of DEAD box protein 18; This DDX18 gene encodes a DEAD box protein ...
178-369 3.42e-30

DEAD-box helicase domain of DEAD box protein 18; This DDX18 gene encodes a DEAD box protein and is activated by Myc protein. DDX18 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350700 [Multi-domain]  Cd Length: 198  Bit Score: 117.08  E-value: 3.42e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 178 LQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIP---ILMQLK-QPTNkGFRALVISPTRELASQIH- 252
Cdd:cd17942    2 LKAIEEMGFTKMTEIQAKSIPPLLEGRDVLGAAKTGSGKTLAFLIPaieLLYKLKfKPRN-GTGVIIISPTRELALQIYg 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 --RELIKISEGT-GFRIHMIHKAAIAAkkfgpKSSKKFDILVTTPNRLIYLLkQDPPGIDLTNVEWLVVDESDKLFEdgk 329
Cdd:cd17942   81 vaKELLKYHSQTfGIVIGGANRKAEAE-----KLGKGVNILVATPGRLLDHL-QNTKGFLYKNLQCLIIDEADRILE--- 151
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 256985213 330 TGFREQLASIfLACTsPKVRRAM-FSATFAYDVEQWCKLNL 369
Cdd:cd17942  152 IGFEEEMRQI-IKLL-PKRRQTMlFSATQTRKVEDLARISL 190
DEADc_DDX43_DDX53 cd17958
DEAD-box helicase domain of DEAD box proteins 43 and 53; DDX43 (also called cancer/testis ...
177-375 8.05e-30

DEAD-box helicase domain of DEAD box proteins 43 and 53; DDX43 (also called cancer/testis antigen 13 or helical antigen) displays tumor-specific expression. Diseases associated with DDX43 include rheumatoid lung disease. DDX53 is also called cancer/testis antigen 26 or DEAD-Box Protein CAGE. Both DDX46 and DDX53 are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350716 [Multi-domain]  Cd Length: 197  Bit Score: 116.02  E-value: 8.05e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-KQPTNKGFR----ALVISPTRELASQI 251
Cdd:cd17958    1 IMKEIKKQGFEKPSPIQSQAWPIILQGIDLIGVAQTGTGKTLAYLLPGFIHLdLQPIPREQRngpgVLVLTPTRELALQI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 252 HRELIKISEgTGFRIHMIHKAAIAAKKFgPKSSKKFDILVTTPNRLIYLlkQDPPGIDLTNVEWLVVDESDKLFEdgkTG 331
Cdd:cd17958   81 EAECSKYSY-KGLKSVCVYGGGNRNEQI-EDLSKGVDIIIATPGRLNDL--QMNNVINLKSITYLVLDEADRMLD---MG 153
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 256985213 332 FREQLASIFLAcTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSV 375
Cdd:cd17958  154 FEPQIRKILLD-IRPDRQTIMTSATWPDGVRRLAQSYLKDPMIV 196
DEADc_DDX5_DDX17 cd17966
DEAD-box helicase domain of ATP-dependent RNA helicases DDX5 and DDX17; DDX5 and DDX17 are ...
177-363 9.12e-30

DEAD-box helicase domain of ATP-dependent RNA helicases DDX5 and DDX17; DDX5 and DDX17 are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350724 [Multi-domain]  Cd Length: 197  Bit Score: 115.93  E-value: 9.12e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLK-QP---TNKGFRALVISPTRELASQIH 252
Cdd:cd17966    1 VMDELKRQGFTEPTAIQAQGWPMALSGRDMVGIAQTGSGKTLAFLLPAIVHINaQPpleRGDGPIVLVLAPTRELAQQIQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 253 RELIKISEGTGFRIHMIHKAAiaakkfgPKSSKKFD------ILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFE 326
Cdd:cd17966   81 QEANKFGGSSRLRNTCVYGGA-------PKGPQIRDlrrgveICIATPGRLIDFLDQGK--TNLRRVTYLVLDEADRMLD 151
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 256985213 327 dgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQ 363
Cdd:cd17966  152 ---MGFEPQIRKI-VDQIRPDRQTLMWSATWPKEVRR 184
DEADc_DDX31 cd17949
DEAD-box helicase domain of DEAD box protein 31; DDX31 (also called helicain or G2 helicase) ...
185-376 1.12e-28

DEAD-box helicase domain of DEAD box protein 31; DDX31 (also called helicain or G2 helicase) plays a role in ribosome biogenesis and TP53/p53 regulation through its interaction with NPM1. DDX31 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350707 [Multi-domain]  Cd Length: 214  Bit Score: 113.45  E-value: 1.12e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 185 GFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-KQPT----NKGFRALVISPTRELASQIHRELIKIs 259
Cdd:cd17949   10 GIEKPTAIQKLAIPVLLQGRDVLVRSQTGSGKTLAYLLPIIQRLlSLEPrvdrSDGTLALVLVPTRELALQIYEVLEKL- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 260 egtGFRIHMIHKAAIAA--KKFGPKSS--KKFDILVTTPNRLIYLLkQDPPGIDLTNVEWLVVDESDKLFEdgkTGFREQ 335
Cdd:cd17949   89 ---LKPFHWIVPGYLIGgeKRKSEKARlrKGVNILIATPGRLLDHL-KNTQSFDVSNLRWLVLDEADRLLD---MGFEKD 161
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 256985213 336 LASIF----------LACTSPKVRR--AMFSATFAYDVEQWCKLNLDNVVSVS 376
Cdd:cd17949  162 ITKILellddkrskaGGEKSKPSRRqtVLVSATLTDGVKRLAGLSLKDPVYID 214
DEADc_DDX39 cd17950
DEAD-box helicase domain of DEAD box protein 39; DDX39A is involved in pre-mRNA splicing and ...
169-366 1.23e-27

DEAD-box helicase domain of DEAD box protein 39; DDX39A is involved in pre-mRNA splicing and is required for the export of mRNA out of the nucleus. DDX39B is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. Diseases associated with DDX39A (also called UAP56-Related Helicase, 49 kDa) include gastrointestinal stromal tumor and inflammatory bowel disease 6, while diseases associated with DDX39B (also called 56 kDa U2AF65-Associated Protein) include Plasmodium vivax malaria. DDX39 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350708 [Multi-domain]  Cd Length: 208  Bit Score: 110.13  E-value: 1.23e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 169 QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPTNKgFRALVISPTRELA 248
Cdd:cd17950    5 RDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQLEPVDGQ-VSVLVICHTRELA 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 249 SQIHRELIKISE-------GTGFRIHMIHKAAIAAKKFGPksskkfDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDES 321
Cdd:cd17950   84 FQISNEYERFSKympnvktAVFFGGVPIKKDIEVLKNKCP------HIVVGTPGRILALVREK--KLKLSHVKHFVLDEC 155
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 256985213 322 DKLFEDGKTgfREQLASIFLACTSPKvRRAMFSATFAYDVEQWCK 366
Cdd:cd17950  156 DKMLEQLDM--RRDVQEIFRATPHDK-QVMMFSATLSKEIRPVCK 197
DEADc_DDX1 cd17938
DEAD-box helicase domain of DEAD box protein 1; DEAD box protein 1 (DDX1) acts as an ...
177-365 1.64e-27

DEAD-box helicase domain of DEAD box protein 1; DEAD box protein 1 (DDX1) acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. It possesses 5' single-stranded RNA overhang nuclease activity as well as ATPase activity on various RNA, but not DNA polynucleotides. DDX1 may play a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. It may also be involved in 3'-end cleavage and polyadenylation of pre-mRNAs. DDX1 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350696 [Multi-domain]  Cd Length: 204  Bit Score: 109.72  E-value: 1.64e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILmQLkqptnkgFRALVISPTRELASQIHRELI 256
Cdd:cd17938   10 LIKAVEELDWLLPTDIQAEAIPLILGGGDVLMAAETGSGKTGAFCLPVL-QI-------VVALILEPSRELAEQTYNCIE 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 257 KisegtgFRIHM-----IHKAAIAAKKFGPKSS---KKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEDG 328
Cdd:cd17938   82 N------FKKYLdnpklRVALLIGGVKAREQLKrleSGVDIVVGTPGRLEDLIKTGK--LDLSSVRFFVLDEADRLLSQG 153
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 256985213 329 KTGFREQLASIFLACTSPKVRRAM--FSATF-AYDVEQWC 365
Cdd:cd17938  154 NLETINRIYNRIPKITSDGKRLQVivCSATLhSFEVKKLA 193
HELICc smart00490
helicase superfamily c-terminal domain;
427-508 1.67e-27

helicase superfamily c-terminal domain;


Pssm-ID: 197757 [Multi-domain]  Cd Length: 82  Bit Score: 105.37  E-value: 1.67e-27
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   427 KELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGR 506
Cdd:smart00490   1 EELAELLKELGIKVARLHGGLSQEEREEILDKFNNGKIKVLVATDVAERGLDLPGVDLVIIYDLPWSPASYIQRIGRAGR 80

                   ..
gi 256985213   507 AG 508
Cdd:smart00490  81 AG 82
DEADc_DDX17 cd18050
DEAD-box helicase domain of DEAD box protein 17; DDX17 (also called DEAD Box Protein P72 or ...
132-378 3.65e-27

DEAD-box helicase domain of DEAD box protein 17; DDX17 (also called DEAD Box Protein P72 or DEAD Box Protein P82) has a wide variety of functions including regulating the alternative splicing of exons exhibiting specific features such as the inclusion of AC-rich alternative exons in CD44 transcripts, playing a role in innate immunity, and promoting mRNA degradation mediated by the antiviral zinc-finger protein ZC3HAV1 in an ATPase-dependent manner. DDX17 synergizes with DDX5 and SRA1 RNA to activate MYOD1 transcriptional activity and is involved in skeletal muscle differentiation. DDX17 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350808  Cd Length: 271  Bit Score: 110.87  E-value: 3.65e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 132 KLEHLRKEKVNFFRNKHKIHVQGTDLPDPIATFQQLDqeykINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAP 211
Cdd:cd18050   32 EVARMTQYDVEELRRKKEITIRGVGCPKPVFAFHQAN----FPQYVMDVLLDQNFKEPTPIQCQGFPLALSGRDMVGIAQ 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 212 TGSGKTLAFSIPILMQLK-QP---TNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAakkfGPKS---S 284
Cdd:cd18050  108 TGSGKTLAYLLPAIVHINhQPyleRGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPK----GPQIrdlE 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 285 KKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQW 364
Cdd:cd18050  184 RGVEICIATPGRLIDFLEAGK--TNLRRCTYLVLDEADRMLD---MGFEPQIRKI-VDQIRPDRQTLMWSATWPKEVRQL 257
                        250
                 ....*....|....
gi 256985213 365 CKLNLDNVVSVSIG 378
Cdd:cd18050  258 AEDFLRDYVQINIG 271
DEADc_EIF4A cd17939
DEAD-box helicase domain of eukaryotic initiation factor 4A; The eukaryotic initiation ...
170-373 4.91e-27

DEAD-box helicase domain of eukaryotic initiation factor 4A; The eukaryotic initiation factor-4A (eIF4A) family consists of 3 proteins EIF4A1, EIF4A2, and EIF4A3. These factors are required for the binding of mRNA to 40S ribosomal subunits. In addition these proteins are helicases that function to unwind double-stranded RNA. EIF4A proteins are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350697 [Multi-domain]  Cd Length: 199  Bit Score: 108.18  E-value: 4.91e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 170 EYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRELAS 249
Cdd:cd17939    1 DMGLSEDLLRGIYAYGFEKPSAIQQRAIVPIIKGRDVIAQAQSGTGKTATFSIGALQRI-DTTVRETQALVLAPTRELAQ 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 250 QIHRELIKISEGTGFRIH-MIHKAAIAAKKFgpKSSKKFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFedg 328
Cdd:cd17939   80 QIQKVVKALGDYMGVKVHaCIGGTSVREDRR--KLQYGPHIVVGTPGRVFDMLQRR--SLRTDKIKMFVLDEADEML--- 152
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 256985213 329 KTGFREQLASIFLACTsPKVRRAMFSATFAYDVEQWCKLNLDNVV 373
Cdd:cd17939  153 SRGFKDQIYDIFQFLP-PETQVVLFSATMPHEVLEVTKKFMRDPV 196
DEADc_DDX5 cd18049
DEAD-box helicase domain of DEAD box protein 5; DDX5 (also called RNA helicase P68, HLR1, ...
139-379 1.23e-26

DEAD-box helicase domain of DEAD box protein 5; DDX5 (also called RNA helicase P68, HLR1, G17P1, or HUMP68) is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. It synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and is involved in skeletal muscle differentiation. Dysregulation of this gene may play a role in cancer development. DDX5 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350807 [Multi-domain]  Cd Length: 234  Bit Score: 108.17  E-value: 1.23e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 139 EKVNFFRNKHKIHVQGTDLPDPIATFQqldqEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTL 218
Cdd:cd18049    1 QEVEQYRRSKEITVRGHNCPKPVLNFY----EANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 219 AFSIPILMQLK-QP---TNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAakkfGPKS---SKKFDILV 291
Cdd:cd18049   77 SYLLPAIVHINhQPfleRGDGPICLVLAPTRELAQQVQQVAAEYGRACRLKSTCIYGGAPK----GPQIrdlERGVEICI 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 292 TTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQLASIfLACTSPKVRRAMFSATFAYDVEQWCKLNLDN 371
Cdd:cd18049  153 ATPGRLIDFLEAGK--TNLRRCTYLVLDEADRMLD---MGFEPQIRKI-VDQIRPDRQTLMWSATWPKEVRQLAEDFLKD 226

                 ....*...
gi 256985213 372 VVSVSIGA 379
Cdd:cd18049  227 YIHINIGA 234
DEADc_DDX20 cd17943
DEAD-box helicase domain of DEAD box protein 20; DDX20 (also called DEAD Box Protein DP 103, ...
177-374 2.24e-25

DEAD-box helicase domain of DEAD box protein 20; DDX20 (also called DEAD Box Protein DP 103, Component Of Gems 3, Gemin-3, and SMN-Interacting Protein) interacts directly with SMN (survival of motor neurons), the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on ribonucleoproteins. Diseases associated with DDX20 include spinal muscular atrophy and muscular atrophy. DDX20 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350701 [Multi-domain]  Cd Length: 192  Bit Score: 103.50  E-value: 2.24e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKqPTNKGFRALVISPTRELASQIHRELI 256
Cdd:cd17943    1 VLEGLKAAGFQRPSPIQLAAIPLGLAGHDLIVQAKSGTGKTLVFVVIALESLD-LERRHPQVLILAPTREIAVQIHDVFK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 257 KISE-GTGFRIH-MIHKAAIAAKKfgpKSSKKFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDgktGFRE 334
Cdd:cd17943   80 KIGKkLEGLKCEvFIGGTPVKEDK---KKLKGCHIAVGTPGRIKQLIELG--ALNVSHVRLFVLDEADKLMEG---SFQK 151
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 256985213 335 QLASIFLACtsPKVRR-AMFSATFAYdveqwcklNLDNVVS 374
Cdd:cd17943  152 DVNWIFSSL--PKNKQvIAFSATYPK--------NLDNLLA 182
DEADc_DDX19_DDX25 cd17963
DEAD-box helicase domain of ATP-dependent RNA helicases DDX19 and DDX25; DDX19 (also called ...
173-362 2.66e-25

DEAD-box helicase domain of ATP-dependent RNA helicases DDX19 and DDX25; DDX19 (also called DEAD box RNA helicase DEAD5) and DDX25 (also called gonadotropin-regulated testicular RNA helicase (GRTH)) are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350721 [Multi-domain]  Cd Length: 196  Bit Score: 103.42  E-value: 2.66e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 173 INSRLLQNILDAGFQVPTPIQMQAIPVMLHG--RELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRELASQ 250
Cdd:cd17963    1 LKPELLKGLYAMGFNKPSKIQETALPLILSDppENLIAQSQSGTGKTAAFVLAMLSRV-DPTLKSPQALCLAPTRELARQ 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 251 IHRELIKISEGTGFRIHmihkAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDGkt 330
Cdd:cd17963   80 IGEVVEKMGKFTGVKVA----LAVPGNDVPRGKKITAQIVIGTPGTVLDWLKKR--QLDLKKIKILVLDEADVMLDTQ-- 151
                        170       180       190
                 ....*....|....*....|....*....|....
gi 256985213 331 GFREQLASI--FLactSPKVRRAMFSATFAYDVE 362
Cdd:cd17963  152 GHGDQSIRIkrML---PRNCQILLFSATFPDSVR 182
DEADc_DDX28 cd17948
DEAD-box helicase domain of DEAD box protein 28; DDX28 (also called mitochondrial DEAD-box ...
177-363 5.35e-25

DEAD-box helicase domain of DEAD box protein 28; DDX28 (also called mitochondrial DEAD-box polypeptide 28) plays an essential role in facilitating the proper assembly of the mitochondrial large ribosomal subunit and its helicase activity is essential for this function. DDX28 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350706 [Multi-domain]  Cd Length: 231  Bit Score: 103.60  E-value: 5.35e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQ-LKQPTNKGF-----RALVISPTRELASQ 250
Cdd:cd17948    1 LVEILQRQGITKPTTVQKQGIPSILRGRNTLCAAETGSGKTLTYLLPIIQRlLRYKLLAEGpfnapRGLVITPSRELAEQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 251 IHRELIKISEGTGFRIHMIH----KAAIAAKKFGpksskKFDILVTTPNRLIYLLKQdppGI-DLTNVEWLVVDESDKLF 325
Cdd:cd17948   81 IGSVAQSLTEGLGLKVKVITggrtKRQIRNPHFE-----EVDILVATPGALSKLLTS---RIySLEQLRHLVLDEADTLL 152
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 256985213 326 EDGKTGF------REQLASIFLACT---SPKVRRAMFSATFAYDVEQ 363
Cdd:cd17948  153 DDSFNEKlshflrRFPLASRRSENTdglDPGTQLVLVSATMPSGVGE 199
DEADc_DDX41 cd17951
DEAD-box helicase domain of DEAD box protein 41; DDX41 (also called ABS and MPLPF) interacts ...
177-356 6.83e-25

DEAD-box helicase domain of DEAD box protein 41; DDX41 (also called ABS and MPLPF) interacts with several spliceosomal proteins and may recognize the bacterial second messengers cyclic di-GMP and cyclic di-AMP, resulting in the induction of genes involved in the innate immune response. Diseases associated with DDX41 include "myeloproliferative/lymphoproliferative neoplasms, familial" and "Ddx41-related susceptibility to familial myeloproliferative/lymphoproliferative neoplasms". DDX41 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350709 [Multi-domain]  Cd Length: 206  Bit Score: 102.42  E-value: 6.83e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILM-----QLKQP--TNKGFRALVISPTRELAS 249
Cdd:cd17951    1 ILKGLKKKGIKKPTPIQMQGLPTILSGRDMIGIAFTGSGKTLVFTLPLIMfaleqEKKLPfiKGEGPYGLIVCPSRELAR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 250 QIHrELI-----KISEGTGFRIH-MIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDK 323
Cdd:cd17951   81 QTH-EVIeyyckALQEGGYPQLRcLLCIGGMSVKEQLEVIRKGVHIVVATPGRLMDMLNKKK--INLDICRYLCLDEADR 157
                        170       180       190
                 ....*....|....*....|....*....|...
gi 256985213 324 LFEdgkTGFREQLASIFLACTSPKvRRAMFSAT 356
Cdd:cd17951  158 MID---MGFEEDIRTIFSYFKGQR-QTLLFSAT 186
DEADc_EIF4AII_EIF4AI_DDX2 cd18046
DEAD-box helicase domain of eukaryotic initiation factor 4A-I and 4-II; Eukaryotic initiation ...
177-361 6.77e-21

DEAD-box helicase domain of eukaryotic initiation factor 4A-I and 4-II; Eukaryotic initiation factor 4A-I (DDX2A) and eukaryotic initiation factor 4A-II (DDX2B) are involved in cap recognition and are required for mRNA binding to ribosome. They are DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350804 [Multi-domain]  Cd Length: 201  Bit Score: 90.97  E-value: 6.77e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRELASQIHRELI 256
Cdd:cd18046   10 LLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFSISILQQI-DTSLKATQALVLAPTRELAQQIQKVVM 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 257 KISEGTGFRIHmihkAAIAAKKFGPKSSKKFD---ILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEdgkTGFR 333
Cdd:cd18046   89 ALGDYMGIKCH----ACIGGTSVRDDAQKLQAgphIVVGTPGRVFDMINRR--YLRTDYIKMFVLDEADEMLS---RGFK 159
                        170       180
                 ....*....|....*....|....*...
gi 256985213 334 EQLASIFlACTSPKVRRAMFSATFAYDV 361
Cdd:cd18046  160 DQIYDIF-QKLPPDTQVVLLSATMPNDV 186
DEADc_MRH4 cd17965
DEAD-box helicase domain of ATP-dependent RNA helicase MRH4; Mitochondrial RNA helicase 4 ...
164-327 7.78e-21

DEAD-box helicase domain of ATP-dependent RNA helicase MRH4; Mitochondrial RNA helicase 4 (MRH4) plays an essential role during the late stages of mitochondrial ribosome or mitoribosome assembly by promoting remodeling of the 21S rRNA-protein interactions. MRH4 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350723 [Multi-domain]  Cd Length: 251  Bit Score: 92.05  E-value: 7.78e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 164 FQQLD-----QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGR----------------ELLASAPTGSGKTLAFSI 222
Cdd:cd17965    1 FDQLKllpsvREAIIKEILKGSNKTDEEIKPSPIQTLAIKKLLKTLmrkvtkqtsneepkleVFLLAAETGSGKTLAYLA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 223 PILMQLKQ----------------PTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIhKAAIAA--KKFGPKSS 284
Cdd:cd17965   81 PLLDYLKRqeqepfeeaeeeyesaKDTGRPRSVILVPTHELVEQVYSVLKKLSHTVKLGIKTF-SSGFGPsyQRLQLAFK 159
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 256985213 285 KKFDILVTTPNRLIYLLKQDPPgiDLTNVEWLVVDESDKLFED 327
Cdd:cd17965  160 GRIDILVTTPGKLASLAKSRPK--ILSRVTHLVVDEADTLFDR 200
DEADc_EIF4AIII_DDX48 cd18045
DEAD-box helicase domain of eukaryotic initiation factor 4A-III; Eukaryotic initiation factor ...
177-361 1.83e-20

DEAD-box helicase domain of eukaryotic initiation factor 4A-III; Eukaryotic initiation factor 4A-III (EIF4AIII, also known as DDX48) is part of the exon junction complex (EJC) that plays a major role in posttranscriptional regulation of mRNA. EJC consists of four proteins (eIF4AIII, Barentsz [Btz], Mago, and Y14), mRNA, and ATP. DDX48 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350803 [Multi-domain]  Cd Length: 201  Bit Score: 89.45  E-value: 1.83e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 177 LLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILmQLKQPTNKGFRALVISPTRELASQIHRELI 256
Cdd:cd18045   10 LLRGIYAYGFEKPSAIQQRAIKPIIKGRDVIAQSQSGTGKTATFSISVL-QCLDIQVRETQALILSPTRELAVQIQKVLL 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 257 KISEGTGFRIHmihkAAIAAKKFGPKSSK---KFDILVTTPNRLIYLLKQDppGIDLTNVEWLVVDESDKLFEDgktGFR 333
Cdd:cd18045   89 ALGDYMNVQCH----ACIGGTSVGDDIRKldyGQHIVSGTPGRVFDMIRRR--SLRTRHIKMLVLDEADEMLNK---GFK 159
                        170       180
                 ....*....|....*....|....*...
gi 256985213 334 EQLASIFlACTSPKVRRAMFSATFAYDV 361
Cdd:cd18045  160 EQIYDVY-RYLPPATQVVLVSATLPQDI 186
YprA COG1205
ATP-dependent helicase YprA, contains C-terminal metal-binding DUF1998 domain [Replication, ...
168-526 5.78e-20

ATP-dependent helicase YprA, contains C-terminal metal-binding DUF1998 domain [Replication, recombination and repair];


Pssm-ID: 224126 [Multi-domain]  Cd Length: 851  Bit Score: 94.01  E-value: 5.78e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 168 DQEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQptNKGFRALVISPTREL 247
Cdd:COG1205   50 EFPELRDESLKSALVKAGIERLYSHQVDALRLIREGRNVVVTTGTGSGKTESFLLPILDHLLR--DPSARALLLYPTNAL 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 248 ASQIHRELIKISEGTGFRIH-MIHKAAIAAKKFGPKSSKKFDILVTTPNRLIYLL--KQDPPGIDLTNVEWLVVDESDkl 324
Cdd:COG1205  128 ANDQAERLRELISDLPGKVTfGRYTGDTPPEERRAIIRNPPDILLTNPDMLHYLLlrNHDAWLWLLRNLKYLVVDELH-- 205
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 325 FEDGKTG-------------FREQLASIFLACTSPKVR------RAMFSATFAYDVEQwcklnldnvvsvsIGARNSAVE 385
Cdd:COG1205  206 TYRGVQGsevalllrrllrrLRRYGSPLQIICTSATLAnpgefaEELFGRDFEVPVDE-------------DGSPRGLRY 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 386 TVEQELLFV----------GSETGKLLAMreLVKKGFKppVLVFVQSIERAK--ELFHELIYEGINVDVIHAERT----- 448
Cdd:COG1205  273 FVRREPPIRelaesirrsaLAELATLAAL--LVRNGIQ--TLVFFRSRKQVEllYLSPRRRLVREGGKLLDAVSTyragl 348
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 449 -QQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSV-EYIHRIGRTGRAGNrgKAVTFFTEDDKPLLR 526
Cdd:COG1205  349 hREERRRIEAEFKEGELLGVIATNALELGIDIGSLDAVIAYGYPGVSVlSFRQRAGRAGRRGQ--ESLVLVVLRSDPLDS 426
DEXH_lig_assoc TIGR04121
DEXH box helicase, DNA ligase-associated; Members of this protein family are DEAD/DEAH box ...
189-516 7.43e-20

DEXH box helicase, DNA ligase-associated; Members of this protein family are DEAD/DEAH box helicases found associated with a bacterial ATP-dependent DNA ligase, part of a four-gene system that occurs in about 12 % of prokaryotic reference genomes. The actual motif in this family is DE[VILW]H.


Pssm-ID: 274994 [Multi-domain]  Cd Length: 804  Bit Score: 93.77  E-value: 7.43e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  189 PTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL---KQPTNKGFRALVISPTRELASQIHRELIKISEGTG-- 263
Cdd:TIGR04121  14 PRPFQLEMWAAALEGRSGLLIAPTGSGKTLAGFLPSLIDLagpEAPKEKGLHTLYITPLRALAVDIARNLQAPIEELGlp 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  264 FRIHM------IHKAAiAAKKFGPksskkfDILVTTPNRLIYLLKQ-DPPGIdLTNVEWLVVDESDKLFEdGKTGFREQL 336
Cdd:TIGR04121  94 IRVETrtgdtsSSERA-RQRKKPP------DILLTTPESLALLLSYpDAARL-FKDLRCVVVDEWHELAG-SKRGDQLEL 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  337 ASIFLACTSPKVRRAMFSATFAyDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSET-----GKL-LAMRELVKK 410
Cdd:TIGR04121 165 ALARLRRLAPGLRRWGLSATIG-NLEEARRVLLGVGGAPAVLVRGKLPKAIEVISLLPESEErfpwaGHLgLRALPEVYA 243
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  411 GFKP--PVLVFVQSIERAKELFHELIYegINVD---VI---HAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGV 482
Cdd:TIGR04121 244 EIDQarTTLVFTNTRSQAELWFQALWE--ANPEfalPIalhHGSLDREQRRWVEAAMAAGRLRAVVCTSSLDLGVDFGPV 321
                         330       340       350
                  ....*....|....*....|....*....|....
gi 256985213  483 NLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTF 516
Cdd:TIGR04121 322 DLVIQIGSPKGVARLLQRAGRSNHRPGEPSRALL 355
COG1202 COG1202
Superfamily II helicase, archaea-specific [Replication, recombination and repair];
178-514 1.60e-18

Superfamily II helicase, archaea-specific [Replication, recombination and repair];


Pssm-ID: 224123 [Multi-domain]  Cd Length: 830  Bit Score: 89.46  E-value: 1.60e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 178 LQNIL-DAGFQVPTPIQMQAIPV-MLHGRELLASAPTGSGKTLafsIPILMQLKQPTNKGFRALVISPTRELASQIHREL 255
Cdd:COG1202  205 FKRMLkREGIEELLPVQVLAVEAgLLEGENLLVVSATASGKTL---IGELAGIPRLLSGGKKMLFLVPLVALANQKYEDF 281
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 256 IKISEGTGFRIHmIHKAAIAAKKFGPK----SSKKFDILVTTPNRLIYLLKQdppGIDLTNVEWLVVDESDKLfEDGKTG 331
Cdd:COG1202  282 KERYSKLGLKVA-IRVGMSRIKTREEPvvvdTSPDADIIVGTYEGIDYLLRT---GKDLGDIGTVVIDEIHTL-EDEERG 356
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 332 FR-----EQLASIFlactsPKVRRAMFSATFAYDVEQWCKLNLDNVVsvsigaRNSAVETVEQELLFVGSETGKLLAMRE 406
Cdd:COG1202  357 PRldgliGRLRYLF-----PGAQFIYLSATVGNPEELAKKLGAKLVL------YDERPVPLERHLVFARNESEKWDIIAR 425
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 407 LVK--------KGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGID 478
Cdd:COG1202  426 LVKrefstessKGYRGQTIVFTYSRRRCHELADALTGKGLKAAPYHAGLPYKERKSVERAFAAQELAAVVTTAALAAGVD 505
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*.
gi 256985213 479 FKGvNLVInydFPT--------SSVEYIHRIGRTGRAG--NRGKAV 514
Cdd:COG1202  506 FPA-SQVI---FESlamgiewlSVREFQQMLGRAGRPDyhDRGKVY 547
DEXHc_LHR-like cd17922
DEXH-box helicase domain of LHR; Large helicase-related protein (LHR) is a DNA ...
203-320 1.67e-17

DEXH-box helicase domain of LHR; Large helicase-related protein (LHR) is a DNA damage-inducible helicase that uses ATP hydrolysis to drive unidirectional 3'-to-5' translocation along single-stranded DNA (ssDNA) and to unwind RNA:DNA duplexes. This group also includes related bacterial and archaeal helicases from the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 350680 [Multi-domain]  Cd Length: 166  Bit Score: 79.93  E-value: 1.67e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 203 GRELLASAPTGSGKTLAFSIPILMQLKQPTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIH---------KAA 273
Cdd:cd17922    1 GRNVLIAAPTGSGKTEAAFLPALSSLADEPEKGVQVLYISPLKALINDQERRLEEPLDEIDLEIPVAVrhgdtsqseKAK 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 256985213 274 IAAKkfgPKsskkfDILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDE 320
Cdd:cd17922   81 QLKN---PP-----GILITTPESLELLLVNKKLRELFAGLRYVVVDE 119
DEXHc_Ski2 cd17921
DEXH-box helicase domain of DEAD-like helicase Ski2 family proteins; Ski2-like RNA helicases ...
190-364 2.84e-17

DEXH-box helicase domain of DEAD-like helicase Ski2 family proteins; Ski2-like RNA helicases play an important role in RNA degradation, processing, and splicing pathways. They belong to the type II DEAD box helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 350679 [Multi-domain]  Cd Length: 181  Bit Score: 79.61  E-value: 2.84e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 190 TPIQMQAI-PVMLHGRELLASAPTGSGKTLAFSIPILMQLKQptnKGFRALVISPTRELASQIHRELIKISEGTGFRIHM 268
Cdd:cd17921    3 NPIQREALrALYLSGDSVLVSAPTSSGKTLIAELAILRALAT---SGGKAVYIAPTRALVNQKEADLRERFGPLGKNVGL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 269 IhkaaIAAKKFGPKSSKKFDILVTTPNRL-IYLLKqdPPGIDLTNVEWLVVDESdKLFEDGKTGFREQLASIFLACTSPK 347
Cdd:cd17921   80 L----TGDPSVNKLLLAEADILVATPEKLdLLLRN--GGERLIQDVRLVVVDEA-HLIGDGERGVVLELLLSRLLRINKN 152
                        170
                 ....*....|....*....
gi 256985213 348 VRRAMFSATF--AYDVEQW 364
Cdd:cd17921  153 ARFVGLSATLpnAEDLAEW 171
RecQ COG0514
Superfamily II DNA helicase RecQ [Replication, recombination and repair];
176-526 4.91e-17

Superfamily II DNA helicase RecQ [Replication, recombination and repair];


Pssm-ID: 223588 [Multi-domain]  Cd Length: 590  Bit Score: 84.27  E-value: 4.91e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 176 RLLQNILD-AGFQVPtpiQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMqLKQPTnkgfraLVISPtreLAS----Q 250
Cdd:COG0514    7 QVLKQVFGyASFRPG---QQEIIDALLSGKDTLVVMPTGGGKSLCYQIPALL-LEGLT------LVVSP---LISlmkdQ 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 251 IHRELIKisegtGFRIHMIHKAA--------IAAKKFGpksskKFDILVTTP-----NRLIYLLKQDPPGIdltnvewLV 317
Cdd:COG0514   74 VDQLEAA-----GIRAAYLNSTLsreerqqvLNQLKSG-----QLKLLYISPerlmsPRFLELLKRLPISL-------VA 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 318 VDESDKLFEDGKTgFREQLASI-FLACTSPKVRRAMFSATFAYDVEQ-WCKLNLDNVVSVSIGA------RNSAVE--TV 387
Cdd:COG0514  137 IDEAHCISQWGHD-FRPDYRRLgRLRAGLPNPPVLALTATATPRVRDdIREQLGLQDANIFRGSfdrpnlALKVVEkgEP 215
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 388 EQELLFVGSETGKLLAmrelvkkgfkpPVLVFVQSIERAKELFHELIYEGINVDVIHA-----ERTQQQRDntvhsFRAG 462
Cdd:COG0514  216 SDQLAFLATVLPQLSK-----------SGIIYCLTRKKVEELAEWLRKNGISAGAYHAglsneERERVQQA-----FLND 279
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 256985213 463 KIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLR 526
Cdd:COG0514  280 EIKVMVATNAFGMGIDKPDVRFVIHYDLPGSIESYYQETGRAGRDGLPAEAILLYSPEDIRWQR 343
BRR2 COG1204
Replicative superfamily II helicase [Replication, recombination and repair];
191-534 1.57e-16

Replicative superfamily II helicase [Replication, recombination and repair];


Pssm-ID: 224125 [Multi-domain]  Cd Length: 766  Bit Score: 83.20  E-value: 1.57e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 191 PIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQptnKGFRALVISPTRELASQIHRELiKISEGTGFRIHMIH 270
Cdd:COG1204   35 PQQEAVEKGLLSDENVLISAPTGSGKTLIALLAILSTLLE---GGGKVVYIVPLKALAEEKYEEF-SRLEELGIRVGIST 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 271 kaaiAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIdlTNVEWLVVDESDKLfedgktGFREQLASI-----FLACTS 345
Cdd:COG1204  111 ----GDYDLDDERLARYDVIVTTPEKLDSLTRKRPSWI--EEVDLVVIDEIHLL------GDRTRGPVLesivaRMRRLN 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 346 PKVRRAMFSATF--AYDVEQWckLNLDNVVSV-----------------SIGARNS----------------AVETVEQE 390
Cdd:COG1204  179 ELIRIVGLSATLpnAEEVADW--LNAKLVESDwrpvplrrgvpyvgaflGADGKKKtwpllidnlalelvleSLAEGGQV 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 391 LLFVGSETGKLLAMRELVKKGFKP--------------PVLVFVQSIERAKELfHELIYEGINVDviHAERTQQQRDNTV 456
Cdd:COG1204  257 LVFVHSRKEAEKTAKKLRIKMSATlsddekivldegasPILIPETPTSEDEEL-AELVLRGVAFH--HAGLPREDRQLVE 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 457 HSFRAGKIWVLICTALLARgidfkGVNL----VINYD----------FPTSSVEYIHRIGRTGRAG--NRGKAVTFFTED 520
Cdd:COG1204  334 DAFRKGKIKVLVSTPTLAA-----GVNLpartVIIKDtrrydpkggiVDIPVLDVLQMAGRAGRPGydDYGEAIILATSH 408
                        410
                 ....*....|....
gi 256985213 521 DKPLLRsVANVIQQ 534
Cdd:COG1204  409 DELEYL-AELYIQS 421
PRK01172 PRK01172
ski2-like helicase; Provisional
193-508 1.38e-15

ski2-like helicase; Provisional


Pssm-ID: 100801 [Multi-domain]  Cd Length: 674  Bit Score: 79.93  E-value: 1.38e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 193 QMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKqptnKGFRALVISPTRELASQIHRELIKISEgTGFRIHMihka 272
Cdd:PRK01172  27 QRMAIEQLRKGENVIVSVPTAAGKTLIAYSAIYETFL----AGLKSIYIVPLRSLAMEKYEELSRLRS-LGMRVKI---- 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 273 AIAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDltNVEWLVVDESDKLFEDGKTGFREQLASIfLACTSPKVRRAM 352
Cdd:PRK01172  98 SIGDYDDPPDFIKRYDVVILTSEKADSLIHHDPYIIN--DVGLIVADEIHIIGDEDRGPTLETVLSS-ARYVNPDARILA 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 353 FSATF--AYDVEQWckLNLDNVVSvsiGARNSAVET---VEQELLFVGSETGKL---LAMRELVKKGFKppVLVFVQSIE 424
Cdd:PRK01172 175 LSATVsnANELAQW--LNASLIKS---NFRPVPLKLgilYRKRLILDGYERSQVdinSLIKETVNDGGQ--VLVFVSSRK 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 425 RAK---------------------------ELFHELIYEGINVDviHAERTQQQRDNTVHSFRAGKIWVLICTALLARGI 477
Cdd:PRK01172 248 NAEdyaemliqhfpefndfkvssennnvydDSLNEMLPHGVAFH--HAGLSNEQRRFIEEMFRNRYIKVIVATPTLAAGV 325
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|
gi 256985213 478 DFKGvNLVINYDF---------PTSSVEYIHRIGRTGRAG 508
Cdd:PRK01172 326 NLPA-RLVIVRDItrygnggirYLSNMEIKQMIGRAGRPG 364
DEADc_DDX21_DDX50 cd17944
DEAD-box helicase domain of DEAD box proteins 21 and 50; DDX21 (also called Gu-Alpha and ...
191-361 1.98e-15

DEAD-box helicase domain of DEAD box proteins 21 and 50; DDX21 (also called Gu-Alpha and nucleolar RNA helicase 2) is an RNA helicase that acts as a sensor of the transcriptional status of both RNA polymerase (Pol) I and II. It promotes ribosomal RNA (rRNA) processing and transcription from polymerase II (Pol II) and binds various RNAs, such as rRNAs, snoRNAs, 7SK and, at lower extent, mRNAs. DDX50 (also called Gu-Beta, Nucleolar Protein Gu2, and malignant cell derived RNA helicase). DDX21 and DDX50 have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. Diseases associated with DDX21 include stomach disease and cerebral creatine deficiency syndrome 3. Diseases associated with DDX50 include rectal disease. Both are members of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. Their name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region.


Pssm-ID: 350702 [Multi-domain]  Cd Length: 202  Bit Score: 74.88  E-value: 1.98e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 191 PIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLK---QPTNKGF--RALVISPTRELASQIHRELIKISEG---T 262
Cdd:cd17944   15 PIQVKTFHPVYSGKDLIAQARTGTGKTFSFAIPLIEKLQedqQPRKRGRapKVLVLAPTRELANQVTKDFKDITRKlsvA 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 263 GFRIHMIHKAAIAAKKFGpksskkFDILVTTPNRLIYLLKQDPpgIDLTNVEWLVVDESDKLFEdgkTGFREQLASI--- 339
Cdd:cd17944   95 CFYGGTPYQQQIFAIRNG------IDILVGTPGRIKDHLQNGR--LDLTKLKHVVLDEVDQMLD---MGFAEQVEEIlsv 163
                        170       180
                 ....*....|....*....|....*.
gi 256985213 340 -FLACTSPKVRRAMFSAT---FAYDV 361
Cdd:cd17944  164 sYKKDSEDNPQTLLFSATcpdWVYNV 189
MPH1 COG1111
ERCC4-related helicase [Replication, recombination and repair];
395-521 3.70e-15

ERCC4-related helicase [Replication, recombination and repair];


Pssm-ID: 224036 [Multi-domain]  Cd Length: 542  Bit Score: 78.15  E-value: 3.70e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 395 GSETGKLLAMRELVKKGFKPP----VLVFVQSIERAKELFHELIYEGINVDVI---HAER------TQQQRDNTVHSFRA 461
Cdd:COG1111  344 GVEHPKLEKLREILKEQLEKNgdsrVIVFTEYRDTAEEIVNFLKKIGIKARVRfigQASRegdkgmSQKEQKEIIDQFRK 423
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 462 GKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRaGNRGKAVTFFTEDD 521
Cdd:COG1111  424 GEYNVLVATSVGEEGLDIPEVDLVIFYEPVPSEIRSIQRKGRTGR-KRKGRVVVLVTEGT 482
SF2-N cd00046
N-terminal DEAD/H-box helicase domain of superfamily 2 helicases; The DEAD/H-like superfamily ...
203-356 6.54e-15

N-terminal DEAD/H-box helicase domain of superfamily 2 helicases; The DEAD/H-like superfamily 2 helicases comprise a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This N-terminal domain contains the ATP-binding region.


Pssm-ID: 350668 [Multi-domain]  Cd Length: 146  Bit Score: 72.05  E-value: 6.54e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 203 GRELLASAPTGSGKTLAFSIPILMQLKQptnKGFRALVISPTRELASQIHRELIKISeGTGFRIHMIHkaaiAAKKFGPK 282
Cdd:cd00046    1 GENVLITAPTGSGKTLAALLAALLLLLK---KGKKVLVLVPTKALALQTAERLRELF-GPGIRVAVLV----GGSSAEER 72
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256985213 283 SSKKF---DILVTTPNRlIYLLKQDPPGIDLTNVEWLVVDESDKLFEDGKTGFREQLASIFLActSPKVRRAMFSAT 356
Cdd:cd00046   73 EKNKLgdaDIIIATPDM-LLNLLLREDRLFLKDLKLIIVDEAHALLIDSRGALILDLAVRKAG--LKNAQVILLSAT 146
DEADc_DDX25 cd18048
DEAD-box helicase domain of DEAD box protein 25; DDX25 (also called gonadotropin-regulated ...
148-357 5.58e-14

DEAD-box helicase domain of DEAD box protein 25; DDX25 (also called gonadotropin-regulated testicular RNA helicase (GRTH) is a testis-specific protein essential for completion of spermatogenesis. DDX25 is also a novel negative regulator of IFN pathway and facilitates RNA virus infection. Diseases associated with DDX25 include hydrolethalus syndrome, an autosomal recessive lethal malformation syndrome characterized by multiple developmental defects of fetus.. DDX25 (also called gonadotropin-regulated testicular RNA helicase) is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350806 [Multi-domain]  Cd Length: 229  Bit Score: 71.59  E-value: 5.58e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 148 HKIHVQGTDLPDPIATFQQLdQEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHG--RELLASAPTGSGKTLAFSIPIL 225
Cdd:cd18048    1 HRVEVLQRDPTSPLFSVKSF-EELHLKEELLRGIYAMGFNRPSKIQENALPMMLADppQNLIAQSQSGTGKTAAFVLAML 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 226 MQLKqpTNKGF-RALVISPTRELASQIHR---ELIKISEGtgfrIHMIHkaAIAAKKFGPKSSKKFDILVTTPNRLI--- 298
Cdd:cd18048   80 SRVD--ALKLYpQCLCLSPTFELALQTGKvveEMGKFCVG----IQVIY--AIRGNRPGKGTDIEAQIVIGTPGTVLdwc 151
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256985213 299 YLLKQdppgIDLTNVEWLVVDESDKLFEdgKTGFREQlasiflactSPKVRRAM--------FSATF 357
Cdd:cd18048  152 FKLRL----IDVTNISVFVLDEADVMIN--VQGHSDH---------SVRVKRSMpkecqmllFSATF 203
recQ_fam TIGR00614
ATP-dependent DNA helicase, RecQ family; All proteins in this family for which functions are ...
185-527 1.13e-12

ATP-dependent DNA helicase, RecQ family; All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129701 [Multi-domain]  Cd Length: 470  Bit Score: 70.18  E-value: 1.13e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  185 GFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMqlkqptNKGFrALVISPtreLASQIHRELIKISEgtgf 264
Cdd:TIGR00614   8 GLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALC------SDGI-TLVISP---LISLMEDQVLQLKA---- 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  265 rihmihkAAIAAKKFGPKSSK-------------KFDILVTTP------NRLIYLLKQDppgidlTNVEWLVVDESDKLF 325
Cdd:TIGR00614  74 -------SGIPATFLNSSQSKeqqknvltdlkdgKIKLLYVTPekcsasNRLLQTLEER------KGITLIAVDEAHCIS 140
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  326 EDGKTgFREQLASI-FLACTSPKVRRAMFSATFAYDVEQ--WCKLNLDN--VVSVSIGARNSAVEtveqellfVGSETGK 400
Cdd:TIGR00614 141 QWGHD-FRPDYKALgSLKQKFPNVPIMALTATASPSVREdiLRQLNLKNpqIFCTSFDRPNLYYE--------VRRKTPK 211
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  401 LLA-MRELVKKGFK-PPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGID 478
Cdd:TIGR00614 212 ILEdLLRFIRKEFKgKSGIIYCPSRKKSEQVTASLQNLGIAAGAYHAGLEISARDDVHHKFQRDEIQVVVATVAFGMGIN 291
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....*....
gi 256985213  479 FKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRS 527
Cdd:TIGR00614 292 KPDVRFVIHYSLPKSMESYYQESGRAGRDGLPSECHLFYAPADINRLRR 340
SF2_C cd18785
C-terminal helicase domain of superfamily 2 DEAD/H-box helicases; Superfamily (SF)2 helicases ...
415-518 5.47e-12

C-terminal helicase domain of superfamily 2 DEAD/H-box helicases; Superfamily (SF)2 helicases include DEAD-box helicases, UvrB, RecG, Ski2, Sucrose Non-Fermenting (SNF) family helicases, and dicer proteins, among others. Similar to SF1 helicases, they do not form toroidal structures like SF3-6 helicases. SF2 helicases are a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Their helicase core is surrounded by C- and N-terminal domains with specific functions such as nucleases, RNA or DNA binding domains, or domains engaged in protein-protein interactions. The core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350172 [Multi-domain]  Cd Length: 77  Bit Score: 61.18  E-value: 5.47e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 415 PVLVFVQSIERAKELFHELIyeginvdvihaertqqqrdntvhsfragkiwVLICTALLARGIDFKGVNLVINYDFPTSS 494
Cdd:cd18785    5 KIIVFTNSIEHAEEIASSLE-------------------------------ILVATNVLGEGIDVPSLDTVIFFDPPSSA 53
                         90       100
                 ....*....|....*....|....
gi 256985213 495 VEYIHRIGRTGRAGNRGKAVTFFT 518
Cdd:cd18785   54 ASYIQRVGRAGRGGKDEGEVILFV 77
DEXHc_archSki2 cd18028
DEXH-box helicase domain of archaeal Ski2-type helicase; Archaeal Ski2-type RNA helicases play ...
191-320 5.83e-12

DEXH-box helicase domain of archaeal Ski2-type helicase; Archaeal Ski2-type RNA helicases play an important role in RNA degradation, processing and splicing pathways. They belong to the type II DEAD box helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 350786 [Multi-domain]  Cd Length: 177  Bit Score: 64.28  E-value: 5.83e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 191 PIQMQAI-PVMLHGRELLASAPTGSGKTLAFSIPILMQLKqptnKGFRALVISPTRELASQIHRELiKISEGTGFRIhmi 269
Cdd:cd18028    4 PPQAEAVrAGLLKGENLLISIPTASGKTLIAEMAMVNTLL----EGGKALYLVPLRALASEKYEEF-KKLEEIGLKV--- 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 256985213 270 hkaAIAAKKF--GPKSSKKFDILVTTPNRLIYLLKQDPPGIDltNVEWLVVDE 320
Cdd:cd18028   76 ---GISTGDYdeDDEWLGDYDIIVATYEKFDSLLRHSPSWLR--DVGVVVVDE 123
DEXHc_Hrq1-like cd17923
DEAH-box helicase domain of Hrq1 and similar proteins; Yeast Hrq1, similar to RecQ4, plays a ...
193-320 9.51e-12

DEAH-box helicase domain of Hrq1 and similar proteins; Yeast Hrq1, similar to RecQ4, plays a role in DNA inter-strand crosslink (ICL) repair and in telomere maintenance. Hrq1 lacks the Sld2-like domain found in RecQ4. Hrq1 belongs to the type II DEAD box helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 350681 [Multi-domain]  Cd Length: 182  Bit Score: 63.76  E-value: 9.51e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 193 QMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQptNKGFRALVISPTRELA-SQIhRELIKISEGTGFRIHMihk 271
Cdd:cd17923    5 QAEAIEAARAGRSVVVTTGTASGKSLCYQLPILEALLR--DPGSRALYLYPTKALAqDQL-RSLRELLEQLGLGIRV--- 78
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 256985213 272 AAIAAKKfgPKSSKKF------DILVTTPNRLIYLLkqDPPGID----LTNVEWLVVDE 320
Cdd:cd17923   79 ATYDGDT--PREERRAiirnppRILLTNPDMLHYAL--LPHHDRwarfLRNLRYVVLDE 133
SSL2 COG1061
Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];
188-520 1.09e-11

Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 67.08  E-value: 1.09e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 188 VPTPIQMQAIPVMLHGREL----LASAPTGSGKTLaFSIPILMQLKQPTnkgfraLVISPTRELASQIHRELIKisegtg 263
Cdd:COG1061   36 ELRPYQEEALDALVKNRRTerrgVIVLPTGAGKTV-VAAEAIAELKRST------LVLVPTKELLDQWAEALKK------ 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 264 FRIHMIHKAAIAAKKfgpKSSKKFDILVTT---PNRLIYLLKQDPPGIDLtnvewLVVDE-------SDKLFEDGKTGFR 333
Cdd:COG1061  103 FLLLNDEIGIYGGGE---KELEPAKVTVATvqtLARRQLLDEFLGNEFGL-----IIFDEvhhlpapSYRRILELLSAAY 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 334 EQLA----------------------------------SIFLA---CTSPKVrramfsaTFAYDVEQWcKLNLDNVVSVS 376
Cdd:COG1061  175 PRLGltatperedggrigdlfdligpivyevslkelidEGYLApykYVEIKV-------TLTEDEERE-YAKESARFREL 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 377 IGARNSAVETVEQELLFVGSETgKLLAMRELVKKGFKP-PVLVFVQSIERAKELFHELIYEGInVDVIHAERTQQQRDNT 455
Cdd:COG1061  247 LRARGTLRAENEARRIAIASER-KIAAVRGLLLKHARGdKTLIFASDVEHAYEIAKLFLAPGI-VEAITGETPKEEREAI 324
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 256985213 456 VHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGR-AGNRGKAVTFFTED 520
Cdd:COG1061  325 LERFRTGGIKVLVTVKVLDEGVDIPDADVLIILRPTGSRRLFIQRLGRGLRpAEGKEDTLALDYSL 390
recQ TIGR01389
ATP-dependent DNA helicase RecQ; The ATP-dependent DNA helicase RecQ of E. coli is about 600 ...
178-526 1.39e-11

ATP-dependent DNA helicase RecQ; The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273594 [Multi-domain]  Cd Length: 591  Bit Score: 67.02  E-value: 1.39e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  178 LQNILDAGFQVPT--PIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQlkqptnKGFrALVISPTREL-------- 247
Cdd:TIGR01389   1 AQQVLKRTFGYDDfrPGQEEIISHVLDGRDVLVVMPTGGGKSLCYQVPALLL------KGL-TVVISPLISLmkdqvdql 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  248 -ASQIHRELIKISEGTGFRIHMIHKAaiaakkfgpkSSKKFDILVTTPNRLI--YLLKQdppgIDLTNVEWLVVDESDKL 324
Cdd:TIGR01389  74 rAAGVAAAYLNSTLSAKEQQDIEKAL----------VNGELKLLYVAPERLEqdYFLNM----LQRIPIALVAVDEAHCV 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  325 FEDGKTgFR-EQLASIFLACTSPKVRRAMFSAT----FAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQEllfvgsetG 399
Cdd:TIGR01389 140 SQWGHD-FRpEYQRLGSLAERFPQVPRIALTATadaeTRQDIRELLRLADANEFITSFDRPNLRFSVVKKN--------N 210
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  400 KLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHA-----ERTQQQRDntvhsFRAGKIWVLICTALLA 474
Cdd:TIGR01389 211 KQKFLLDYLKKHRGQSGIIYASSRKKVEELAERLESQGISALAYHAglsnkVRAENQED-----FLYDDVKVMVATNAFG 285
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|..
gi 256985213  475 RGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLR 526
Cdd:TIGR01389 286 MGIDKPNVRFVIHYDMPGNLESYYQEAGRAGRDGLPAEAILLYSPADIALLK 337
TopG2 COG1110
Reverse gyrase [Replication, recombination and repair];
201-478 4.26e-11

Reverse gyrase [Replication, recombination and repair];


Pssm-ID: 224035 [Multi-domain]  Cd Length: 1187  Bit Score: 65.87  E-value: 4.26e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  201 LHGRELLASAPTGSGKTlafSIPILMQLKQPTnKGFRALVISPTRELASQIHRELIKISEGTG-FRIHMIHKAAIAAKKf 279
Cdd:COG1110    95 VRGKSFAIIAPTGVGKT---TFGLLMSLYLAK-KGKRVYIIVPTTTLVRQVYERLKKFAEDAGsLDVLVVYHSALPTKE- 169
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  280 gPKSSKK------FDILVTTPNRLIY----LLKQDPpgiDLtnvewLVVDESDKLFEDGKT--------GFREqlASIFL 341
Cdd:COG1110   170 -KEEALEriesgdFDILITTSQFLSKrfeeLSKLKF---DF-----IFVDDVDAILKASKNvdrllrllGFSE--EVIES 238
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  342 ACTSPKVRRAMFSATFAYDVEQWCKLNLDN------------VVSVSIGARNSAVETVEQELLF-VGS------------ 396
Cdd:COG1110   239 AYELIKLRRKLYGEKRAERVREELREVERErekkrrklgilvVSSATGKPRGSRLKLFRELLGFeVGSggeglrnivdiy 318
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  397 -ETGKLLAMRELVKKgFKPPVLVFVQS---IERAKELFHELIYEGINVDVIHAERTQqqrdnTVHSFRAGKIWVLICTA- 471
Cdd:COG1110   319 vESESLEKVVELVKK-LGDGGLIFVPIdygREKAEELAEYLRSHGINAELIHAEKEE-----ALEDFEEGEVDVLVGVAs 392
                         330
                  ....*....|
gi 256985213  472 ---LLARGID 478
Cdd:COG1110   393 yygVLVRGLD 402
DEADc_DDX19 cd18047
DEAD-box helicase domain of DEAD box protein 19; DDX19 is an RNA helicase involved in both ...
169-357 4.37e-11

DEAD-box helicase domain of DEAD box protein 19; DDX19 is an RNA helicase involved in both mRNA (mRNA) export from the nucleus into the cytoplasm and in mRNA translation. DDX19 functions in the nucleus in resolving RNA:DNA hybrids (R-loops). Activation of a DNA damage response pathway dependent upon the ATR kinase, a major regulator of replication fork progression, stimulates translocation of DDX19 from the cytoplasm into the nucleus. Only nuclear Ddx19 is competent to resolve R-loops. DDX19 is a member of the DEAD-box helicases, a diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP-binding region.


Pssm-ID: 350805 [Multi-domain]  Cd Length: 205  Bit Score: 62.43  E-value: 4.37e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 169 QEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHG--RELLASAPTGSGKTLAFSIPILMQLkQPTNKGFRALVISPTRE 246
Cdd:cd18047    4 EELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEppQNLIAQSQSGTGKTAAFVLAMLSQV-EPANKYPQCLCLSPTYE 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 247 LASQIHRELIKISEgtgFRIHMIHKAAIAAKKFGPKSSKKFDILVTTPNRLI-YLLKQDPpgIDLTNVEWLVVDESDKLF 325
Cdd:cd18047   83 LALQTGKVIEQMGK---FYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLdWCSKLKF--IDPKKIKVFVLDEADVMI 157
                        170       180       190
                 ....*....|....*....|....*....|...
gi 256985213 326 edGKTGFREQlaSIFLACTSPK-VRRAMFSATF 357
Cdd:cd18047  158 --ATQGHQDQ--SIRIQRMLPRnCQMLLFSATF 186
PRK13767 PRK13767
ATP-dependent helicase; Provisional
186-320 4.73e-11

ATP-dependent helicase; Provisional


Pssm-ID: 237497 [Multi-domain]  Cd Length: 876  Bit Score: 65.68  E-value: 4.73e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 186 FQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQL-----KQPTNKGFRALVISPTRELASQIHRELI---- 256
Cdd:PRK13767  30 FGTFTPPQRYAIPLIHEGKNVLISSPTGSGKTLAAFLAIIDELfrlgrEGELEDKVYCLYVSPLRALNNDIHRNLEeplt 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 257 ---KISEGTGFRIHMIhKAAIaakKFGPKSS--------KKFDILVTTPNRLIYLL-----KQDppgidLTNVEWLVVDE 320
Cdd:PRK13767 110 eirEIAKERGEELPEI-RVAI---RTGDTSSyekqkmlkKPPHILITTPESLAILLnspkfREK-----LRTVKWVIVDE 180
SF2_C_FANCM_Hef cd18801
C-terminal helicase domain of Fanconi anemia group M family helicases; Fanconi anemia group M ...
400-514 1.38e-10

C-terminal helicase domain of Fanconi anemia group M family helicases; Fanconi anemia group M (FANCM) protein is a DNA-dependent ATPase component of the Fanconi anemia (FA) core complex. It is required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. Hef (helicase-associated endonuclease fork-structure) belongs to the XPF/MUS81/FANCM family of endonucleases and is involved in stalled replication fork repair. FANCM and Hef are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350188 [Multi-domain]  Cd Length: 143  Bit Score: 59.29  E-value: 1.38e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 400 KLLAMRELVKKGFK-------PPVLVFVQSIERAKELFHELIYEGINVDVI----HAER------TQQQRDNTVHSFRAG 462
Cdd:cd18801   10 KLEKLEEIVKEHFKkkqegsdTRVIIFSEFRDSAEEIVNFLSKIRPGIRATrfigQASGksskgmSQKEQKEVIEQFRKG 89
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 256985213 463 KIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRaGNRGKAV 514
Cdd:cd18801   90 GYNVLVATSIGEEGLDIGEVDLIICYDASPSPIRMIQRMGRTGR-KRQGRVV 140
SF2_C_TRCF cd18810
C-terminal helicase domain of the transcription-repair coupling factor; Transcription-repair ...
393-524 1.28e-09

C-terminal helicase domain of the transcription-repair coupling factor; Transcription-repair coupling factor (TrcF) dissociates transcription elongation complexes blocked at nonpairing lesions and mediates recruitment of DNA repair proteins. TrcF is a DEAD-like helicase belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350197 [Multi-domain]  Cd Length: 151  Bit Score: 56.97  E-value: 1.28e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 393 FVGSETGKLLA---MRELVKKGFKPPVLVFVQSIERAKELFHELIYEgINVDVIHAERTQQQRDNTVHSFRAGKIWVLIC 469
Cdd:cd18810    5 YVMPYDDELIReaiERELLRGGQVFYVHNRIESIEKLATQLRQLVPE-ARIAIAHGQMTENELEEVMLEFAKGEYDILVC 83
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 256985213 470 TALLARGIDFKGVNLVINYDFPTSSVEYIHRI-GRTGRAGNRGKAVtFFTEDDKPL 524
Cdd:cd18810   84 TTIIESGIDIPNANTIIIERADKFGLAQLYQLrGRVGRSKERAYAY-FLYPDQKKL 138
PRK09401 PRK09401
reverse gyrase; Reviewed
200-478 1.35e-09

reverse gyrase; Reviewed


Pssm-ID: 236498 [Multi-domain]  Cd Length: 1176  Bit Score: 61.10  E-value: 1.35e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  200 MLHGRELLASAPTGSGKTlafSIPILMQLKQPTnKGFRALVISPTRELASQIHRELIKISEGTGF--RIHMIHKAAIAAK 277
Cdd:PRK09401   92 LLLGESFAIIAPTGVGKT---TFGLVMSLYLAK-KGKKSYIIFPTRLLVEQVVEKLEKFGEKVGCgvKILYYHSSLKKKE 167
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  278 KFGPKS---SKKFDILVTTPNRLIY---LLKQDPPgiDLtnvewLVVDESDKLFEDGKT--------GF----------- 332
Cdd:PRK09401  168 KEEFLErlkEGDFDILVTTSQFLSKnfdELPKKKF--DF-----VFVDDVDAVLKSSKNidkllyllGFseediekamel 240
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  333 -----------------REQLAS---------IFLACTSPKVRRA-MFSATFAYDVEqwcklnldnvvSVSIGARNsave 385
Cdd:PRK09401  241 irlkrkyeeiyekirelEEKIAElkdkkgvlvVSSATGRPRGNRVkLFRELLGFEVG-----------SPVFYLRN---- 305
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213  386 tVEQELLFVGSETGKLLamrELVKKgFKPPVLVFVQS---IERAKELFHELIYEGINVDVIHAERTQQQRDntvhsFRAG 462
Cdd:PRK09401  306 -IVDSYIVDEDSVEKLV---ELVKR-LGDGGLIFVPSdkgKEYAEELAEYLEDLGINAELAISGFERKFEK-----FEEG 375
                         330       340
                  ....*....|....*....|
gi 256985213  463 KIWVLICTA----LLARGID 478
Cdd:PRK09401  376 EVDVLVGVAsyygVLVRGID 395
rgy TIGR01054
reverse gyrase; This model describes reverse gyrase, found in both archaeal and bacterial ...
200-478 1.62e-09

reverse gyrase; This model describes reverse gyrase, found in both archaeal and bacterial thermophiles. This enzyme, a fusion of a type I topoisomerase domain and a helicase domain, introduces positive supercoiling to increase the melting temperature of DNA double strands. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273418 [Multi-domain]  Cd Length: 1171  Bit Score: 61.00  E-value: 1.62e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   200 MLHGRELLASAPTGSGKTlAFSIPILMQLKQptnKGFRALVISPTRELASQIHRELIKISEGTGF---RIHMIHKAAIAA 276
Cdd:TIGR01054   90 VLRGDSFAIIAPTGVGKT-TFGLAMSLFLAK---KGKRCYIILPTTLLVIQVAEKISSLAEKAGVgtvNIGAYHSRLPTK 165
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   277 KKfgpKSSKK------FDILVTTPNRLIYLLKQDPPGIDLtnvewLVVDESDKLFEDGK--------TGFREQLasIFLA 342
Cdd:TIGR01054  166 EK---KEFMEriengdFDILITTTMFLSKNYDELGPKFDF-----IFVDDVDALLKASKnvdkllklLGFSEEL--IEKA 235
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   343 CTSPKVRRAMFSATFAYDVEQWCKLNLDN-----VVSVSIGARNSAVETVEQELL-F-VGSETGKLL------------- 402
Cdd:TIGR01054  236 WKLIRLRLKLYRALHAKKRLELLEAIPGKkrgclIVSSATGRPRGKRAKLFRELLgFeVGGGSDTLRnvvdvyvededlk 315
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213   403 -AMRELVKKgFKPPVLVFVQS---IERAKELFHELIYEGINVDVIHAerTQQQRDntVHSFRAGKIWVLICTA----LLA 474
Cdd:TIGR01054  316 eTLLEIVKK-LGTGGIVYVSIdygKEKAEEIAEFLENHGVKAVAYHA--TKPKED--YEKFAEGEIDVLIGVAsyygTLV 390

                   ....
gi 256985213   475 RGID 478
Cdd:TIGR01054  391 RGLD 394
SF2_C_RecQ cd18794
C-terminal helicase domain of the RecQ family helicases; The RecQ helicase family is an ...
390-517 1.70e-09

C-terminal helicase domain of the RecQ family helicases; The RecQ helicase family is an evolutionarily conserved class of enzymes, dedicated to preserving genomic integrity by operating in telomere maintenance, DNA repair, and replication. They are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350181 [Multi-domain]  Cd Length: 134  Bit Score: 56.06  E-value: 1.70e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 390 ELLFVGSETGKLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLIC 469
Cdd:cd18794    7 SVRPKDKKDEKLDLLKRIKVEHLGGSGIIYCLSRKECEQVAARLQSKGISAAAYHAGLEPSDRRDVQRKWLRDKIQVIVA 86
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 256985213 470 TALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFF 517
Cdd:cd18794   87 TVAFGMGIDKPDVRFVIHYSLPKSMESYYQESGRAGRDGLPSECILFY 134
PRK13766 PRK13766
Hef nuclease; Provisional
400-520 4.34e-09

Hef nuclease; Provisional


Pssm-ID: 237496 [Multi-domain]  Cd Length: 773  Bit Score: 59.12  E-value: 4.34e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 400 KLLAMRELVKK--GFKPP--VLVFVQSIERAKELFHELIYEGINvdvihAER-------------TQQQRDNTVHSFRAG 462
Cdd:PRK13766 348 KLEKLREIVKEqlGKNPDsrIIVFTQYRDTAEKIVDLLEKEGIK-----AVRfvgqaskdgdkgmSQKEQIEILDKFRAG 422
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 256985213 463 KIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRaGNRGKAVTFFTED 520
Cdd:PRK13766 423 EFNVLVSTSVAEEGLDIPSVDLVIFYEPVPSEIRSIQRKGRTGR-QEEGRVVVLIAKG 479
DEXHc_POLQ-like cd18026
DEXH-box helicase domain of DNA polymerase theta; DNA polymerase theta (POLQ) is important in ...
198-356 1.43e-08

DEXH-box helicase domain of DNA polymerase theta; DNA polymerase theta (POLQ) is important in the repair of genomic double-strand breaks (DSBs). POLQ contains an N-terminal type II DEAD box helicase domain which contains the ATP-binding region.


Pssm-ID: 350784 [Multi-domain]  Cd Length: 202  Bit Score: 54.91  E-value: 1.43e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 198 PVMLHGRELLASAPTGSGKTLAFSipILMqLKQPTNKGFRALVISPTRELASQIHRELIKISEGTGFRI--HMIHKaaia 275
Cdd:cd18026   28 PGLLEGRNLVYSLPTSGGKTLVAE--ILM-LKRLLERRKKALFVLPYVSIVQEKVDALSPLFEELGFRVegYAGNK---- 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 276 aKKFGPKSSKKFDILVTTP-------NRLIYLLKQDPPGIdltnvewLVVDESDKLFEDGKTGFREQLASIFLACTSPKV 348
Cdd:cd18026  101 -GRSPPKRRKSLSVAVCTIekanslvNSLIEEGRLDELGL-------VVVDELHMLGDGHRGALLELLLTKLLYAAQKNI 172

                 ....*...
gi 256985213 349 RRAMFSAT 356
Cdd:cd18026  173 QIVGMSAT 180
SF2_C_SNF cd18793
C-terminal helicase domain of the SNF family helicases; The Sucrose Non-Fermenting (SNF) ...
399-502 1.60e-08

C-terminal helicase domain of the SNF family helicases; The Sucrose Non-Fermenting (SNF) family includes chromatin-remodeling factors, such as CHD proteins and SMARCA proteins, recombination proteins Rad54, and many others. They are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.


Pssm-ID: 350180 [Multi-domain]  Cd Length: 135  Bit Score: 53.25  E-value: 1.60e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256985213 399 GKLLAMRELVKKGFKPP--VLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAG-KIWV-