NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|94536848|ref|NP_060888.2|]
View 

spermatogenesis-associated protein 7 isoform 1 [Homo sapiens]

Protein Classification

HSD3 domain-containing protein (domain architecture ID 10633643)

HSD3 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HSD3 pfam15244
Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also ...
10-420 0e+00

Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also goes by the name of spermatogenesis-associated protein 7 or SPAT7. The family carries a single transmembrane domain. It functions in several tissues, and is expressed in the developing and mature mouse retina; it is expressed in multiple retinal layers in the adult mouse retina. Mutations lead to LCA disease, or Leber congenital amaurosis, which results in a number of retinal dystrophies. The disease- phenotype is characterized by severe visual loss at birth, nystagmus, a variety of fundus changes, and minimal or absent recordable responses on the electroretinogram (ERG).


:

Pssm-ID: 317626  Cd Length: 413  Bit Score: 772.46  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    10 TSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDCSVPVSVSTSIKYADQQRREKL 89
Cdd:pfam15244   1 TSVLPRYSPPCLFKGHLSTKSNAFCTDSSSLRLSTLYLIKNHMAVHYNKILSAKAAVDCSVPVSMSSSIKYADQQRREKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    90 KKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVIT 169
Cdd:pfam15244  81 KKELAQCEKELKLAKTSMQANSKNNSKSLLNTLQKPSGEPQDEDEVLIEEMNEFPSFSKSLLPSSERLHLSLPKSSKVLT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   170 NGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 249
Cdd:pfam15244 161 NGTEKNYSSSPSSMDYTTSGPRKSSSSTTNGRRPRKTFPSSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   250 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTEL-SFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDST 328
Cdd:pfam15244 241 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTELsSFKSDFGTAETKNFTDSEVNIEQASSCLTYGTKEKITPLPSQGHDLT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   329 WDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH-LEEEK 407
Cdd:pfam15244 321 WDKVKDGALQYSSSRASCPYSLQPPPMRKIYSEEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHhLEEEK 400
                         410
                  ....*....|...
gi 94536848   408 MRHLLHVLKVDLG 420
Cdd:pfam15244 401 MRHLLHVLKVDLG 413
 
Name Accession Description Interval E-value
HSD3 pfam15244
Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also ...
10-420 0e+00

Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also goes by the name of spermatogenesis-associated protein 7 or SPAT7. The family carries a single transmembrane domain. It functions in several tissues, and is expressed in the developing and mature mouse retina; it is expressed in multiple retinal layers in the adult mouse retina. Mutations lead to LCA disease, or Leber congenital amaurosis, which results in a number of retinal dystrophies. The disease- phenotype is characterized by severe visual loss at birth, nystagmus, a variety of fundus changes, and minimal or absent recordable responses on the electroretinogram (ERG).


Pssm-ID: 317626  Cd Length: 413  Bit Score: 772.46  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    10 TSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDCSVPVSVSTSIKYADQQRREKL 89
Cdd:pfam15244   1 TSVLPRYSPPCLFKGHLSTKSNAFCTDSSSLRLSTLYLIKNHMAVHYNKILSAKAAVDCSVPVSMSSSIKYADQQRREKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    90 KKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVIT 169
Cdd:pfam15244  81 KKELAQCEKELKLAKTSMQANSKNNSKSLLNTLQKPSGEPQDEDEVLIEEMNEFPSFSKSLLPSSERLHLSLPKSSKVLT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   170 NGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 249
Cdd:pfam15244 161 NGTEKNYSSSPSSMDYTTSGPRKSSSSTTNGRRPRKTFPSSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   250 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTEL-SFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDST 328
Cdd:pfam15244 241 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTELsSFKSDFGTAETKNFTDSEVNIEQASSCLTYGTKEKITPLPSQGHDLT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   329 WDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH-LEEEK 407
Cdd:pfam15244 321 WDKVKDGALQYSSSRASCPYSLQPPPMRKIYSEEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHhLEEEK 400
                         410
                  ....*....|...
gi 94536848   408 MRHLLHVLKVDLG 420
Cdd:pfam15244 401 MRHLLHVLKVDLG 413
 
Name Accession Description Interval E-value
HSD3 pfam15244
Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also ...
10-420 0e+00

Spermatogenesis-associated protein 7, or HSD3; Spermatogenesis-associated protein HSD3 also goes by the name of spermatogenesis-associated protein 7 or SPAT7. The family carries a single transmembrane domain. It functions in several tissues, and is expressed in the developing and mature mouse retina; it is expressed in multiple retinal layers in the adult mouse retina. Mutations lead to LCA disease, or Leber congenital amaurosis, which results in a number of retinal dystrophies. The disease- phenotype is characterized by severe visual loss at birth, nystagmus, a variety of fundus changes, and minimal or absent recordable responses on the electroretinogram (ERG).


Pssm-ID: 317626  Cd Length: 413  Bit Score: 772.46  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    10 TSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDCSVPVSVSTSIKYADQQRREKL 89
Cdd:pfam15244   1 TSVLPRYSPPCLFKGHLSTKSNAFCTDSSSLRLSTLYLIKNHMAVHYNKILSAKAAVDCSVPVSMSSSIKYADQQRREKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848    90 KKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVIT 169
Cdd:pfam15244  81 KKELAQCEKELKLAKTSMQANSKNNSKSLLNTLQKPSGEPQDEDEVLIEEMNEFPSFSKSLLPSSERLHLSLPKSSKVLT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   170 NGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 249
Cdd:pfam15244 161 NGTEKNYSSSPSSMDYTTSGPRKSSSSTTNGRRPRKTFPSSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEA 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   250 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTEL-SFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDST 328
Cdd:pfam15244 241 KSFLSQYRYYTPAKRKKDFTDQRIEAETQTELsSFKSDFGTAETKNFTDSEVNIEQASSCLTYGTKEKITPLPSQGHDLT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 94536848   329 WDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH-LEEEK 407
Cdd:pfam15244 321 WDKVKDGALQYSSSRASCPYSLQPPPMRKIYSEEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHhLEEEK 400
                         410
                  ....*....|...
gi 94536848   408 MRHLLHVLKVDLG 420
Cdd:pfam15244 401 MRHLLHVLKVDLG 413
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH