NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|9055178|ref|NP_061289.1|]
View 

mitochondrial pyruvate carrier 1 isoform 1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MPC super family cl04196
Uncharacterized protein family (UPF0041);
24-105 1.63e-41

Uncharacterized protein family (UPF0041);


The actual alignment was detected with superfamily member pfam03650:

Pssm-ID: 308961  Cd Length: 110  Bit Score: 132.35  E-value: 1.63e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9055178     24 STHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEM 103
Cdd:pfam03650  14 TVHFWAPVMKWGLVIAGISDLKRPPEKISGTQNLALLATGAIWTRWSLVIKPKNYLLASVNFFLGCVGLYQVYRILNYRY 93

                  ..
gi 9055178    104 SK 105
Cdd:pfam03650  94 SQ 95
 
Name Accession Description Interval E-value
MPC pfam03650
Uncharacterized protein family (UPF0041);
24-105 1.63e-41

Uncharacterized protein family (UPF0041);


Pssm-ID: 308961  Cd Length: 110  Bit Score: 132.35  E-value: 1.63e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9055178     24 STHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEM 103
Cdd:pfam03650  14 TVHFWAPVMKWGLVIAGISDLKRPPEKISGTQNLALLATGAIWTRWSLVIKPKNYLLASVNFFLGCVGLYQVYRILNYRY 93

                  ..
gi 9055178    104 SK 105
Cdd:pfam03650  94 SQ 95
 
Name Accession Description Interval E-value
MPC pfam03650
Uncharacterized protein family (UPF0041);
24-105 1.63e-41

Uncharacterized protein family (UPF0041);


Pssm-ID: 308961  Cd Length: 110  Bit Score: 132.35  E-value: 1.63e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9055178     24 STHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEM 103
Cdd:pfam03650  14 TVHFWAPVMKWGLVIAGISDLKRPPEKISGTQNLALLATGAIWTRWSLVIKPKNYLLASVNFFLGCVGLYQVYRILNYRY 93

                  ..
gi 9055178    104 SK 105
Cdd:pfam03650  94 SQ 95
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH