NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|115387120|ref|NP_057583.2|]
View 

transmembrane protein 216 isoform 1 [Homo sapiens]

Protein Classification

Transmemb_17 domain-containing protein (domain architecture ID 10561172)

Transmemb_17 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Transmemb_17 pfam09799
Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved ...
1-67 4.43e-15

Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved from nematodes to humans. It is predicted to be a transmembrane region but its function is not known.


:

Pssm-ID: 313090  Cd Length: 104  Bit Score: 66.04  E-value: 4.43e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 115387120    1 MLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFC 67
Cdd:pfam09799  38 LLVLLLILEVIRLYLGYKGNLTEKVPPLAAFLLLTIPSQLPLVYFLLWQTYVLRLEYILNIILLALL 104
 
Name Accession Description Interval E-value
Transmemb_17 pfam09799
Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved ...
1-67 4.43e-15

Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved from nematodes to humans. It is predicted to be a transmembrane region but its function is not known.


Pssm-ID: 313090  Cd Length: 104  Bit Score: 66.04  E-value: 4.43e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 115387120    1 MLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFC 67
Cdd:pfam09799  38 LLVLLLILEVIRLYLGYKGNLTEKVPPLAAFLLLTIPSQLPLVYFLLWQTYVLRLEYILNIILLALL 104
 
Name Accession Description Interval E-value
Transmemb_17 pfam09799
Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved ...
1-67 4.43e-15

Predicted membrane protein; This is a 100 amino acid region of a family of proteins conserved from nematodes to humans. It is predicted to be a transmembrane region but its function is not known.


Pssm-ID: 313090  Cd Length: 104  Bit Score: 66.04  E-value: 4.43e-15
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 115387120    1 MLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFC 67
Cdd:pfam09799  38 LLVLLLILEVIRLYLGYKGNLTEKVPPLAAFLLLTIPSQLPLVYFLLWQTYVLRLEYILNIILLALL 104
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH