NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7839172|ref|NP_058161.1|]
View 

TPA: gag protein [Saccharomyces cerevisiae S288C]

Protein Classification

TYA domain-containing protein (domain architecture ID 10470239)

TYA domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.43e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.43e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839172     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.43e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.43e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839172     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-180 8.20e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 41.85  E-value: 8.20e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7839172    124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMtSTKKYVRPPPM-----LTSPND 180
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSL-ALHEETDPPPVslkqtLWPPDD 3033
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.43e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.43e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     17 ACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 7839172     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
46-141 4.54e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 313063  Cd Length: 837  Bit Score: 42.30  E-value: 4.54e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     46 ASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMI----PYTPYQMSPMY 121
Cdd:pfam09770 196 AAMRAQAKKPAQQPAPAPPQQPQAPPAQQQQQQQQFPPQQQQQQQPQQQPQQPQQHPGQGHPVTIlqrpQSKQPDPPQPS 275
                          90       100
                  ....*....|....*....|
gi 7839172    122 FPPGPQSQFPQYPSSVGTPL 141
Cdd:pfam09770 276 PQPQAQPFHQQPPPVPVQPT 295
Cytadhesin_P30 pfam07271
Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 ...
45-144 7.46e-04

Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localized on the tip organelle. It is thought that it is important in cytadherence and virulence.


Pssm-ID: 284643  Cd Length: 308  Bit Score: 40.99  E-value: 7.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     45 KASTKANSQQTTTPASSAVPENPHHASPQPASvpPPQNGPYPQQCMMTQNQANPSGWSFYG----------HPSMIPYTP 114
Cdd:pfam07271 137 QAAAEAHAEAETEPAGQNVANNPQMGINQPQI--NINFGPNPQQRINPQCFGFPMQPGQMAmrpgfnqmppHMGGAPPNQ 214
                          90       100       110
                  ....*....|....*....|....*....|
gi 7839172    115 YQMSPMYFPPGPqsQFPQYPSSVGTPLSTP 144
Cdd:pfam07271 215 MGMRPGFNQMPP--QMGGMAPRPGFPNHMP 242
PHA03247 PHA03247
large tegument protein UL36; Provisional
47-180 8.20e-04

large tegument protein UL36; Provisional


Pssm-ID: 223021  Cd Length: 3151  Bit Score: 41.85  E-value: 8.20e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     47 STKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANP-SGWSFYGHPSMIPYTPY--QMSPMYFP 123
Cdd:PHA03247 2894 STESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPtTDPAGAGEPSGAVPQPWlgALVPGRVA 2973
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7839172    124 PgPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMtSTKKYVRPPPM-----LTSPND 180
Cdd:PHA03247 2974 V-PRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSL-ALHEETDPPPVslkqtLWPPDD 3033
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
52-149 3.79e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 308660  Cd Length: 938  Bit Score: 39.70  E-value: 3.79e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7839172     52 SQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGwsfyghPSMIPYTPYQMSPMYFPPGPQSQFP 131
Cdd:pfam03154 181 QQPAPTPATPLPSQTPPPMTSQPQPLPVASPSTITTATSTTTTSRVVSP------VDPNPDPPSIIAPQSAQRGPEGPPT 254
                          90
                  ....*....|....*...
gi 7839172    132 QYPSSVGTPLSTPSPESG 149
Cdd:pfam03154 255 PQPHSLQGPPSFPGPAQG 272
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH