NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|10946942|ref|NP_067494.1|]
View 

endothelial differentiation-related factor 1 [Mus musculus]

Protein Classification

multiprotein bridging factor 1 (domain architecture ID 12094464)

multiprotein bridging factor 1 is a transcriptional coactivator with a C-terminal XRE (Xenobiotic Response Element) family DNA-binding helix-turn-helix domain

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MBF1 pfam08523
Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 ...
4-72 1.26e-27

Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 (MBF1) which forms a heterodimer with MBF2. It has been shown to make direct contact with the TATA-box binding protein (TBP) and interacts with Ftz-F1, stabilizing the Ftz-F1-DNA complex. It is also found in the endothelial differentiation-related factor (EDF-1). Human EDF-1 is involved in the repression of endothelial differentiation, interacts with CaM and is phosphorylated by PKC. The domain is found in a wide range of eukaryotic proteins including metazoans, fungi and plants. A helix-turn-helix motif (pfam01381) is found to its C-terminus.


:

Pssm-ID: 337091  Cd Length: 71  Bit Score: 97.30  E-value: 1.26e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10946942     4 SDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSIT--KNTAKLDRETEELHHDR 72
Cdd:pfam08523   1 QDWDSVTVIGKKAPRATVARSESALNAARRSGAVVETEKKFYAGTNKAHKATegQNAAKLDRETEELKHKK 71
aMBF1 super family cl26727
Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and ...
48-142 8.67e-16

Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and HTH domains [Translation, ribosomal structure and biogenesis];


The actual alignment was detected with superfamily member COG1813:

Pssm-ID: 331548 [Multi-domain]  Cd Length: 165  Bit Score: 69.77  E-value: 8.67e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10946942  48 QNKQHSITKNTAKLDRETEELHHDrvtleVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERA 127
Cdd:COG1813  56 AQKPRGSPRRERRDNDELPELVED-----YGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKL 130
                        90
                ....*....|....*
gi 10946942 128 IGLKLRGKDIGKPIE 142
Cdd:COG1813 131 LGIKLVEKVDEEEEG 145
 
Name Accession Description Interval E-value
MBF1 pfam08523
Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 ...
4-72 1.26e-27

Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 (MBF1) which forms a heterodimer with MBF2. It has been shown to make direct contact with the TATA-box binding protein (TBP) and interacts with Ftz-F1, stabilizing the Ftz-F1-DNA complex. It is also found in the endothelial differentiation-related factor (EDF-1). Human EDF-1 is involved in the repression of endothelial differentiation, interacts with CaM and is phosphorylated by PKC. The domain is found in a wide range of eukaryotic proteins including metazoans, fungi and plants. A helix-turn-helix motif (pfam01381) is found to its C-terminus.


Pssm-ID: 337091  Cd Length: 71  Bit Score: 97.30  E-value: 1.26e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10946942     4 SDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSIT--KNTAKLDRETEELHHDR 72
Cdd:pfam08523   1 QDWDSVTVIGKKAPRATVARSESALNAARRSGAVVETEKKFYAGTNKAHKATegQNAAKLDRETEELKHKK 71
aMBF1 COG1813
Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and ...
48-142 8.67e-16

Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and HTH domains [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224726 [Multi-domain]  Cd Length: 165  Bit Score: 69.77  E-value: 8.67e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10946942  48 QNKQHSITKNTAKLDRETEELHHDrvtleVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERA 127
Cdd:COG1813  56 AQKPRGSPRRERRDNDELPELVED-----YGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKL 130
                        90
                ....*....|....*
gi 10946942 128 IGLKLRGKDIGKPIE 142
Cdd:COG1813 131 LGIKLVEKVDEEEEG 145
HTH_XRE smart00530
Helix-turn-helix XRE-family like proteins;
81-133 2.27e-10

Helix-turn-helix XRE-family like proteins;


Pssm-ID: 197775 [Multi-domain]  Cd Length: 56  Bit Score: 52.52  E-value: 2.27e-10
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 10946942     81 IQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133
Cdd:smart00530   2 LKELREEKGLTQEELAEKLGVSRSTLSRIENGKRKPSLETLKKLAKALGVSLD 54
HTH_XRE cd00093
Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the ...
78-132 1.41e-09

Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.


Pssm-ID: 238045 [Multi-domain]  Cd Length: 58  Bit Score: 50.63  E-value: 1.41e-09
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 10946942  78 GKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKL 132
Cdd:cd00093   1 GERLKELRKEKGLTQEELAEKLGVSRSTISRIENGKRNPSLETLEKLAKALGVSL 55
HTH_3 pfam01381
Helix-turn-helix; This large family of DNA binding helix-turn helix proteins includes Cro and ...
81-133 3.32e-09

Helix-turn-helix; This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.


Pssm-ID: 334515 [Multi-domain]  Cd Length: 55  Bit Score: 49.44  E-value: 3.32e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 10946942    81 IQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133
Cdd:pfam01381   1 LKELREELGLSQEELAEKLGVSRSTISKIENGKREPSLETLKKLAEALGVSLD 53
TIGR00270 TIGR00270
TIGR00270 family protein; [Hypothetical proteins, Conserved]
78-144 7.19e-07

TIGR00270 family protein; [Hypothetical proteins, Conserved]


Pssm-ID: 129371 [Multi-domain]  Cd Length: 154  Bit Score: 45.67  E-value: 7.19e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 10946942    78 GKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKG 144
Cdd:TIGR00270  71 GIIIRREREKRGWSQEQLAKKIQEKESLIKKIENAEIEPEPKVVEKLEKLLKIKLREQVPEIKIEKS 137
PRK06424 PRK06424
transcription factor; Provisional
79-132 3.84e-05

transcription factor; Provisional


Pssm-ID: 102369  Cd Length: 144  Bit Score: 41.08  E-value: 3.84e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 10946942   79 KVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKL 132
Cdd:PRK06424  87 ELVKNARERLSMSQADLAAKIFERKNVIASIERGDLLPDIKTARKLEKILGITL 140
 
Name Accession Description Interval E-value
MBF1 pfam08523
Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 ...
4-72 1.26e-27

Multiprotein bridging factor 1; This domain is found in the multiprotein bridging factor 1 (MBF1) which forms a heterodimer with MBF2. It has been shown to make direct contact with the TATA-box binding protein (TBP) and interacts with Ftz-F1, stabilizing the Ftz-F1-DNA complex. It is also found in the endothelial differentiation-related factor (EDF-1). Human EDF-1 is involved in the repression of endothelial differentiation, interacts with CaM and is phosphorylated by PKC. The domain is found in a wide range of eukaryotic proteins including metazoans, fungi and plants. A helix-turn-helix motif (pfam01381) is found to its C-terminus.


Pssm-ID: 337091  Cd Length: 71  Bit Score: 97.30  E-value: 1.26e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10946942     4 SDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSIT--KNTAKLDRETEELHHDR 72
Cdd:pfam08523   1 QDWDSVTVIGKKAPRATVARSESALNAARRSGAVVETEKKFYAGTNKAHKATegQNAAKLDRETEELKHKK 71
aMBF1 COG1813
Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and ...
48-142 8.67e-16

Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and HTH domains [Translation, ribosomal structure and biogenesis];


Pssm-ID: 224726 [Multi-domain]  Cd Length: 165  Bit Score: 69.77  E-value: 8.67e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10946942  48 QNKQHSITKNTAKLDRETEELHHDrvtleVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERA 127
Cdd:COG1813  56 AQKPRGSPRRERRDNDELPELVED-----YGERIREAREKRGLSQEDLAAKLKEKVSVIRRIERGEATPNIKVAKKLEKL 130
                        90
                ....*....|....*
gi 10946942 128 IGLKLRGKDIGKPIE 142
Cdd:COG1813 131 LGIKLVEKVDEEEEG 145
HTH_XRE smart00530
Helix-turn-helix XRE-family like proteins;
81-133 2.27e-10

Helix-turn-helix XRE-family like proteins;


Pssm-ID: 197775 [Multi-domain]  Cd Length: 56  Bit Score: 52.52  E-value: 2.27e-10
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 10946942     81 IQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133
Cdd:smart00530   2 LKELREEKGLTQEELAEKLGVSRSTLSRIENGKRKPSLETLKKLAKALGVSLD 54
HTH_XRE cd00093
Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the ...
78-132 1.41e-09

Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.


Pssm-ID: 238045 [Multi-domain]  Cd Length: 58  Bit Score: 50.63  E-value: 1.41e-09
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 10946942  78 GKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKL 132
Cdd:cd00093   1 GERLKELRKEKGLTQEELAEKLGVSRSTISRIENGKRNPSLETLEKLAKALGVSL 55
HTH_3 pfam01381
Helix-turn-helix; This large family of DNA binding helix-turn helix proteins includes Cro and ...
81-133 3.32e-09

Helix-turn-helix; This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.


Pssm-ID: 334515 [Multi-domain]  Cd Length: 55  Bit Score: 49.44  E-value: 3.32e-09
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 10946942    81 IQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133
Cdd:pfam01381   1 LKELREELGLSQEELAEKLGVSRSTISKIENGKREPSLETLKKLAEALGVSLD 53
TIGR00270 TIGR00270
TIGR00270 family protein; [Hypothetical proteins, Conserved]
78-144 7.19e-07

TIGR00270 family protein; [Hypothetical proteins, Conserved]


Pssm-ID: 129371 [Multi-domain]  Cd Length: 154  Bit Score: 45.67  E-value: 7.19e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 10946942    78 GKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKG 144
Cdd:TIGR00270  71 GIIIRREREKRGWSQEQLAKKIQEKESLIKKIENAEIEPEPKVVEKLEKLLKIKLREQVPEIKIEKS 137
PRK06424 PRK06424
transcription factor; Provisional
79-132 3.84e-05

transcription factor; Provisional


Pssm-ID: 102369  Cd Length: 144  Bit Score: 41.08  E-value: 3.84e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 10946942   79 KVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKL 132
Cdd:PRK06424  87 ELVKNARERLSMSQADLAAKIFERKNVIASIERGDLLPDIKTARKLEKILGITL 140
COG1709 COG1709
Predicted transcriptional regulator [Transcription];
78-113 8.61e-05

Predicted transcriptional regulator [Transcription];


Pssm-ID: 224623  Cd Length: 241  Bit Score: 40.78  E-value: 8.61e-05
                        10        20        30
                ....*....|....*....|....*....|....*.
gi 10946942  78 GKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGR 113
Cdd:COG1709  29 GETLRKWREIFNVSQTELARELGVSPSVISDYESGR 64
HipB COG1396
Transcriptional regulator, contains XRE-family HTH domain [Transcription];
76-132 1.53e-03

Transcriptional regulator, contains XRE-family HTH domain [Transcription];


Pssm-ID: 224314 [Multi-domain]  Cd Length: 120  Bit Score: 36.17  E-value: 1.53e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 10946942  76 EVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESG-RAIPNNQVLGKIERAIGLKL 132
Cdd:COG1396   1 SIGERLKELRKKKGLSQEELAERLGVSRSTISRIERGrSESPSLELLARLAAALGVSL 58
HTH_31 pfam13560
Helix-turn-helix domain; This domain is a helix-turn-helix domain that probably binds to DNA.
76-130 4.26e-03

Helix-turn-helix domain; This domain is a helix-turn-helix domain that probably binds to DNA.


Pssm-ID: 316117 [Multi-domain]  Cd Length: 63  Bit Score: 33.66  E-value: 4.26e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 10946942    76 EVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGL 130
Cdd:pfam13560   1 ELGARLRRLRERAGLTQAQLAERLGVSRSTLSRLETGRRRPSPEVLEALARALGA 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH