NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7706671|ref|NP_057643.1|]
View 

PEX5-related protein isoform 1 [Homo sapiens]

Protein Classification

TPR_1 domain-containing protein (domain architecture ID 10453187)

TPR_1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TPR_1 pfam00515
Tetratricopeptide repeat;
511-541 1.58e-03

Tetratricopeptide repeat;


:

Pssm-ID: 278916  Cd Length: 34  Bit Score: 37.01  E-value: 1.58e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 7706671    511 WNRLGATLANGDRSEEAVEAYTRALEIQPGF 541
Cdd:pfam00515   4 LYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
TPR_1 pfam00515
Tetratricopeptide repeat;
360-393 5.51e-03

Tetratricopeptide repeat;


:

Pssm-ID: 278916  Cd Length: 34  Bit Score: 35.09  E-value: 5.51e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 7706671    360 AEAWQFLGITQAENENEQAAIVALQRCLELQPNN 393
Cdd:pfam00515   1 AKALYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
 
Name Accession Description Interval E-value
TPR_1 pfam00515
Tetratricopeptide repeat;
511-541 1.58e-03

Tetratricopeptide repeat;


Pssm-ID: 278916  Cd Length: 34  Bit Score: 37.01  E-value: 1.58e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 7706671    511 WNRLGATLANGDRSEEAVEAYTRALEIQPGF 541
Cdd:pfam00515   4 LYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
TPR_1 pfam00515
Tetratricopeptide repeat;
360-393 5.51e-03

Tetratricopeptide repeat;


Pssm-ID: 278916  Cd Length: 34  Bit Score: 35.09  E-value: 5.51e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 7706671    360 AEAWQFLGITQAENENEQAAIVALQRCLELQPNN 393
Cdd:pfam00515   1 AKALYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
331-561 1.22e-11

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 66.26  E-value: 1.22e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    331 EEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 410
Cdd:TIGR02917  27 EAAKSYLQKNKYKAAIIQLKNALQKDPNDAEARFLLGKIYLALGDYAAAEKELRKALSLGYPKNQVLPLLARAYLLQGKF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    411 QDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMskspvdssvLEGVKELYLEAAHQNGDmiDPDLQTGLGVLFHLSGEF 490
Cdd:TIGR02917 107 QQVLDELPGKTLLDDEGAAELLALRGLAYLGLGQ---------LELAQKSYEQALAIDPR--SLYAKLGLAQLALAENRF 175
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7706671    491 NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREA 561
Cdd:TIGR02917 176 DEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEA 246
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
266-539 8.20e-10

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533 [Multi-domain]  Cd Length: 291  Bit Score: 59.09  E-value: 8.20e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  266 FERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAQNQVTISASEKGYYFHTENPFKDWpgAFEEGLKRLKEGDLPVT 345
Cdd:COG0457   1 LKDLLLALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAGL--LLLLALALLKLGRLEEA 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  346 ILFMEAAI--LQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALA-VSYTNTGHQQDACDALKNWIK 422
Cdd:COG0457  79 LELLEKALelELLPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLAlGALYELGDYEEALELYEKALE 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  423 QNPKYKYLVKSKKGSPGLTRRMSKspvdssvLEGVKELYLEAAHQNGDmIDPDLQTGLGVLFHLSGEFNRAIDAFNAALT 502
Cdd:COG0457 159 LDPELNELAEALLALGALLEALGR-------YEEALELLEKALKLNPD-DDAEALLNLGLLYLKLGKYEEALEYYEKALE 230
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 7706671  503 VRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP 539
Cdd:COG0457 231 LDPDNAEALYNLALLLLELGRYEEALEALEKALELDP 267
TPR_11 pfam13414
TPR repeat;
473-539 6.11e-09

TPR repeat;


Pssm-ID: 290150 [Multi-domain]  Cd Length: 67  Bit Score: 53.10  E-value: 6.11e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7706671    473 DPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP 539
Cdd:pfam13414   1 NAEALKNLGNALLKKGKYEEAIEAYEKALELDPDAAELYLNLALALLKLGDYEEALEDLEKALELDP 67
PRK11189 PRK11189
lipoprotein NlpI; Provisional
480-529 5.59e-04

lipoprotein NlpI; Provisional


Pssm-ID: 236875 [Multi-domain]  Cd Length: 296  Bit Score: 41.03  E-value: 5.59e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 7706671   480 LGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRlGATLANGDRSEEAVE 529
Cdd:PRK11189 104 LGIYLTQAGNFDAAYEAFDSVLELDPTyNYAYLNR-GIALYYGGRYELAQD 153
 
Name Accession Description Interval E-value
TPR_1 pfam00515
Tetratricopeptide repeat;
511-541 1.58e-03

Tetratricopeptide repeat;


Pssm-ID: 278916  Cd Length: 34  Bit Score: 37.01  E-value: 1.58e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 7706671    511 WNRLGATLANGDRSEEAVEAYTRALEIQPGF 541
Cdd:pfam00515   4 LYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
TPR_1 pfam00515
Tetratricopeptide repeat;
360-393 5.51e-03

Tetratricopeptide repeat;


Pssm-ID: 278916  Cd Length: 34  Bit Score: 35.09  E-value: 5.51e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 7706671    360 AEAWQFLGITQAENENEQAAIVALQRCLELQPNN 393
Cdd:pfam00515   1 AKALYNLGNAYLKLGKYDEALEYYEKALELNPNN 34
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
331-561 1.22e-11

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 66.26  E-value: 1.22e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    331 EEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 410
Cdd:TIGR02917  27 EAAKSYLQKNKYKAAIIQLKNALQKDPNDAEARFLLGKIYLALGDYAAAEKELRKALSLGYPKNQVLPLLARAYLLQGKF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    411 QDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMskspvdssvLEGVKELYLEAAHQNGDmiDPDLQTGLGVLFHLSGEF 490
Cdd:TIGR02917 107 QQVLDELPGKTLLDDEGAAELLALRGLAYLGLGQ---------LELAQKSYEQALAIDPR--SLYAKLGLAQLALAENRF 175
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7706671    491 NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREA 561
Cdd:TIGR02917 176 DEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEA 246
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
328-548 1.60e-10

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 62.79  E-value: 1.60e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    328 GAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNT 407
Cdd:TIGR02917 263 AHYLKALVDFQKKNYEDARETLQDALKSAPEYLPALLLAGASEYQLGNLEQAYQYLNQILKYAPNSHQARRLLASIQLRL 342
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    408 GHQQDACDALKNWIKQNP-----------KY----------KYLVKSKKGSP---------GLTRRMSKSPVdssvlEGV 457
Cdd:TIGR02917 343 GRVDEAIATLSPALGLDPddpaalsllgeAYlalgdfekaaEYLAKATELDPenaaartqlGISKLSQGDPS-----EAI 417
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    458 KELyLEAAHQNGDMIDPDLqtgLGVLFHL-SGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALE 536
Cdd:TIGR02917 418 ADL-ETAAQLDPELGRADL---LLILSYLrSGQFDKALAAAKKLEKKQPDNASLHNLLGAIYLGKGDLAKAREAFEKALS 493
                         250
                  ....*....|..
gi 7706671    537 IQPGFIRSRYNL 548
Cdd:TIGR02917 494 IEPDFFPAAANL 505
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
266-539 8.20e-10

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533 [Multi-domain]  Cd Length: 291  Bit Score: 59.09  E-value: 8.20e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  266 FERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAQNQVTISASEKGYYFHTENPFKDWpgAFEEGLKRLKEGDLPVT 345
Cdd:COG0457   1 LKDLLLALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAGL--LLLLALALLKLGRLEEA 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  346 ILFMEAAI--LQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALA-VSYTNTGHQQDACDALKNWIK 422
Cdd:COG0457  79 LELLEKALelELLPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLAlGALYELGDYEEALELYEKALE 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  423 QNPKYKYLVKSKKGSPGLTRRMSKspvdssvLEGVKELYLEAAHQNGDmIDPDLQTGLGVLFHLSGEFNRAIDAFNAALT 502
Cdd:COG0457 159 LDPELNELAEALLALGALLEALGR-------YEEALELLEKALKLNPD-DDAEALLNLGLLYLKLGKYEEALEYYEKALE 230
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 7706671  503 VRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP 539
Cdd:COG0457 231 LDPDNAEALYNLALLLLELGRYEEALEALEKALELDP 267
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
337-574 9.13e-10

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 60.48  E-value: 9.13e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    337 LKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAvsytntghqqDACDA 416
Cdd:TIGR02917 578 LGKGQLKKALAILNEAADAAPDSPEAWLMLGRAQLAAGDLNKAVSSFKKLLALQPDSALALLLLA----------DAYAV 647
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    417 LKNWIKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELY--LEAAHQNgdmiDPDLQTGLGVLFHLSGEFNRAI 494
Cdd:TIGR02917 648 MKNYAKAITSLKRALELKPDNTEAQIGLAQLLLAAKRTESAKKIAksLQKQHPK----AALGFELEGDLYLRQKDYPAAI 723
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    495 DAFNAALTVRPEDYSLWNRLGATLANGDRSeEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 574
Cdd:TIGR02917 724 QAYRKALKRAPSSQNAIKLHRALLASGNTA-EAVKTLEAWLKTHPNDAVLRTALAELYLAQKDYDKAIKHYQTVVKKAPD 802
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
333-571 5.30e-09

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 57.79  E-value: 5.30e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    333 GLKRLK--EGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 410
Cdd:TIGR02917 164 GLAQLAlaENRFDEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEF 243
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    411 QDA---CDALKNWIKQNPK---YKYLVKSKKG-----SPGLTRRMSKSP--VDSSVLEGVKELYL---EAAHQNGDMI-- 472
Cdd:TIGR02917 244 EEAekhADALLKKAPNSPLahyLKALVDFQKKnyedaRETLQDALKSAPeyLPALLLAGASEYQLgnlEQAYQYLNQIlk 323
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    473 -DPDLQTG---LGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGAT-LANGDrSEEAVEAYTRALEIQPGFIRSRYN 547
Cdd:TIGR02917 324 yAPNSHQArrlLASIQLRLGRVDEAIATLSPALGLDPDDPAALSLLGEAyLALGD-FEKAAEYLAKATELDPENAAARTQ 402
                         250       260
                  ....*....|....*....|....
gi 7706671    548 LGISCINLGAYREAVSNFLTALSL 571
Cdd:TIGR02917 403 LGISKLSQGDPSEAIADLETAAQL 426
TPR_11 pfam13414
TPR repeat;
473-539 6.11e-09

TPR repeat;


Pssm-ID: 290150 [Multi-domain]  Cd Length: 67  Bit Score: 53.10  E-value: 6.11e-09
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7706671    473 DPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP 539
Cdd:pfam13414   1 NAEALKNLGNALLKKGKYEEAIEAYEKALELDPDAAELYLNLALALLKLGDYEEALEDLEKALELDP 67
TadD COG5010
Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, ...
440-574 1.38e-08

Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, and vesicular transport, Extracellular structures];


Pssm-ID: 227343 [Multi-domain]  Cd Length: 257  Bit Score: 54.75  E-value: 1.38e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  440 LTRRMSKSPVDSSVLEGVKELYLEA-AHQ---------NGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYS 509
Cdd:COG5010  56 LGAAVLRNPEDLSIAKLATALYLRGdADSslavlqksaIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWE 135
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7706671  510 LWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 574
Cdd:COG5010 136 AWNLLGAALDQLGRFDEARRAYRQALELAPNEPSIANNLGMSLLLRGDLEDAETLLLPAYLSPAA 200
TPR_11 pfam13414
TPR repeat;
510-571 7.33e-08

TPR repeat;


Pssm-ID: 290150 [Multi-domain]  Cd Length: 67  Bit Score: 50.02  E-value: 7.33e-08
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7706671    510 LWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSL 571
Cdd:pfam13414   4 ALKNLGNALLKKGKYEEAIEAYEKALELDPDAAELYLNLALALLKLGDYEEALEDLEKALEL 65
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
308-574 2.41e-07

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533 [Multi-domain]  Cd Length: 291  Bit Score: 51.39  E-value: 2.41e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  308 ISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCL 387
Cdd:COG0457   7 ALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAGLLLLLALALLKLGRLEEALELLEKAL 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  388 ELQ--PNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYKYLVKSKKGspGLTRRMSKspvdssvLEGVKELYLEAA 465
Cdd:COG0457  87 ELEllPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLAL--GALYELGD-------YEEALELYEKAL 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  466 HQNGDMID-PDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIR 543
Cdd:COG0457 158 ELDPELNElAEALLALGALLEALGRYEEALELLEKALKLNPDdDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNAE 237
                       250       260       270
                ....*....|....*....|....*....|.
gi 7706671  544 SRYNLGISCINLGAYREAVSNFLTALSLQRK 574
Cdd:COG0457 238 ALYNLALLLLELGRYEEALEALEKALELDPD 268
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
355-539 1.06e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 50.47  E-value: 1.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    355 QDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYkylVKSK 434
Cdd:TIGR02917 460 KQPDNASLHNLLGAIYLGKGDLAKAREAFEKALSIEPDFFPAAANLARIDIQEGNPDDAIQRFEKVLTIDPKN---LRAI 536
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    435 KGSPGLTRRMSKSpvdssvlEGVKELYLEAAHQNGDMIDPDLQtgLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRL 514
Cdd:TIGR02917 537 LALAGLYLRTGNE-------EEAVAWLEKAAELNPQEIEPALA--LAQYYLGKGQLKKALAILNEAADAAPDSPEAWLML 607
                         170       180
                  ....*....|....*....|....*.
gi 7706671    515 GAT-LANGDrSEEAVEAYTRALEIQP 539
Cdd:TIGR02917 608 GRAqLAAGD-LNKAVSSFKKLLALQP 632
YfgC COG4783
Putative Zn-dependent protease, contains TPR repeats [General function prediction only];
426-577 3.36e-06

Putative Zn-dependent protease, contains TPR repeats [General function prediction only];


Pssm-ID: 227122 [Multi-domain]  Cd Length: 484  Bit Score: 48.55  E-value: 3.36e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  426 KYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGdmidPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRP 505
Cdd:COG4783 262 QSPPYNKLDSPDFQLARARIRAKYEALPNQQAADLLAKRSKRGG----LAAQYGRALQTYLAGQYDEALKLLQPLIAAQP 337
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7706671  506 EDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSnfltalSLQRKSRN 577
Cdd:COG4783 338 DNPYYLELAGDILLEANKAKEAIERLKKALALDPNSPLLQLNLAQALLKGGKPQEAIR------ILNRYLFN 403
TPR_12 pfam13424
Tetratricopeptide repeat;
504-574 8.58e-06

Tetratricopeptide repeat;


Pssm-ID: 290160 [Multi-domain]  Cd Length: 79  Bit Score: 44.33  E-value: 8.58e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7706671    504 RPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQ--------PGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 574
Cdd:pfam13424   1 HPDTATALNNLALVLRALGDYDEALELLEKALEIAervlgpdhPLTATALNNLARLYLALGDYEEALELLEKALAIREK 79
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
454-575 1.03e-05

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533 [Multi-domain]  Cd Length: 291  Bit Score: 46.38  E-value: 1.03e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  454 LEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLsGEFNRAIDAFNAALTVRPEDYSL---WNRLGATLANGDRSEEAVEA 530
Cdd:COG0457 111 YEEALELLEKALALDPDPDLAEALLALGALYEL-GDYEEALELYEKALELDPELNELaeaLLALGALLEALGRYEEALEL 189
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*.
gi 7706671  531 YTRALEIQPG-FIRSRYNLGISCINLGAYREAVSNFLTALSLQRKS 575
Cdd:COG0457 190 LEKALKLNPDdDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDN 235
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
355-527 2.51e-05

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 45.84  E-value: 2.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    355 QDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLkALMALAVSYTNTGHQQDACDALKNWIKQNPK-------- 426
Cdd:TIGR02917 698 QHPKAALGFELEGDLYLRQKDYPAAIQAYRKALKRAPSSQ-NAIKLHRALLASGNTAEAVKTLEAWLKTHPNdavlrtal 776
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    427 ---YKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYL-----------EAAHQNGDMIDPDLQTgLGVLFHLSGEFNR 492
Cdd:TIGR02917 777 aelYLAQKDYDKAIKHYQTVVKKAPDNAVVLNNLAWLYLelkdpraleyaERALKLAPNIPAILDT-LGWLLVEKGEADR 855
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 7706671    493 AIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEA 527
Cdd:TIGR02917 856 ALPLLRKAVNIAPEAAAIRYHLALALLATGRKAEA 890
TPR_11 pfam13414
TPR repeat;
359-425 2.51e-05

TPR repeat;


Pssm-ID: 290150 [Multi-domain]  Cd Length: 67  Bit Score: 42.70  E-value: 2.51e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7706671    359 DAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNP 425
Cdd:pfam13414   1 NAEALKNLGNALLKKGKYEEAIEAYEKALELDPDAAELYLNLALALLKLGDYEEALEDLEKALELDP 67
TPR_16 pfam13432
Tetratricopeptide repeat;
488-540 2.67e-05

Tetratricopeptide repeat;


Pssm-ID: 290168 [Multi-domain]  Cd Length: 65  Bit Score: 42.67  E-value: 2.67e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 7706671    488 GEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPG 540
Cdd:pfam13432  11 GDYDDALAALEAALARYPEAAEALLLLAEALLRQGRLAEAAALLRAALALAPG 63
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
480-582 7.37e-05

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273380 [Multi-domain]  Cd Length: 615  Bit Score: 44.20  E-value: 7.37e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    480 LGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRsEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYR 559
Cdd:TIGR00990 133 KGNKAYRNKDFNKAIKLYSKAIECKPDPVYYSNRAACHNALGDW-EKVVEDTTAALELDPDYSKALNRRANAYDGLGKYA 211
                          90       100
                  ....*....|....*....|...
gi 7706671    560 EAVSNFlTALSLQRKSRNQQQVP 582
Cdd:TIGR00990 212 DALLDL-TASCIIDGFRNEQSAQ 233
NrfG COG4235
Cytochrome c-type biogenesis protein CcmH/NrfG [Energy production and conversion, ...
346-425 9.69e-05

Cytochrome c-type biogenesis protein CcmH/NrfG [Energy production and conversion, Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 226687 [Multi-domain]  Cd Length: 287  Bit Score: 43.13  E-value: 9.69e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  346 ILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQD---ACDALKNWIK 422
Cdd:COG4235 142 IARLETHLQQNPGDAEGWDLLGRAYMALGRASDALLAYRNALRLAGDNPEILLGLAEALYYQAGQQMtakARALLRQALA 221

                ...
gi 7706671  423 QNP 425
Cdd:COG4235 222 LDP 224
TPR_11 pfam13414
TPR repeat;
329-391 2.29e-04

TPR repeat;


Pssm-ID: 290150 [Multi-domain]  Cd Length: 67  Bit Score: 39.62  E-value: 2.29e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7706671    329 AFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQP 391
Cdd:pfam13414   5 LKNLGNALLKKGKYEEAIEAYEKALELDPDAAELYLNLALALLKLGDYEEALEDLEKALELDP 67
TadD COG5010
Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, ...
349-413 2.53e-04

Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, and vesicular transport, Extracellular structures];


Pssm-ID: 227343 [Multi-domain]  Cd Length: 257  Bit Score: 41.65  E-value: 2.53e-04
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7706671  349 MEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDA 413
Cdd:COG5010  89 LQKSAIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLGRFDEA 153
LcrH_SycD TIGR02552
type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in ...
484-587 3.73e-04

type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in type III secretion operons. LcrH, from Yersinia is believed to have a regulatory function in the low-calcium response of the secretion system. The same protein is also known as SycD (SYC = Specific Yop Chaperone) for its chaperone role. In Pseudomonas, where the homolog is known as PcrH, the chaperone role has been demonstrated and the regulatory role appears to be absent. ScyD/LcrH contains three central tetratricopeptide-like repeats that are predicted to fold into an all-alpha-helical array.


Pssm-ID: 274197 [Multi-domain]  Cd Length: 135  Bit Score: 39.58  E-value: 3.73e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    484 FHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVS 563
Cdd:TIGR02552  27 LYQQGRYDEALKLFQLLAAYDPYNSRYWLGLAACCQMLKEYEEAIDAYALAAALDPDDPRPYFHAAECLLALGEPESALK 106
                          90       100
                  ....*....|....*....|....
gi 7706671    564 NFLTALSLQRKSRNQQQVPHPAIS 587
Cdd:TIGR02552 107 ALDLAIEICGENPEYSELKERAEA 130
PRK11189 PRK11189
lipoprotein NlpI; Provisional
480-529 5.59e-04

lipoprotein NlpI; Provisional


Pssm-ID: 236875 [Multi-domain]  Cd Length: 296  Bit Score: 41.03  E-value: 5.59e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 7706671   480 LGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRlGATLANGDRSEEAVE 529
Cdd:PRK11189 104 LGIYLTQAGNFDAAYEAFDSVLELDPTyNYAYLNR-GIALYYGGRYELAQD 153
type_IV_pilW TIGR02521
type IV pilus biogenesis/stability protein PilW; Members of this family are designated PilF ...
476-626 7.89e-04

type IV pilus biogenesis/stability protein PilW; Members of this family are designated PilF and PilW. This outer membrane protein is required both for pilus stability and for pilus function such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain.


Pssm-ID: 131573 [Multi-domain]  Cd Length: 234  Bit Score: 40.01  E-value: 7.89e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    476 LQTGLGVLfhLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINL 555
Cdd:TIGR02521  35 VQLALGYL--EQGDLEVAKENLDKALEHDPDDYLAYLALALYYQQLGELEKAEDSFRRALTLNPNNGDVLNNYGTFLCQQ 112
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7706671    556 GAYREAVSNFLTALSlqrksrnQQQVPHPAISgniwaALRIALSLMDQPELFQAANLgdldvLLRAFNLDP 626
Cdd:TIGR02521 113 GKYEQAMQQFEQAIE-------DPLYPQPARS-----LENAGLCALKAGDFDKAEKY-----LTRALQIDP 166
TPR_16 pfam13432
Tetratricopeptide repeat;
330-393 2.92e-03

Tetratricopeptide repeat;


Pssm-ID: 290168 [Multi-domain]  Cd Length: 65  Bit Score: 36.51  E-value: 2.92e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7706671    330 FEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNN 393
Cdd:pfam13432   1 LALARALLRAGDYDDALAALEAALARYPEAAEALLLLAEALLRQGRLAEAAALLRAALALAPGD 64
TPR_12 pfam13424
Tetratricopeptide repeat;
476-539 3.02e-03

Tetratricopeptide repeat;


Pssm-ID: 290160 [Multi-domain]  Cd Length: 79  Bit Score: 36.24  E-value: 3.02e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7706671    476 LQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDY--------SLWNRLGATLANGDRSEEAVEAYTRALEIQP 539
Cdd:pfam13424   7 ALNNLALVLRALGDYDEALELLEKALEIAERVLgpdhpltaTALNNLARLYLALGDYEEALELLEKALAIRE 78
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
347-430 5.82e-03

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533 [Multi-domain]  Cd Length: 291  Bit Score: 37.90  E-value: 5.82e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671  347 LFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPK 426
Cdd:COG0457 189 LLEKALKLNPDDDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNAEALYNLALLLLELGRYEEALEALEKALELDPD 268

                ....
gi 7706671  427 YKYL 430
Cdd:COG0457 269 LYNL 272
LcrH_SycD TIGR02552
type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in ...
356-432 7.50e-03

type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in type III secretion operons. LcrH, from Yersinia is believed to have a regulatory function in the low-calcium response of the secretion system. The same protein is also known as SycD (SYC = Specific Yop Chaperone) for its chaperone role. In Pseudomonas, where the homolog is known as PcrH, the chaperone role has been demonstrated and the regulatory role appears to be absent. ScyD/LcrH contains three central tetratricopeptide-like repeats that are predicted to fold into an all-alpha-helical array.


Pssm-ID: 274197 [Multi-domain]  Cd Length: 135  Bit Score: 35.73  E-value: 7.50e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7706671    356 DPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALK---NWIKQNPKYKYLVK 432
Cdd:TIGR02552  47 DPYNSRYWLGLAACCQMLKEYEEAIDAYALAAALDPDDPRPYFHAAECLLALGEPESALKALDlaiEICGENPEYSELKE 126
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH