NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|12056969|ref|NP_073149.1|]
View 

homeobox protein Hox-C8 [Homo sapiens]

Protein Classification

homeobox domain-containing protein (domain architecture ID 10441114)

homeobox domain-containing protein may be involved in the transcriptional regulation of key eukaryotic developmental processes; similar to transcription factor LBX, NK1 transcription factor-related protein, and thyroid transcription factor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
153-205 6.15e-27

Homeobox domain;


:

Pssm-ID: 306543  Cd Length: 54  Bit Score: 100.65  E-value: 6.15e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 12056969   153 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK 205
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
 
Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
153-205 6.15e-27

Homeobox domain;


Pssm-ID: 306543  Cd Length: 54  Bit Score: 100.65  E-value: 6.15e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 12056969   153 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK 205
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
149-205 1.76e-23

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 91.16  E-value: 1.76e-23
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 12056969    149 RRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK 205
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
150-208 2.16e-23

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 91.15  E-value: 2.16e-23
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 12056969 150 RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 208
Cdd:cd00086   1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
147-210 1.47e-12

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863  Cd Length: 156  Bit Score: 63.22  E-value: 1.47e-12
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 12056969 147 PGRRSGRQTYSrYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK 210
Cdd:COG5576  50 PPKSKRRRTTD-EQLMVLEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKRSG 112
 
Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
153-205 6.15e-27

Homeobox domain;


Pssm-ID: 306543  Cd Length: 54  Bit Score: 100.65  E-value: 6.15e-27
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 12056969   153 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK 205
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWK 54
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
149-205 1.76e-23

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 91.16  E-value: 1.76e-23
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 12056969    149 RRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWK 205
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
150-208 2.16e-23

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 91.15  E-value: 2.16e-23
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 12056969 150 RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 208
Cdd:cd00086   1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
147-210 1.47e-12

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863  Cd Length: 156  Bit Score: 63.22  E-value: 1.47e-12
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 12056969 147 PGRRSGRQTYSrYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK 210
Cdd:COG5576  50 PPKSKRRRTTD-EQLMVLEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKRSG 112
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH