NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|48762685|ref|NP_055197|]
View 

calcium-transporting ATPase type 2C member 1 isoform 1a [Homo sapiens]

Protein Classification

P-type_ATPase_SPCA domain-containing protein (domain architecture ID 11550604)

P-type_ATPase_SPCA domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
54-896 0e+00

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


:

Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 1582.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  54 RRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSK 133
Cdd:cd02085   1 RRKLHGPNEFKVEDEEPLWKKYLEQFKNPLILLLLGSAVVSVVMKQYDDAVSITVAILIVVTVAFVQEYRSEKSLEALNK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 134 LVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASR 213
Cdd:cd02085  81 LVPPECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSKTTEVIPKASNGDLTTR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 214 SNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILE 293
Cdd:cd02085 161 SNIAFMGTLVRCGHGKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDKLGKQLSLYSFIIIGVIMLIGWLQGKNLLE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 294 MFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglha 373
Cdd:cd02085 241 MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT------ 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 374 evtgvgynqfgevivdgdvvhgfynpavsriveaGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYP 453
Cdd:cd02085 315 ----------------------------------GCVCNNAVIRNNTLMGQPTEGALIALAMKMGLSDIRETYIRKQEIP 360
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 454 FSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQT-LTLTQQQRDVYQQEKARMGSAGLRVLALASGPE 532
Cdd:cd02085 361 FSSEQKWMAVKCIPKYNSDNEEIYFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEINEEEKEMGSKGLRVLALASGPE 440
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 533 LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVP 612
Cdd:cd02085 441 LGDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITGDAQETAIAIGSSLGLYSPSLQALSGEEVDQMSDSQLASVVR 520
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 613 KVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEG 692
Cdd:cd02085 521 KVTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEG 600
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 693 KGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILT 772
Cdd:cd02085 601 KGIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILT 680
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 773 KNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSI 852
Cdd:cd02085 681 RSLILNVLLSAAIIVSGTLWVFWKEMSDDNVTPRDTTMTFTCFVFFDMFNALSCRSQTKSIFEIGFFSNRMFLYAVGGSL 760
                       810       820       830       840
                ....*....|....*....|....*....|....*....|....
gi 48762685 853 MGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 896
Cdd:cd02085 761 IGQLLVIYFPPLQRVFQTEALGLLDLLFLLGLTSSVFIVSELRK 804
 
Name Accession Description Interval E-value
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
54-896 0e+00

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 1582.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  54 RRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSK 133
Cdd:cd02085   1 RRKLHGPNEFKVEDEEPLWKKYLEQFKNPLILLLLGSAVVSVVMKQYDDAVSITVAILIVVTVAFVQEYRSEKSLEALNK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 134 LVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASR 213
Cdd:cd02085  81 LVPPECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSKTTEVIPKASNGDLTTR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 214 SNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILE 293
Cdd:cd02085 161 SNIAFMGTLVRCGHGKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDKLGKQLSLYSFIIIGVIMLIGWLQGKNLLE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 294 MFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglha 373
Cdd:cd02085 241 MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT------ 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 374 evtgvgynqfgevivdgdvvhgfynpavsriveaGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYP 453
Cdd:cd02085 315 ----------------------------------GCVCNNAVIRNNTLMGQPTEGALIALAMKMGLSDIRETYIRKQEIP 360
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 454 FSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQT-LTLTQQQRDVYQQEKARMGSAGLRVLALASGPE 532
Cdd:cd02085 361 FSSEQKWMAVKCIPKYNSDNEEIYFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEINEEEKEMGSKGLRVLALASGPE 440
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 533 LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVP 612
Cdd:cd02085 441 LGDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITGDAQETAIAIGSSLGLYSPSLQALSGEEVDQMSDSQLASVVR 520
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 613 KVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEG 692
Cdd:cd02085 521 KVTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEG 600
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 693 KGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILT 772
Cdd:cd02085 601 KGIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILT 680
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 773 KNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSI 852
Cdd:cd02085 681 RSLILNVLLSAAIIVSGTLWVFWKEMSDDNVTPRDTTMTFTCFVFFDMFNALSCRSQTKSIFEIGFFSNRMFLYAVGGSL 760
                       810       820       830       840
                ....*....|....*....|....*....|....*....|....
gi 48762685 853 MGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 896
Cdd:cd02085 761 IGQLLVIYFPPLQRVFQTEALGLLDLLFLLGLTSSVFIVSELRK 804
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
23-903 0e+00

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 1580.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    23 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNEFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 100
Cdd:TIGR01522   1 SKQYCELSVEETCSKLQTDLQNGLNsSQEASHRRAFHGWNEFDVEEDESLWKKFLSQFvKNPLILLLIASAVISVFMGNI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   101 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 180
Cdd:TIGR01522  81 DDAVSITLAILIVVTVGFVQEYRSEKSLEALNKLVPPECHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   181 LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQK 260
Cdd:TIGR01522 161 LSIDESNLTGETTPVSKVTAPIPAATNGDLAERSNIAFMGTLVRCGHGKGIVVGTGSNTEFGAVFKMMQAIEKPKTPLQK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   261 SMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 340
Cdd:TIGR01522 241 SMDLLGKQLSLVSFGVIGVICLVGWFQGKDWLEMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVET 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   341 LGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNN- 419
Cdd:TIGR01522 321 LGSVNVICSDKTGTLTKNHMTVTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLCNNAKFRNEa 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   420 -TLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRtqQDRPEICFMKGAYEQVIKYCTTYQSK-G 497
Cdd:TIGR01522 401 dTLLGNPTDVALIELLMKFGLDDLRETYIRVAEVPFSSERKWMAVKCVHR--QDRSEMCFMKGAYEQVLKYCTYYQKKdG 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   498 QTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 577
Cdd:TIGR01522 479 KTLTLTQQQRDVIQEEAAEMASAGLRVIAFASGPEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETA 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   578 VAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 657
Cdd:TIGR01522 559 VSIARRLGMPSKTSQSVSGEKLDAMDDQQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADI 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   658 GVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWI 737
Cdd:TIGR01522 639 GVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKGIFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWI 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   738 NIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVF 817
Cdd:TIGR01522 719 NILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKDLIKKILVSAIIIVVGTLFVFVREMQDGVITARDTTMTFTCFVF 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   818 FDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKK 897
Cdd:TIGR01522 799 FDMFNALACRSQTKSVFEIGFFSNRMFNYAVGGSIIGQLLVIYFPPLQSVFQTEALSIKDLLFLLLITSSVCIVDEIRKK 878

                  ....*.
gi 48762685   898 VERSRE 903
Cdd:TIGR01522 879 VERSRE 884
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
14-870 0e+00

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 805.79  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  14 NETMIPVLTSKKASELPVS--EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASA 91
Cdd:COG0474  11 NKSSSTPVTSETWHPLSVErnELLLELFTSPTTGLSEEEVKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAA 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  92 VISVLMHQF----DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGD 167
Cdd:COG0474  91 LLSAFVGDWvdagVDAIVILLVVVINALLGFVQEYRAEKALEALKKMSSPKAKVLRDGKFVEIPASELVPGDIVLLEAGD 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 168 RVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKM 247
Cdd:COG0474 171 VVPADLRLLESSDLEVDESALTGESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRAKGIVVATGFETEFGKIARL 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 248 MQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV 326
Cdd:COG0474 251 LPTKKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGLFRGGnGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMA 330
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 327 KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHaevtgvgynqfgevivDGDVVHGFYNPAVSRIVE 406
Cdd:COG0474 331 KDNAIVRSLNAIETLGSVDVICSDKTGTLTQNKMTVKKIYINGGGK----------------DIDDKDLKDSPALLRFLL 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 407 AGCVCNDAVI--RNNTLMGKPTEGALIALAMKMG----LDGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPeICFMK 480
Cdd:COG0474 395 AAALCNSVTPekNGWYQAGDPTEGALVEFAEKLGfsldLSGLEVEYPILAEIPFDSERKRMSV--IVKTDEGKY-ILFVK 471
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 481 GAYEQVIKYCTTYqskGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP------------ELGQLTFLGLVGIIDPP 548
Cdd:COG0474 472 GAPEVILERCKSI---GELEPLTEEGLRTLEEAVKELASEGLRVLAVAYKKldraekddevdeIESDLVFLGLTGIEDPP 548
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 549 RTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQS--VSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM 626
Cdd:COG0474 549 REDVKEAIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESAlvIDGAELDALSDEELAELVEELSVFARVSPEQKA 628
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 627 KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQ 706
Cdd:COG0474 629 RIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYL 708
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 707 LSTSIAALTLISLATLMNFPN-PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILK-ILVSSI 784
Cdd:COG0474 709 LSKNVGEVLTLLIYSLFNLFFlPLTPLQLLWINLLTDSLPALALGVEDPESDVMKRPPRGPEEGLFNRKIFWRfILIIGL 788
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 785 IIVCGTLFVF--------WRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQL 856
Cdd:COG0474 789 LSAILFILTFllyllgfiANTLGLDLFQALLQTTAFTVLVLIQLLLTLAVRSRGRPFLSSLLFSNKYLWLALLVIIILQL 868
                       890
                ....*....|....*
gi 48762685 857 LVIYFPPLQ-KVFQT 870
Cdd:COG0474 869 LIIFLPPLNlKIFQP 883
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
18-794 1.79e-104

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 345.13  E-value: 1.79e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   18 IPVLTSKKASELPVSEVASILQA--DLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV 95
Cdd:PRK10517  38 VPPSLSARCLKAAVMPEEELWKTfdTHPEGLNEAEVESAREQHGENELPAQKPLPWWVHLWVCYRNPFNILLTILGAISY 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   96 LMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR--EGKLEHTLA----RDLVPGDTVCLSVGDRV 169
Cdd:PRK10517 118 ATEDLFAAGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRviNDKGENGWLeipiDQLVPGDIIKLAAGDMI 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  170 PADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ 249
Cdd:PRK10517 198 PADLRILQARDLFVAQASLTGESLPVEKFATTRQPEHSNPL-ECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLAGRVS 276
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  250 AEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV-GWLLGkDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 328
Cdd:PRK10517 277 EQDSEPNAFQQGISRVSWLLIRFMLVMAPVVLLInGYTKG-DWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQ 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  329 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEmtvthIFTSDglHAEVtgvgynqFGEviVDGDVVH-----GFYNPAVSR 403
Cdd:PRK10517 356 KVIVKRLDAIQNFGAMDILCTDKTGTLTQDK-----IVLEN--HTDI-------SGK--TSERVLHsawlnSHYQTGLKN 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  404 IVEAgcvcndAVIrnntlmgkptEGALIALAMKMGldglqQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPE-ICfmKGA 482
Cdd:PRK10517 420 LLDT------AVL----------EGVDEESARSLA-----SRWQKIDEIPFDFERRRMSV--VVAENTEHHQlIC--KGA 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  483 YEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQLTFLGLVGIIDPPRTG 551
Cdd:PRK10517 475 LEEILNVCSQVRHNGEIVPLDDIMLRRIKRVTDTLNRQGLRVVAVATKYlparegdyqraDESDLILEGYIAFLDPPKET 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  552 VKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKS 631
Cdd:PRK10517 555 TAPALKALKASGVTVKILTGDSELVAAKVCHEVGL--DAGEVLIGSDIETLSDDELANLAERTTLFARLTPMHKERIVTL 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  632 LQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSI 711
Cdd:PRK10517 633 LKREGHVVGFMGDGINDAPALRAADIGISV-DGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNF 711
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  712 AAL--TLISLATLmnfPN-PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKPPRnWKDSILTKNLILKILVSSII-I 786
Cdd:PRK10517 712 GNVfsVLVASAFL---PFlPMLPLHLLIQNLLYD--VSQvAIPFDNVDDEQIQKPQR-WNPADLGRFMVFFGPISSIFdI 785
                        810
                 ....*....|
gi 48762685  787 VCGTL--FVF 794
Cdd:PRK10517 786 LTFCLmwWVF 795
E1-E2_ATPase pfam00122
E1-E2 ATPase;
136-328 1.50e-48

E1-E2 ATPase;


Pssm-ID: 333857 [Multi-domain]  Cd Length: 178  Bit Score: 170.05  E-value: 1.50e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   136 PPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSN 215
Cdd:pfam00122   1 PPTATVLRDGTEEEIPADELVPGDIVLLKPGERVPADGRIVEGSA-SVDESALTGESLPVEK--------------EKGD 65
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   216 IAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMF 295
Cdd:pfam00122  66 MVFSGTVVVSGSAKAVVTATGEDTELGKIARLVEEAKSKKTPLQRLLDKLAKYFTPVVLLLALAVFLLWLFVGGPPLEAL 145
                         170       180       190
                  ....*....|....*....|....*....|...
gi 48762685   296 TISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 328
Cdd:pfam00122 146 LRALALLVAACPCALPLATPLALALGARRLAKK 178
Cation_ATPase_N smart00831
Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region ...
29-97 2.21e-17

Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases.


Pssm-ID: 214842 [Multi-domain]  Cd Length: 75  Bit Score: 77.24  E-value: 2.21e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 48762685     29 LPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLM 97
Cdd:smart00831   7 LSLEEVLERLQTDLEKGLSSEEAARRLERYGPNELPPPKKTSPLLRFLRQFHNPLIYILLAAAVLSALL 75
 
Name Accession Description Interval E-value
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
54-896 0e+00

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 1582.41  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  54 RRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSK 133
Cdd:cd02085   1 RRKLHGPNEFKVEDEEPLWKKYLEQFKNPLILLLLGSAVVSVVMKQYDDAVSITVAILIVVTVAFVQEYRSEKSLEALNK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 134 LVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASR 213
Cdd:cd02085  81 LVPPECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSKTTEVIPKASNGDLTTR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 214 SNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILE 293
Cdd:cd02085 161 SNIAFMGTLVRCGHGKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDKLGKQLSLYSFIIIGVIMLIGWLQGKNLLE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 294 MFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglha 373
Cdd:cd02085 241 MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT------ 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 374 evtgvgynqfgevivdgdvvhgfynpavsriveaGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYP 453
Cdd:cd02085 315 ----------------------------------GCVCNNAVIRNNTLMGQPTEGALIALAMKMGLSDIRETYIRKQEIP 360
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 454 FSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQT-LTLTQQQRDVYQQEKARMGSAGLRVLALASGPE 532
Cdd:cd02085 361 FSSEQKWMAVKCIPKYNSDNEEIYFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEINEEEKEMGSKGLRVLALASGPE 440
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 533 LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVP 612
Cdd:cd02085 441 LGDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITGDAQETAIAIGSSLGLYSPSLQALSGEEVDQMSDSQLASVVR 520
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 613 KVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEG 692
Cdd:cd02085 521 KVTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEG 600
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 693 KGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILT 772
Cdd:cd02085 601 KGIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILT 680
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 773 KNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSI 852
Cdd:cd02085 681 RSLILNVLLSAAIIVSGTLWVFWKEMSDDNVTPRDTTMTFTCFVFFDMFNALSCRSQTKSIFEIGFFSNRMFLYAVGGSL 760
                       810       820       830       840
                ....*....|....*....|....*....|....*....|....
gi 48762685 853 MGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 896
Cdd:cd02085 761 IGQLLVIYFPPLQRVFQTEALGLLDLLFLLGLTSSVFIVSELRK 804
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
23-903 0e+00

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 1580.62  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    23 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNEFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 100
Cdd:TIGR01522   1 SKQYCELSVEETCSKLQTDLQNGLNsSQEASHRRAFHGWNEFDVEEDESLWKKFLSQFvKNPLILLLIASAVISVFMGNI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   101 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 180
Cdd:TIGR01522  81 DDAVSITLAILIVVTVGFVQEYRSEKSLEALNKLVPPECHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   181 LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQK 260
Cdd:TIGR01522 161 LSIDESNLTGETTPVSKVTAPIPAATNGDLAERSNIAFMGTLVRCGHGKGIVVGTGSNTEFGAVFKMMQAIEKPKTPLQK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   261 SMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 340
Cdd:TIGR01522 241 SMDLLGKQLSLVSFGVIGVICLVGWFQGKDWLEMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVET 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   341 LGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNN- 419
Cdd:TIGR01522 321 LGSVNVICSDKTGTLTKNHMTVTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLCNNAKFRNEa 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   420 -TLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRtqQDRPEICFMKGAYEQVIKYCTTYQSK-G 497
Cdd:TIGR01522 401 dTLLGNPTDVALIELLMKFGLDDLRETYIRVAEVPFSSERKWMAVKCVHR--QDRSEMCFMKGAYEQVLKYCTYYQKKdG 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   498 QTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 577
Cdd:TIGR01522 479 KTLTLTQQQRDVIQEEAAEMASAGLRVIAFASGPEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETA 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   578 VAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 657
Cdd:TIGR01522 559 VSIARRLGMPSKTSQSVSGEKLDAMDDQQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADI 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   658 GVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWI 737
Cdd:TIGR01522 639 GVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKGIFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWI 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   738 NIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVF 817
Cdd:TIGR01522 719 NILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKDLIKKILVSAIIIVVGTLFVFVREMQDGVITARDTTMTFTCFVF 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   818 FDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKK 897
Cdd:TIGR01522 799 FDMFNALACRSQTKSVFEIGFFSNRMFNYAVGGSIIGQLLVIYFPPLQSVFQTEALSIKDLLFLLLITSSVCIVDEIRKK 878

                  ....*.
gi 48762685   898 VERSRE 903
Cdd:TIGR01522 879 VERSRE 884
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
14-870 0e+00

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 805.79  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  14 NETMIPVLTSKKASELPVS--EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASA 91
Cdd:COG0474  11 NKSSSTPVTSETWHPLSVErnELLLELFTSPTTGLSEEEVKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAA 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  92 VISVLMHQF----DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGD 167
Cdd:COG0474  91 LLSAFVGDWvdagVDAIVILLVVVINALLGFVQEYRAEKALEALKKMSSPKAKVLRDGKFVEIPASELVPGDIVLLEAGD 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 168 RVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKM 247
Cdd:COG0474 171 VVPADLRLLESSDLEVDESALTGESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRAKGIVVATGFETEFGKIARL 250
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 248 MQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV 326
Cdd:COG0474 251 LPTKKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGLFRGGnGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMA 330
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 327 KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHaevtgvgynqfgevivDGDVVHGFYNPAVSRIVE 406
Cdd:COG0474 331 KDNAIVRSLNAIETLGSVDVICSDKTGTLTQNKMTVKKIYINGGGK----------------DIDDKDLKDSPALLRFLL 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 407 AGCVCNDAVI--RNNTLMGKPTEGALIALAMKMG----LDGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPeICFMK 480
Cdd:COG0474 395 AAALCNSVTPekNGWYQAGDPTEGALVEFAEKLGfsldLSGLEVEYPILAEIPFDSERKRMSV--IVKTDEGKY-ILFVK 471
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 481 GAYEQVIKYCTTYqskGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP------------ELGQLTFLGLVGIIDPP 548
Cdd:COG0474 472 GAPEVILERCKSI---GELEPLTEEGLRTLEEAVKELASEGLRVLAVAYKKldraekddevdeIESDLVFLGLTGIEDPP 548
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 549 RTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQS--VSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM 626
Cdd:COG0474 549 REDVKEAIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESAlvIDGAELDALSDEELAELVEELSVFARVSPEQKA 628
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 627 KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQ 706
Cdd:COG0474 629 RIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYL 708
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 707 LSTSIAALTLISLATLMNFPN-PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILK-ILVSSI 784
Cdd:COG0474 709 LSKNVGEVLTLLIYSLFNLFFlPLTPLQLLWINLLTDSLPALALGVEDPESDVMKRPPRGPEEGLFNRKIFWRfILIIGL 788
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 785 IIVCGTLFVF--------WRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQL 856
Cdd:COG0474 789 LSAILFILTFllyllgfiANTLGLDLFQALLQTTAFTVLVLIQLLLTLAVRSRGRPFLSSLLFSNKYLWLALLVIIILQL 868
                       890
                ....*....|....*
gi 48762685 857 LVIYFPPLQ-KVFQT 870
Cdd:COG0474 869 LIIFLPPLNlKIFQP 883
P-type_ATPase_cation cd02080
P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, ...
45-896 0e+00

P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase; This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319775 [Multi-domain]  Cd Length: 819  Bit Score: 771.82  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 124
Cdd:cd02080   1 GLTSEEAAERLERYGPNRLPEKKTKSPLLRFLRQFNNPLIYILLAAAVVTAFLGHWVDAIVIFGVVLINAIIGYIQEGKA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 125 EKSLEELSKLVPPECHCVREGKlEHTL-ARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQP 203
Cdd:cd02080  81 EKALAAIKNMLSPEATVLRDGK-KLTIdAEELVPGDIVLLEAGDKVPADLRLIEARNLQIDESALTGESVPVEKQEGPLE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 204 AATNgdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV 283
Cdd:cd02080 160 EDTP--LGDRKNMAYSGTLVTAGSATGVVVATGADTEIGRINQLLAEVEQLATPLTRQIAKFSKALLIVILVLAALTFVF 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 284 GWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTV 362
Cdd:cd02080 238 GLLRGDySLVELFMAVVALAVAAIPEGLPAVITITLAIGVQRMAKRNAIIRRLPAVETLGSVTVICSDKTGTLTRNEMTV 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 363 THIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcVCNDAVIRNN----TLMGKPTEGALIALAMKMG 438
Cdd:cd02080 318 QAIVT------------------------------------------LCNDAQLHQEdghwKITGDPTEGALLVLAAKAG 355
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 439 LD--GLQQDYIRKAEYPFSSEQKWMAVkcvhRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLtqqQRDVYQQEKAR 516
Cdd:cd02080 356 LDpdRLASSYPRVDKIPFDSAYRYMAT----LHRDDGQRVIYVKGAPERLLDMCDQELLDGGVSPL---DRAYWEAEAED 428
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 517 MGSAGLRVLALASGPE------------LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRL 584
Cdd:cd02080 429 LAKQGLRVLAFAYREVdseveeidhadlEGGLTFLGLQGMIDPPRPEAIAAVAECQSAGIRVKMITGDHAETARAIGAQL 508
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 585 GLySKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQT 664
Cdd:cd02080 509 GL-GDGKKVLTGAELDALDDEELAEAVDEVDVFARTSPEHKLRLVRALQARGEVVAMTGDGVNDAPALKQADIGIAMGIK 587
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 665 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGP 744
Cdd:cd02080 588 GTEVAKEAADMVLADDNFATIAAAVEEGRRVYDNLKKFILFTLPTNLGEGLVIIVAILFGVTLPLTPVQILWINMVTAIT 667
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 745 PAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNAL 824
Cdd:cd02080 668 LGLALAFEPAEPGIMKRPPRDPSEPLLSRELIWRILLVSLLMLGGAFGLFLWALDRGYSLETARTMAVNTIVVAQIFYLF 747
                       810       820       830       840       850       860       870
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 48762685 825 SSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 896
Cdd:cd02080 748 NCRSLHRSILKLGVFSNKILFLGIGALILLQLAFTYLPFMNSLFGTAPIDLVDWAIILLVGIVVFIVVELEK 819
P-type_ATPase_Ca_prok cd02089
prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL ...
45-764 0e+00

prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL and Listeria monocytogenes LMCA1; Ca(2+) transport ATPase is a plasma membrane protein which pumps Ca(2+) ion out of the cytoplasm. This prokaryotic subfamily includes the Ca(2+)-ATPase Synechococcus elongatus PacL, Listeria monocytogenes Ca(2+)-ATPase 1 (LMCA1) which has a low Ca(2+) affinity and a high pH optimum (pH about 9) and may remove Ca(2+) from the microorganism in environmental conditions when e.g. stressed by high Ca(2+) and alkaline pH, and the Bacillus subtilis putative P-type Ca(2+)-transport ATPase encoded by the yloB gene, which is expressed during sporulation. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319781 [Multi-domain]  Cd Length: 674  Bit Score: 753.29  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSItVAILIVVTV-AFVQEYR 123
Cdd:cd02089   1 GLSEEEAERRLAKYGPNELVEKKKRSPWKKFLEQFKDFMVIVLLAAAVISGVLGEYVDAIVI-IAIVILNAVlGFVQEYK 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 124 SEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQP 203
Cdd:cd02089  80 AEKALAALKKMSAPTAKVLRDGKKQEIPARELVPGDIVLLEAGDYVPADGRLIESASLRVEESSLTGESEPVEKDADTLL 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 204 AATNGdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV 283
Cdd:cd02089 160 EEDVP-LGDRKNMVFSGTLVTYGRGRAVVTATGMNTEMGKIATLLEETEEEKTPLQKRLDQLGKRLAIAALIICALVFAL 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 284 GWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVT 363
Cdd:cd02089 239 GLLRGEDLLDMLLTAVSLAVAAIPEGLPAIVTIVLALGVQRMAKRNAIIRKLPAVETLGSVSVICSDKTGTLTQNKMTVE 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 364 HIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnntlMGKPTEGALIALAMKMGLD--G 441
Cdd:cd02089 319 KIYT------------------------------------------------------IGDPTETALIRAARKAGLDkeE 344
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 442 LQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRpeICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAG 521
Cdd:cd02089 345 LEKKYPRIAEIPFDSERKLMTT--VHKDAGKY--IVFTKGAPDVLLPRCTYIYINGQVRPLTEEDRAKILAVNEEFSEEA 420
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 522 LRVLALA----------SGPEL-GQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKT 590
Cdd:cd02089 421 LRVLAVAykpldedpteSSEDLeNDLIFLGLVGMIDPPRPEVKDAVAECKKAGIKTVMITGDHKLTARAIAKELGILEDG 500
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 591 SQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCK 670
Cdd:cd02089 501 DKALTGEELDKMSDEELEKKVEQISVYARVSPEHKLRIVKALQRKGKIVAMTGDGVNDAPALKAADIGVAMGITGTDVAK 580
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 671 EAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLG 750
Cdd:cd02089 581 EAADMILTDDNFATIVAAVEEGRTIYDNIRKFIRYLLSGNVGEILTMLLAPLLGWPVPLLPIQLLWINLLTDGLPALALG 660
                       730
                ....*....|....
gi 48762685 751 VEPVDKDVIRKPPR 764
Cdd:cd02089 661 VEPAEPDIMDRKPR 674
P-type_ATPase_SERCA cd02083
sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; ...
29-870 0e+00

sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; SERCA is a transmembrane (Ca2+)-ATPase and a major regulator of Ca(2+) homeostasis and contractility in cardiac and skeletal muscle. It re-sequesters cytoplasmic Ca(2+) to the sarco/endoplasmic reticulum store, thereby also terminating Ca(2+)-induced signaling such as in muscle contraction. Three genes (ATP2A1-3/SERCA1-3) encode SERCA pumps in mammals, further isoforms exist due to alternative splicing of transcripts. The activity of SERCA is regulated by two small membrane proteins called phospholamban and sarcolipin. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319778 [Multi-domain]  Cd Length: 979  Bit Score: 677.09  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  29 LPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSIT- 107
Cdd:cd02083   3 KTVEEVLAYFGVDPTRGLSDEQVKRRREKYGPNELPAEEGKSLWELVLEQFDDLLVRILLLAAIISFVLALFEEGEEGVt 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 108 ------VAILIVV---TVAFVQEYRSEKSLEELSKLVPPECHCVREGK-LEHTLARDLVPGDTVCLSVGDRVPADLRL-- 175
Cdd:cd02083  83 afvepfVILLILIanaVVGVWQERNAEKAIEALKEYEPEMAKVLRNGKgVQRIRARELVPGDIVEVAVGDKVPADIRIie 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 176 FEAVDLSIDESSLTGETTPCSKVTA--PQPAATNGDlasRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEA 253
Cdd:cd02083 163 IKSTTLRVDQSILTGESVSVIKHTDvvPDPRAVNQD---KKNMLFSGTNVAAGKARGVVVGTGLNTEIGKIRDEMAETEE 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 254 PKTPLQKSMDLLGKQLSFYSFGIIGIIMLV------------GWLLGKdiLEMFTISVSLAVAAIPEGLPIVVTVTLALG 321
Cdd:cd02083 240 EKTPLQQKLDEFGEQLSKVISVICVAVWAInighfndpahggSWIKGA--IYYFKIAVALAVAAIPEGLPAVITTCLALG 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 322 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHA-------EVTGVGYNQFGEVIVDGDVVH 394
Cdd:cd02083 318 TRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFILDKVEDdsslnefEVTGSTYAPEGEVFKNGKKVK 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 395 GFYNPAVSRIVEAGCVCNDAVIRNN------TLMGKPTEGALIALAMKMGLDG------------------LQQDYIRKA 450
Cdd:cd02083 398 AGQYDGLVELATICALCNDSSLDYNeskgvyEKVGEATETALTVLVEKMNVFNtdksglskreranacndvIEQLWKKEF 477
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 451 EYPFSSEQKWMAVKCVHRTQQDRPEIcFMKGAYEQVIKYCTTYQSKGQTLT-LTQQQRDVYQQEKARMGSAGLRVLALAS 529
Cdd:cd02083 478 TLEFSRDRKSMSVYCSPTKASGGNKL-FVKGAPEGVLERCTHVRVGGGKVVpLTAAIKILILKKVWGYGTDTLRCLALAT 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 530 GPELGQ------------------LTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTS 591
Cdd:cd02083 557 KDTPPKpedmdledstkfykyetdLTFVGVVGMLDPPRPEVRDSIEKCRDAGIRVIVITGDNKGTAEAICRRIGIFGEDE 636
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 592 Q----SVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTD 667
Cdd:cd02083 637 DttgkSYTGREFDDLSPEEQREACRRARLFSRVEPSHKSKIVELLQSQGEITAMTGDGVNDAPALKKAEIGIAMG-SGTA 715
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 668 VCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQ 747
Cdd:cd02083 716 VAKSASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPAT 795
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 748 SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVF--------------WRELR-------------- 799
Cdd:cd02083 796 ALGFNPPDLDIMKKPPRKPDEPLISGWLFFRYLAIGTYVGLATVGAFawwfmyyeegpqvsFYQLThfmqcsswepnfeg 875
                       890       900       910       920       930       940       950
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 48762685 800 ---DNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQT 870
Cdd:cd02083 876 vdcEIFEDPHPMTMALSVLVVIEMFNALNSLSENQSLLVMPPWSNPWLVGAIALSMALHFVILYVPPLATIFQI 949
ATPase-IIA1_Ca TIGR01116
sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the ...
76-900 0e+00

sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the endoplasmic reticulum membrane of eukaryotes, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. These pumps transfer Ca2+ from the cytoplasm to the lumen of the endoplasmic reticulum. In humans and mice, at least, there are multiple isoforms of the SERCA pump with overlapping but not redundant functions. Defects in SERCA isoforms are associated with diseases in humans. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the latter of which is modelled by TIGR01522. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273452 [Multi-domain]  Cd Length: 917  Bit Score: 601.00  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    76 ISQFKNPLIMLLLASAVISVLMHQFDDAVSIT-------VAILIVV---TVAFVQEYRSEKSLEELSKLVPPECHCVREG 145
Cdd:TIGR01116   2 LEQFEDLLVRILLLAACVSFVLAWFEEGEETVtafvepfVILLILVanaIVGVWQERNAEKAIEALKEYESEHAKVLRDG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   146 KLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAaTNGDLASRSNIAFMGTLVRC 225
Cdd:TIGR01116  82 RWSVIKAKDLVPGDIVELAVGDKVPADIRVLSLKTLRVDQSILTGESVSVNKHTESVPD-ERAVNQDKKNMLFSGTLVVA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   226 GKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSfysfGIIGIIMLVGWLLG--------------KDI 291
Cdd:TIGR01116 161 GKARGVVVRTGMSTEIGKIRDEMRAAEQEDTPLQKKLDEFGELLS----KVIGLICILVWVINighfndpalgggwiQGA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   292 LEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGL 371
Cdd:TIGR01116 237 IYYFKIAVALAVAAIPEGLPAVITTCLALGTRKMAKKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSVCKVVALDPS 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   372 HAE-----VTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTL------MGKPTEGALIALAMKMGLD 440
Cdd:TIGR01116 317 SSSlnefcVTGTTYAPEGGVIKDDGPVAGGQDAGLEELATIAALCNDSSLDFNERkgvyekVGEATEAALKVLVEKMGLP 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   441 G------------------LQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDrpeiCFMKGAYEQVIKYCTTYQSK-GQTLT 501
Cdd:TIGR01116 397 AtkngvsskrrpalgcnsvWNDKFKKLATLEFSRDRKSMSVLCKPSTGNK----LFVKGAPEGVLERCTHILNGdGRAVP 472
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   502 LTQQQRDVYQQEKARMGSA-GLRVLALASGPELGQ------------------LTFLGLVGIIDPPRTGVKEAVTTLIAS 562
Cdd:TIGR01116 473 LTDKMKNTILSVIKEMGTTkALRCLALAFKDIPDPreedllsdpanfeaiesdLTFIGVVGMLDPPRPEVADAIEKCRTA 552
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   563 GVSIKMITGDSQETAVAIASRLGLYSK----TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSV 638
Cdd:TIGR01116 553 GIRVIMITGDNKETAEAICRRIGIFSPdedvTFKSFTGREFDEMGPAKQRAACRSAVLFSRVEPSHKSELVELLQEQGEI 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   639 VAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLIS 718
Cdd:TIGR01116 633 VAMTGDGVNDAPALKKADIGIAMG-SGTEVAKEASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYMISSNIGEVVCIF 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   719 LATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSI--IIVCGTLFVFWR 796
Cdd:TIGR01116 712 LTAALGIPEGLIPVQLLWVNLVTDGLPATALGFNPPDKDIMWKPPRRPDEPLITGWLFFRYLVVGVyvGLATVGGFVWWY 791
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   797 EL-------RDNVITPRD---------------TTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMG 854
Cdd:TIGR01116 792 LLthftgcdEDSFTTCPDfedpdcyvfegkqpaRTISLSVLVVIEMFNALNALSEDQSLLRMPPWVNKWLIGAICLSMAL 871
                         890       900       910       920
                  ....*....|....*....|....*....|....*....|....*.
gi 48762685   855 QLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVER 900
Cdd:TIGR01116 872 HFLILYVPFLSRIFGVTPLSLTDWLMVLKLSLPVILVDEVLKFFSR 917
P-type_ATPase_Ca_PMCA-like cd02081
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related ...
51-773 1.10e-161

animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1; Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319776 [Multi-domain]  Cd Length: 721  Bit Score: 490.18  E-value: 1.10e-161
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  51 VSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV---LMHQFDDA---------VSITVAILIVVTVAF 118
Cdd:cd02081   1 LEHRREVYGKNEIPPKPPKSFLQLVWEALQDPTLIILLIAAIVSLglgFYTPFGEGegktgwiegVAILVAVILVVLVTA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 119 VQEYRSEKSLEEL-SKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSK 197
Cdd:cd02081  81 GNDYQKEKQFRKLnSKKEDQKVTVIRDGEVIQISVFDIVVGDIVQLKYGDLIPADGLLIEGNDLKIDESSLTGESDPIKK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 198 VTapqpaatngDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFG-- 275
Cdd:cd02081 161 TP---------DNQIPDPFLLSGTKVLEGSGKMLVTAVGVNSQTGKIMTLLRAENEEKTPLQEKLTKLAVQIGKVGLIva 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 276 -IIGIIMLVGWLL--------------GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 340
Cdd:cd02081 232 aLTFIVLIIRFIIdgfvndgksfsaedLQEFVNFFIIAVTIIVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACET 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 341 LGCCNVICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnnt 420
Cdd:cd02081 312 MGNATAICSDKTGTLTQNRMTVVQGYI----------------------------------------------------- 338
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 421 lmGKPTEGALIALAMKMGLDglqQDYIRKAE-------YPFSSEQKWMAVkcVHRTQQDRPEIcFMKGAYEQVIKYCTTY 493
Cdd:cd02081 339 --GNKTECALLGFVLELGGD---YRYREKRPeekvlkvYPFNSARKRMST--VVRLKDGGYRL-YVKGASEIVLKKCSYI 410
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 494 QSK-GQTLTLTQQQRDVYQQEKARMGSAGLRVLALASG------------------PELGQLTFLGLVGIIDPPRTGVKE 554
Cdd:cd02081 411 LNSdGEVVFLTSEKKEEIKRVIEPMASDSLRTIGLAYRdfspdeeptaerdwddeeDIESDLTFIGIVGIKDPLRPEVPE 490
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 555 AVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSV----------SGEEIDAMDVQQLSQIVPKVAVFYRASPRH 624
Cdd:cd02081 491 AVAKCQRAGITVRMVTGDNINTARAIARECGILTEGEDGLvlegkefrelIDEEVGEVCQEKFDKIWPKLRVLARSSPED 570
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 625 KMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVR 704
Cdd:cd02081 571 KYTLVKGLKDSGEVVAVTGDGTNDAPALKKADVGFAMGIAGTEVAKEASDIILLDDNFSSIVKAVMWGRNVYDSIRKFLQ 650
                       730       740       750       760       770       780
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 48762685 705 FQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTK 773
Cdd:cd02081 651 FQLTVNVVAVILAFIGAVVTKDSPLTAVQMLWVNLIMDTLAALALATEPPTEDLLKRKPYGRDKPLISR 719
P-type_ATPase_Na_ENA cd02086
fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces ...
45-868 3.85e-161

fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces cerevisiae Ena1p, Ena2p and Ustilago maydis Ena1, and the endoplasmic reticulum sodium transporter Ustilago maydis Ena2; Fungal-type Na(+)-ATPase (also called ENA ATPases). This subfamily includes the Saccharomyces cerevisiae plasma membrane transporters: Na(+)/Li(+)-exporting ATPase Ena1p which may also extrudes K(+), and Na(+)-exporting P-type ATPase Ena2p. It also includes Ustilago maydis plasma membrane Ena1, an K(+)/Na(+)-ATPase whose chief role is to pump Na(+) and K(+) out of the cytoplasm, especially at high pH values, and endoplasmic reticulum Ena2 ATPase which mediates Na(+) or K(+) fluxes in the ER or in other endomembranes. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319780 [Multi-domain]  Cd Length: 920  Bit Score: 495.44  E-value: 3.85e-161
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 124
Cdd:cd02086   1 GLTNDEAERRLKEYGENELEGDTGVSAWKILLRQVANAMTLVLIIAMALSFAVKDWIEGGVIAAVIALNVIVGFIQEYKA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 125 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKvTAPQPA 204
Cdd:cd02086  81 EKTMDSLRNLSSPNAHVIRSGKTETISSKDVVPGDIVLLKVGDTVPADLRLIETKNFETDEALLTGESLPVIK-DAELVF 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 205 ATNGDL--ASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ----AEEAPK----------------------- 255
Cdd:cd02086 160 GKEEDVsvGDRLNLAYSSSTVTKGRAKGIVVATGMNTEIGKIAKALRgkggLISRDRvkswlygtlivtwdavgrflgtn 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 256 --TPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVK 333
Cdd:cd02086 240 vgTPLQRKLSKLAYLLFFIAVILAIIVFAVNKFDVDN--EVIIYAIALAISMIPESLVAVLTITMAVGAKRMVKRNVIVR 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 334 KLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvCND 413
Cdd:cd02086 318 KLDALEALGAVTDICSDKTGTLTQGKMVVRQVWIPAAL---------------------------------------CNI 358
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 414 AVIRNN------TLMGKPTEGALIALAMKMGL------DGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPEICFMKG 481
Cdd:cd02086 359 ATVFKDeetdcwKAHGDPTEIALQVFATKFDMgknaltKGGSAQFQHVAEFPFDSTVKRMSV--VYYNNQAGDYYAYMKG 436
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 482 AYEQVIKYCTTYQSKGQTLTLTQQQRD--VYQQEKarMGSAGLRVLALAS--------------GPELGQ------LTFL 539
Cdd:cd02086 437 AVERVLECCSSMYGKDGIIPLDDEFRKtiIKNVES--LASQGLRVLAFASrsftkaqfnddqlkNITLSRadaesdLTFL 514
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 540 GLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGL-------YSKT---------SQ--SVSGEEIDA 601
Cdd:cd02086 515 GLVGIYDPPRNESAGAVEKCHQAGITVHMLTGDHPGTAKAIAREVGIlppnsyhYSQEimdsmvmtaSQfdGLSDEEVDA 594
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 602 MDVQQLsqivpkvaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDD 681
Cdd:cd02086 595 LPVLPL--------VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMADVGIAMGLNGSDVAKDASDIVLTDDN 666
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 682 FQTIMSAIEEGKGIYNNIKNFVRFQLSTSIA--ALTLISLA-----TLMNFpnPLNAMQILWINIIMDGPPAQSLGVEPV 754
Cdd:cd02086 667 FASIVNAIEEGRRMFDNIQKFVLHLLAENVAqvILLLIGLAfkdedGLSVF--PLSPVEILWINMVTSSFPAMGLGLEKA 744
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 755 DKDVIRKPPRNWKDSILTKNLILKILVSSII--IVCGTLFVF-----------------WRELRDNVITPRDTtmTFTCF 815
Cdd:cd02086 745 SPDVMQRPPHDLKVGIFTRELIIDTFVYGTFmgVLCLASFTLviygigngdlgsdcnesYNSSCEDVFRARAA--VFATL 822
                       890       900       910       920       930       940
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 48762685 816 VFFDMFNALSSRSQTKSVFEIG-------------LCSNRMFCYAVLGSIMGQLLVIYFPPL-QKVF 868
Cdd:cd02086 823 TWCALILAWEVVDMRRSFFNMHpdtdspvksffktLWKNKFLFWSVVLGFVSVFPTLYIPVInDDVF 889
P-type_ATPase cd07539
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
78-752 1.42e-142

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319840 [Multi-domain]  Cd Length: 634  Bit Score: 437.62  E-value: 1.42e-142
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  78 QFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVRE--GKLEHTLARDL 155
Cdd:cd07539  35 QLELPPVALLGLAAGASASTGGGVDAVLIVGVLTVNAVIGGVQRLRAERALAALLAQQQQPARVVRApaGRTQTVPAESL 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 156 VPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAAtngDLASRSNIAFMGTLVRCGKAKGVVIGT 235
Cdd:cd07539 115 VPGDVIELRAGEVVPADARLLEADDLEVDESALTGESLPVDKQVAPTPGA---PLADRACMLYEGTTVVSGQGRAVVVAT 191
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 236 GENSEFGEVFKMMQAEEApKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVT 315
Cdd:cd07539 192 GPHTEAGRAQSLVAPVET-ATGVQAQLRELTSQLLPLSLGGGAAVTGLGLLRGAPLRQAVADGVSLAVAAVPEGLPLVAT 270
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 316 VTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhg 395
Cdd:cd07539 271 LAQLAAARRLSRRGVLVRSPRTVEALGRVDTICFDKTGTLTENRLRVVQVRP---------------------------- 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 396 fynpavsriveagcvcndavirnntlmgkPTegalialamkmgldglqqdyirkAEYPFSSEQKWMAVkcVHRTQQDRPE 475
Cdd:cd07539 323 -----------------------------PL-----------------------AELPFESSRGYAAA--IGRTGGGIPL 348
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 476 ICfMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALA-----SGPEL------GQLTFLGLVGI 544
Cdd:cd07539 349 LA-VKGAPEVVLPRCDRRMTGGQVVPLTEADRQAIEEVNELLAGQGLRVLAVAyrtldAGTTHaveavvDDLELLGLLGL 427
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 545 IDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLySKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRH 624
Cdd:cd07539 428 ADTARPGAAALIAALHDAGIDVVMITGDHPITARAIAKELGL-PRDAEVVTGAELDALDEEALTGLVADIDVFARVSPEQ 506
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 625 KMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVR 704
Cdd:cd07539 507 KLQIVQALQAAGRVVAMTGDGANDAAAIRAADVGIGVGARGSDAAREAADLVLTDDDLETLLDAVVEGRTMWQNVRDAVH 586
                       650       660       670       680
                ....*....|....*....|....*....|....*....|....*...
gi 48762685 705 FQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVE 752
Cdd:cd07539 587 VLLGGNLGEVMFTLIGTAIGGGAPLNTRQLLLVNLLTDMFPALALAVE 634
ATPase-IIB_Ca TIGR01517
plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
31-872 2.42e-142

plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes, out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are represented by two corresponding models (TIGR01116 and TIGR01522). This model is well separated from those.


Pssm-ID: 273668 [Multi-domain]  Cd Length: 956  Bit Score: 447.30  E-value: 2.42e-142
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    31 VSEVASILQADLQNGL--NKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFD------- 101
Cdd:TIGR01517  45 AEGIATKLKTDLNEGVrlSSSTLERREKVYGKNELPEKPPKSFLQIVWAALSDQTLILLSVAAVVSLVLGLYVpsvgedk 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   102 --------DAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPP-ECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPAD 172
Cdd:TIGR01517 125 adtetgwiEGVAILVSVILVVLVTAVNDYKKELQFRQLNREKSAqKIAVIRGGQEQQISIHDIVVGDIVSLSTGDVVPAD 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   173 LRLFEAVDLSIDESSLTGETTPcSKVTAPQPaatngdlasrsNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEE 252
Cdd:TIGR01517 205 GVFISGLSLEIDESSITGESDP-IKKGPVQD-----------PFLLSGTVVNEGSGRMLVTAVGVNSFGGKLMMELRQAG 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   253 APKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLL------------------GKDILEMFTISVSLAVAAIPEGLPIVV 314
Cdd:TIGR01517 273 EEETPLQEKLSELAGLIGKFGMGSAVLLFLVLSLRyvfriirgdgrfedteedAQTFLDHFIIAVTIVVVAVPEGLPLAV 352
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   315 TVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSdGLHAEVTGVGYNQFGEVIVDGDVVH 394
Cdd:TIGR01517 353 TIALAYSMKKMMKDNNLVRHLAACETMGSATAICSDKTGTLTQNVMSVVQGYIG-EQRFNVRDEIVLRNLPAAVRNILVE 431
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   395 GFY-NPAVSRIVEAGcvcndaviRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAE-----YPFSSEQKWMAVKCVHR 468
Cdd:TIGR01517 432 GISlNSSSEEVVDRG--------GKRAFIGSKTECALLDFGLLLLLQSRDVQEVRAEEkvvkiYPFNSERKFMSVVVKHS 503
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   469 TQQDRpeiCFMKGAYEQVIKYCTTYQSKGQTLT-LTQQQRDVYQQEKARMGSAGLRVLALA-----------SGPELGQL 536
Cdd:TIGR01517 504 GGKYR---EFRKGASEIVLKPCRKRLDSNGEATpISEDDKDRCADVIEPLASDALRTICLAyrdfapeefprKDYPNKGL 580
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   537 TFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAV 616
Cdd:TIGR01517 581 TLIGVVGIKDPLRPGVREAVQECQRAGITVRMVTGDNIDTAKAIARNCGILTFGGLAMEGKEFRSLVYEEMDPILPKLRV 660
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   617 FYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIY 696
Cdd:TIGR01517 661 LARSSPLDKQLLVLMLKDMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAKEASDIILLDDNFASIVRAVKWGRNVY 740
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   697 NNIKNFVRFQLSTSIAALTLISLATLM--NFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKN 774
Cdd:TIGR01517 741 DNIRKFLQFQLTVNVVAVILTFVGSCIssSHTSPLTAVQLLWVNLIMDTLAALALATEPPTEALLDRKPIGRNAPLISRS 820
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   775 LILKILVSSI--IIVCGTLFVFWRELRD----NVITPRDT----TMTFTCFVFFDMFNALSSRS--QTKSVFEiGLCSNR 842
Cdd:TIGR01517 821 MWKNILGQAGyqLVVTFILLFAGGSIFDvsgpDEITSHQQgelnTIVFNTFVLLQLFNEINARKlyEGMNVFE-GLFKNR 899
                         890       900       910
                  ....*....|....*....|....*....|
gi 48762685   843 MFCYAVLGSIMGQLLVIYFppLQKVFQTES 872
Cdd:TIGR01517 900 IFVTIMGFTFGFQVIIVEF--GGSFFSTVS 927
P-type_ATPase cd07538
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
45-778 1.19e-138

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319839 [Multi-domain]  Cd Length: 653  Bit Score: 428.01  E-value: 1.19e-138
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 124
Cdd:cd07538   1 GLTEAEARRRLESGGKNELPQPKKRTLLASILDVLREPMFLLLLAAALIYFVLGDPREGLILLIFVVVIIAIEVVQEWRT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 125 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPA 204
Cdd:cd07538  81 ERALEALKNLSSPRATVIRDGRERRIPSRELVPGDLLILGEGERIPADGRLLENDDLGVDESTLTGESVPVWKRIDGKAM 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 205 ATNGdlASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 284
Cdd:cd07538 161 SAPG--GWDKNFCYAGTLVVRGRGVAKVEATGSRTELGKIGKSLAEMDDEPTPLQKQTGRLVKLCALAALVFCALIVAVY 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 285 WLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTH 364
Cdd:cd07538 239 GVTRGDWIQAILAGITLAMAMIPEEFPVILTVFMAMGAWRLAKKNVLVRRAAAVETLGSITVLCVDKTGTLTKNQMEVVE 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 365 IFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndaVIRnntlmgkptegalialamkmgldglqq 444
Cdd:cd07538 319 LTS-----------------------------------------------LVR--------------------------- 324
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 445 dyirkaEYPFSSEQKWMAvkcvHRTQQDRPEICFMKGAYEQVIKYCTtyqskgqtltLTQQQRDVYQQEKARMGSAGLRV 524
Cdd:cd07538 325 ------EYPLRPELRMMG----QVWKRPEGAFAAAKGSPEAIIRLCR----------LNPDEKAAIEDAVSEMAGEGLRV 384
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 525 LALASG--------PELGQLTF--LGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLySKTSQSV 594
Cdd:cd07538 385 LAVAACridesflpDDLEDAVFifVGLIGLADPLREDVPEAVRICCEAGIRVVMITGDNPATAKAIAKQIGL-DNTDNVI 463
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 595 SGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAAD 674
Cdd:cd07538 464 TGQELDAMSDEELAEKVRDVNIFARVVPEQKLRIVQAFKANGEIVAMTGDGVNDAPALKAAHIGIAMGKRGTDVAREASD 543
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 675 MILVDDDFQTIMSAIEEGKGIYNNIKN---FVrFQLSTSIAALTLisLATLMNFPNPLNAMQILWINIIMDGPPAQSLGV 751
Cdd:cd07538 544 IVLLDDNFSSIVSTIRLGRRIYDNLKKaitYV-FAIHVPIAGLAL--LPPLLGLPPLLFPVHVVLLELIIDPTCSIVFEA 620
                       730       740
                ....*....|....*....|....*..
gi 48762685 752 EPVDKDVIRKPPRNWKDSILTKNLILK 778
Cdd:cd07538 621 EPAERDIMRRPPRPPDEPLFGPRLVIK 647
ATPase-IID_K-Na TIGR01523
potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium ...
33-794 2.59e-130

potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.


Pssm-ID: 130586 [Multi-domain]  Cd Length: 1053  Bit Score: 417.88  E-value: 2.59e-130
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685     33 EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILI 112
Cdd:TIGR01523   14 EAAEFIGTSIPEGLTHDEAQHRLKEVGENRLEADSGIDAKAMLLHQVCNAMCMVLIIAAAISFAMHDWIEGGVISAIIAL 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    113 VVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGET 192
Cdd:TIGR01523   94 NILIGFIQEYKAEKTMDSLKNLASPMAHVIRNGKSDAIDSHDLVPGDICLLKTGDTIPADLRLIETKNFDTDEALLTGES 173
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    193 TPCSK----VTAPQPAATNGDlasRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAE---------EAPK---- 255
Cdd:TIGR01523  174 LPVIKdahaTFGKEEDTPIGD---RINLAFSSSAVTKGRAKGICIATALNSEIGAIAAGLQGDgglfqrpekDDPNkrrk 250
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    256 ----------------------TPLQKSMDLLGKQLsFYSFGIIGIIMLVGWLLGKDiLEMFTISVSLAVAAIPEGLPIV 313
Cdd:TIGR01523  251 lnkwilkvtkkvtgaflglnvgTPLHRKLSKLAVIL-FCIAIIFAIIVMAAHKFDVD-KEVAIYAICLAISIIPESLIAV 328
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    314 VTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIF----------TSD-------------- 369
Cdd:TIGR01523  329 LSITMAMGAANMSKRNVIVRKLDALEALGAVNDICSDKTGTITQGKMIARQIWiprfgtisidNSDdafnpnegnvsgip 408
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    370 ------GLHAEVTGVGYNQ-FGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNT------LMGKPTEGALIALAMK 436
Cdd:TIGR01523  409 rfspyeYSHNEAADQDILKeFKDELKEIDLPEDIDMDLFIKLLETAALANIATVFKDDatdcwkAHGDPTEIAIHVFAKK 488
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    437 MGL-----------------------------DGLQQDYIRkaEYPFSSEQKWMAVkcVHRTQQDRPEICFMKGAYEQVI 487
Cdd:TIGR01523  489 FDLphnaltgeedllksnendqsslsqhnekpGSAQFEFIA--EFPFDSEIKRMAS--IYEDNHGETYNIYAKGAFERII 564
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    488 KYCTTYQSKG--QTLTLTQQQRDVYQQEKARMGSAGLRVLALAS---------GPELGQLT-----------FLGLVGII 545
Cdd:TIGR01523  565 ECCSSSNGKDgvKISPLEDCDRELIIANMESLAAEGLRVLAFASksfdkadnnDDQLKNETlnrataesdleFLGLIGIY 644
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    546 DPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLG-----LYSKTSQSVS-----GEEIDAMDVQQLSQIVPKVA 615
Cdd:TIGR01523  645 DPPRNESAGAVEKCHQAGINVHMLTGDFPETAKAIAQEVGiippnFIHDRDEIMDsmvmtGSQFDALSDEEVDDLKALCL 724
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    616 VFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGI 695
Cdd:TIGR01523  725 VIARCAPQTKVKMIEALHRRKAFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRM 804
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    696 YNNIKNFVRFQLSTSIAALTLISLATLMNFPN-----PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSI 770
Cdd:TIGR01523  805 FDNIMKFVLHLLAENVAEAILLIIGLAFRDENgksvfPLSPVEILWCIMITSCFPAMGLGLEKAAPDLMDRLPHDNEVGI 884
                          890       900
                   ....*....|....*....|....
gi 48762685    771 LTKNLILKILVSSIIIVCGTLFVF 794
Cdd:TIGR01523  885 FQKELIIDMFAYGFFLGGSCLASF 908
P-type_ATPase_Mg cd02077
magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella ...
45-794 1.62e-129

magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA; MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319772 [Multi-domain]  Cd Length: 768  Bit Score: 407.79  E-value: 1.62e-129
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVIS----VLMHQ----FDDAVSITVAILIVVTV 116
Cdd:cd02077   1 GLTNEEAEERLEKYGPNEISHEKFPSWFKLLLKAFINPFNIVLLVLALVSfftdVLLAPgefdLVGALIILLMVLISGLL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 117 AFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARD-LVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPC 195
Cdd:cd02077  81 DFIQEIRSLKAAEKLKKMVKNTATVIRDGSKYMEIPIDeLVPGDIVYLSAGDMIPADVRIIQSKDLFVSQSSLTGESEPV 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 196 SKVTAPQpAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQaEEAPKTPLQKSMDLLGKQLSFYSFG 275
Cdd:cd02077 161 EKHATAK-KTKDESILELENICFMGTNVVSGSALAVVIATGNDTYFGSIAKSIT-EKRPETSFDKGINKVSKLLIRFMLV 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 276 IIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTL 355
Cdd:cd02077 239 MVPVVFLINGLTKGDWLEALLFALAVAVGLTPEMLPMIVTSNLAKGAVRMSKRKVIVKNLNAIQNFGAMDILCTDKTGTL 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 356 TKNEMTVTHIFTSDGlhaevtgvgynQFGEVIVDgdvvHGFYNPavsrIVEAGcvcndavIRNntLMGKptegALIALAM 435
Cdd:cd02077 319 TQDKIVLERHLDVNG-----------KESERVLR----LAYLNS----YFQTG-------LKN--LLDK----AIIDHAE 366
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 436 KMGLDGLQQDYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKA 515
Cdd:cd02077 367 EANANGLIQDYTKIDEIPFDFERRRMSV-VVKDNDGKHLLIT--KGAVEEILNVCTHVEVNGEVVPLTDTLREKILAQVE 443
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 516 RMGSAGLRVLALA----SGPELG-------QLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRL 584
Cdd:cd02077 444 ELNREGLRVLAIAykklPAPEGEysvkdekELILIGFLAFLDPPKESAAQAIKALKKNGVNVKILTGDNEIVTKAICKQV 523
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 585 GLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQT 664
Cdd:cd02077 524 GL--DINRVLTGSEIEALSDEELAKIVEETNIFAKLSPLQKARIIQALKKNGHVVGFMGDGINDAPALRQADVGISV-DS 600
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 665 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLAT-LMNFpNPLNAMQILWINIIMDg 743
Cdd:cd02077 601 AVDIAKEAADIILLEKDLMVLEEGVIEGRKTFGNILKYIKMTASSNFGNVFSVLVASaFLPF-LPMLPIQLLLQNLLYD- 678
                       730       740       750       760       770
                ....*....|....*....|....*....|....*....|....*....|....*
gi 48762685 744 pPAQ-SLGVEPVDKDVIRKpPRNWKDSILTKNLILKILVSSI---IIVCGTLFVF 794
Cdd:cd02077 679 -FSQlAIPFDNVDEEFLKK-PQKWDIKNIGRFMIWIGPISSIfdiLTFLVMWFVF 731
P-type_ATPase_Na-K_like cd02608
alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+) ...
45-776 1.14e-127

alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+)/K(+)-ATPase alpha subunits 1-4; This subfamily includes the alpha subunit of Na(+)/K(+)-ATPase a heteromeric transmembrane protein composed of an alpha- and beta-subunit and an optional third subunit belonging to the FXYD proteins which are more tissue specific regulatory subunits of the enzyme. The alpha-subunit is the catalytic subunit responsible for transport activities of the enzyme. This subfamily includes all four isotopes of the human alpha subunit: (alpha1-alpha4, encoded by the ATP1A1- ATP1A4 genes). Na(+)/K(+)-ATPase functions chiefly as an ion pump, hydrolyzing one molecule of ATP to pump three Na(+) out of the cell in exchange for two K(+)entering the cell per pump cycle. In addition Na(+)/K(+)-ATPase acts as a signal transducer. This subfamily also includes Oreochromis mossambicus (tilapia) Na(+)/K(+)-ATPase alpha 1 and alpha 3 subunits, and gastric H(+)/K(+)-ATPase which exchanges hydronium ion with potassium and is responsible for gastric acid secretion. Gastric H(+)/K(+)-ATPase is an alpha,beta-heterodimeric enzyme. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319794 [Multi-domain]  Cd Length: 905  Bit Score: 407.12  E-value: 1.14e-127
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMH----QFDDAVS-------ITVAILIV 113
Cdd:cd02608   1 GLTSARAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSMLLWIGAILCFLAYgiqaATEEEPSndnlylgIVLAAVVI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 114 VT--VAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGE 191
Cdd:cd02608  81 VTgcFSYYQEAKSSKIMDSFKNMVPQQALVIRDGEKMQINAEELVVGDLVEVKGGDRIPADIRIISAHGCKVDNSSLTGE 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 192 TTPCSKvtapQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMD-------- 263
Cdd:cd02608 161 SEPQTR----SPEFTHENPLETKNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGKTPIAREIEhfihiitg 236
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 264 ---LLGkqlsfYSFGIIGIIMLVGWLlgkdilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 340
Cdd:cd02608 237 vavFLG-----VSFFILSLILGYTWL------EAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVET 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 341 LGCCNVICSDKTGTLTKNEMTVTHIFtsdglhaevtgvgynqFGEVIVDGDVVHGFYN----------PAVSRIVeagCV 410
Cdd:cd02608 306 LGSTSTICSDKTGTLTQNRMTVAHMW----------------FDNQIHEADTTEDQSGasfdkssatwLALSRIA---GL 366
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 411 CNDAVIRNN---------TLMGKPTEGALIALA-MKMG-LDGLQQDYIRKAEYPFSSEQKWMAvkCVHRTQQDRPE--IC 477
Cdd:cd02608 367 CNRAEFKAGqenvpilkrDVNGDASESALLKCIeLSCGsVMEMRERNPKVAEIPFNSTNKYQL--SIHENEDPGDPryLL 444
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 478 FMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALA-------SGPE------------LGQLTF 538
Cdd:cd02608 445 VMKGAPERILDRCSTILINGKEQPLDEEMKEAFQNAYLELGGLGERVLGFChlylpddKFPEgfkfdtdevnfpTENLCF 524
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 539 LGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGlysktsqsvsgeeidamdvqqlsqivpkVAVFY 618
Cdd:cd02608 525 VGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVG----------------------------IIVFA 576
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 619 RASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNN 698
Cdd:cd02608 577 RTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN 656
                       730       740       750       760       770       780       790
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 48762685 699 IKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRN-WKDSILTKNLI 776
Cdd:cd02608 657 LKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMVPAISLAYEKAESDIMKRQPRNpKTDKLVNERLI 735
ATPase-IIC_X-K TIGR01106
sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This ...
28-776 3.57e-127

sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This model describes the P-type ATPases responsible for the exchange of either protons or sodium ions for potassium ions across the plasma membranes of eukaryotes. Unlike most other P-type ATPases, members of this subfamily require a beta subunit for activity. This model encompasses eukaryotes and consists of two functional types, a Na/K antiporter found widely distributed in eukaryotes and a H/K antiporter found only in vertebrates. The Na+ or H+/K+ antiporter P-type ATPases have been characterized as Type IIC based on a published phylogenetic analysis. Sequences from Blastocladiella emersonii (GP|6636502, GP|6636502 and PIR|T43025), C. elegans (GP|2315419, GP|6671808 and PIR|T31763) and Drosophila melanogaster (GP|7291424) score below trusted cutoff, apparently due to long branch length (excessive divergence from the last common ancestor) as evidenced by a phylogenetic tree. Experimental evidence is needed to determine whether these sequences represent ATPases with conserved function. Aside from fragments, other sequences between trusted and noise appear to be bacterial ATPases of unclear lineage, but most likely calcium pumps. [Energy metabolism, ATP-proton motive force interconversion]


Pssm-ID: 273445 [Multi-domain]  Cd Length: 997  Bit Score: 408.03  E-value: 3.57e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    28 ELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQF------- 100
Cdd:TIGR01106  19 KLSLDELERKYGTDLSKGLSAARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIqasteee 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   101 --DDAVSITVAILIVVTV----AFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLR 174
Cdd:TIGR01106  99 pqNDNLYLGVVLSAVVIItgcfSYYQEAKSSKIMESFKNMVPQQALVIRDGEKMSINAEQVVVGDLVEVKGGDRIPADLR 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   175 LFEAVDLSIDESSLTGETTPCSKvtapQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAP 254
Cdd:TIGR01106 179 IISAQGCKVDNSSLTGESEPQTR----SPEFTHENPLETRNIAFFSTNCVEGTARGIVVNTGDRTVMGRIASLASGLENG 254
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   255 KTPLQKSMD-----LLGKQLSF-YSFGIIGIIMLVGWLlgkdilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 328
Cdd:TIGR01106 255 KTPIAIEIEhfihiITGVAVFLgVSFFILSLILGYTWL------EAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARK 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   329 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLH-AEVT----GVGYNQFGEVIVdgdvvhgfynpAVSR 403
Cdd:TIGR01106 329 NCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHeADTTedqsGVSFDKSSATWL-----------ALSR 397
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   404 IVEagcVCNDAVIRNN---------TLMGKPTEGALIA-LAMKMG-LDGLQQDYIRKAEYPFSSEQKWMAvkCVHRTQ-- 470
Cdd:TIGR01106 398 IAG---LCNRAVFKAGqenvpilkrAVAGDASESALLKcIELCLGsVMEMRERNPKVVEIPFNSTNKYQL--SIHENEdp 472
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   471 QDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVL-----ALASG--PE----------- 532
Cdd:TIGR01106 473 RDPRHLLVMKGAPERILERCSSILIHGKEQPLDEELKEAFQNAYLELGGLGERVLgfchlYLPDEqfPEgfqfdtddvnf 552
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   533 -LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVS---------------- 595
Cdd:TIGR01106 553 pTDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEdiaarlnipvsqvnpr 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   596 --------GEEIDAMDVQQLSQIV---PKVaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQT 664
Cdd:TIGR01106 633 dakacvvhGSDLKDMTSEQLDEILkyhTEI-VFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIA 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   665 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGP 744
Cdd:TIGR01106 712 GSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMV 791
                         810       820       830
                  ....*....|....*....|....*....|...
gi 48762685   745 PAQSLGVEPVDKDVIRKPPRN-WKDSILTKNLI 776
Cdd:TIGR01106 792 PAISLAYEKAESDIMKRQPRNpKTDKLVNERLI 824
P-type_ATPase_H cd02076
plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+) ...
45-860 6.41e-120

plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+)-ATPases; This subfamily includes eukaryotic plasma membrane H(+)-ATPase which transports H(+) from the cytosol to the extracellular space, thus energizing the plasma membrane for the uptake of ions and nutrients, and is expressed in plants and fungi. This H(+)-ATPase consists of four domains: a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. This subfamily also includes the putative P-type H(+)-ATPase, MJ1226p of the anaerobic hyperthermophilic archaea Methanococcus jannaschii. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319771 [Multi-domain]  Cd Length: 781  Bit Score: 383.12  E-value: 6.41e-120
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  45 GLNKCEVSHRRAFHGWNEFDiSEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 124
Cdd:cd02076   1 GLTSEEAAKRLKEYGPNELP-EKKENPILKFLSFFWGPIPWMLEAAAILAAALGDWVDFAIILLLLLINAGIGFIEERQA 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 125 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKvtapqpa 204
Cdd:cd02076  80 GNAVAALKKSLAPKARVLRDGQWQEIDAKELVPGDIVSLKIGDIVPADARLLTGDALQVDQSALTGESLPVTK------- 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 205 aTNGDlasrsnIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEaPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 284
Cdd:cd02076 153 -HPGD------EAYSGSIVKQGEMLAVVTATGSNTFFGKTAALVASAE-EQGHLQKVLNKIGNFLILLALILVLIIVIVA 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 285 WLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTH 364
Cdd:cd02076 225 LYRHDPFLEILQFVLVLLIASIPVAMPAVLTVTMAVGALELAKKKAIVSRLSAIEELAGVDILCSDKTGTLTLNKLSLDE 304
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 365 IFTSDGLHAEvtgvgynqfgEVIVdgdvvhgfynpavsriveAGCVCNDAviRNNTLMGKPTEGALIALamKMGLDGLQQ 444
Cdd:cd02076 305 PYSLEGDGKD----------ELLL------------------LAALASDT--ENPDAIDTAILNALDDY--KPDLAGYKQ 352
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 445 -DYirkaeYPFSSEqkwmaVKCVHRTQQDRPEICF--MKGAYEQVIKYCttyqskgqtlTLTQQQRDVYQQEKARMGSAG 521
Cdd:cd02076 353 lKF-----TPFDPV-----DKRTEATVEDPDGERFkvTKGAPQVILELV----------GNDEAIRQAVEEKIDELASRG 412
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 522 LRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK---TSQSVSGEE 598
Cdd:cd02076 413 YRSLGVARKEDGGRWELLGLLPLFDPPRPDSKATIARAKELGVRVKMITGDQLAIAKETARQLGMGTNilsAERLKLGGG 492
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 599 IDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILV 678
Cdd:cd02076 493 GGGMPGSELIEFIEDADGFAEVFPEHKYRIVEALQQRGHLVGMTGDGVNDAPALKKADVGIAV-SGATDAARAAADIVLT 571
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 679 DDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGpPAQSLGvepVDKDV 758
Cdd:cd02076 572 APGLSVIIDAIKTSRQIFQRMKSYVIYRIAETLRILVFFTLGILILNFYPLPLIMIVLIAILNDG-ATLTIA---YDNVP 647
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 759 IRKPPRNWKdsiLTKNLILKIL------VSSIIIVC---GTLFVFWRELRDNVItprdTTMTFTCFVFFDMFNALSSRsq 829
Cdd:cd02076 648 PSPRPVRWN---MPELLGIATVlgvvltISSFLLLWlldDQGWFEDIVLSAGEL----QTILYLQLSISGHLTIFVTR-- 718
                       810       820       830
                ....*....|....*....|....*....|.
gi 48762685 830 TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIY 860
Cdd:cd02076 719 TRGPFWRPRPSPLLFIAVVLTQILATLLAVY 749
ATPase_P-type TIGR01494
ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large ...
105-735 7.38e-120

ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large family of trans-membrane transporters acting on charged substances. The distinguishing feature of the family is the formation of a phosphorylated intermediate (aspartyl-phosphate) during the course of the reaction. Another common name for these enzymes is the E1-E2 ATPases based on the two isolable conformations: E1 (unphosphorylated) and E2 (phosphorylated). Generally, P-type ATPases consist of only a single subunit encompassing the ATPase and ion translocation pathway, however, in the case of the potassium (TIGR01497) and sodium/potassium (TIGR01106) varieties, these functions are split between two subunits. Additional small regulatory or stabilizing subunits may also exist in some forms. P-type ATPases are nearly ubiquitous in life and are found in numerous copies in higher organisms (at least 45 in Arabidopsis thaliana, for instance). Phylogenetic analyses have revealed that the P-type ATPase subfamily is divided up into groups based on substrate specificities and this is represented in the various subfamily and equivalog models that have been made: IA (K+) TIGR01497, IB (heavy metals) TIGR01525, IIA1 (SERCA-type Ca++) TIGR01116, IIA2 (PMR1-type Ca++) TIGR01522, IIB (PMCA-type Ca++) TIGR01517, IIC (Na+/K+, H+/K+ antiporters) TIGR01106, IID (fungal-type Na+ and K+) TIGR01523, IIIA (H+) TIGR01647, IIIB (Mg++) TIGR01524, IV (phospholipid, flippase) TIGR01652 and V (unknown specificity) TIGR01657. The crystal structure of one calcium-pumping ATPase and an analysis of the fold of the catalytic domain of the P-type ATPases have been published. These reveal that the catalytic core of these enzymes is a haloacid dehalogenase(HAD)-type aspartate-nucleophile hydrolase. The location of the ATP-binding loop in between the first and second HAD conserved catalytic motifs defines these enzymes as members of subfamily I of the HAD superfamily (see also TIGR01493, TIGR01509, TIGR01549, TIGR01544 and TIGR01545). Based on these classifications, the P-type ATPase _superfamily_ corresponds to the IC subfamily of the HAD superfamily.


Pssm-ID: 273656 [Multi-domain]  Cd Length: 545  Bit Score: 375.50  E-value: 7.38e-120
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   105 SITVAILIVVTVAFVQEYRSEKSLEELSKLV--PPECHCVREGKLEHTlARDLVPGDTVCLSVGDRVPADLRLFEAvDLS 182
Cdd:TIGR01494   1 FILFLVLLFVLLEVKQKLKAEDALRSLKDSLvnTATVLVLRNGWKEIS-SKDLVPGDVVLVKSGDTVPADGVLLSG-SAF 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   183 IDESSLTGETTPCSKVTAPQPAATNGdlasrsniafmGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSM 262
Cdd:TIGR01494  79 VDESSLTGESLPVLKTALPDGDAVFA-----------GTINFGGTLIVKVTATGILTTVGKIAVVVYTGFSTKTPLQSKA 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   263 DLLGKQLSFYSFGIIGIIMLVGWLL----GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIV 338
Cdd:TIGR01494 148 DKFENFIFILFLLLLALAVFLLLPIggwdGNSIYKAILRALAVLVIAIPCALPLAVSVALAVGDARMAKKGILVKNLNAL 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   339 ETLGCCNVICSDKTGTLTKNEMTVTHIFTsDGLHAEVTGVGYNQFGEvivdgdvvhgfynpavsriveagcvcndavirN 418
Cdd:TIGR01494 228 EELGKVDVICFDKTGTLTTNKMTLQKVII-IGGVEEASLALALLAAS--------------------------------L 274
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   419 NTLMGKPTEGALIALAMKMG-LDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRpeiCFMKGAYEQVIKYCTtyqskg 497
Cdd:TIGR01494 275 EYLSGHPLERAIVKSAEGVIkSDEINVEYKILDVFPFSSVLKRMGVIVEGANGSDL---LFVKGAPEFVLERCN------ 345
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   498 qtltltqqQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 577
Cdd:TIGR01494 346 --------NENDYDEKVDEYARQGLRVLAFASKKLPDDLEFLGLLTFEDPLRPDAKETIEALRKAGIKVVMLTGDNVLTA 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   578 VAIASRLGLysktsqsvsgeeidamdvqqlsqivpkvAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 657
Cdd:TIGR01494 418 KAIAKELGI----------------------------DVFARVKPEEKAAIVEALQEKGRTVAMTGDGVNDAPALKKADV 469
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 48762685   658 GVAMGQtgTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQIL 735
Cdd:TIGR01494 470 GIAMGS--GDVAKAAADIVLLDDDLSTIVEAVKEGRKTFSNIKKNIFWAIAYNLILIPLALLLIVIILLPPLLAALAL 545
ATPase-IIIA_H TIGR01647
plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton ...
45-744 1.63e-112

plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea. The best studied representative is from yeast.


Pssm-ID: 273731 [Multi-domain]  Cd Length: 754  Bit Score: 362.80  E-value: 1.63e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    45 GLNKCEVSHRRAFHGWNEFdISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 124
Cdd:TIGR01647   1 GLTSAEAKKRLAKYGPNEL-PEKKVSPLLKFLGFFWNPLSWVMEAAAIIAIALENWVDFVIILGLLLLNATIGFIEENKA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   125 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTapqpa 204
Cdd:TIGR01647  80 GNAVEALKQSLAPKARVLRDGKWQEIPASELVPGDVVRLKIGDIVPADCRLFEGDYIQVDQAALTGESLPVTKKT----- 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   205 atnGDlasrsnIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 284
Cdd:TIGR01647 155 ---GD------IAYSGSTVKQGEAEAVVTATGMNTFFGKAAALVQSTETGSGHLQKILSKIGLFLIVLIGVLVLIELVVL 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   285 WLL-GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVT 363
Cdd:TIGR01647 226 FFGrGESFREGLQFALVLLVGGIPIAMPAVLSVTMAVGAAELAKKKAIVTRLTAIEELAGMDILCSDKTGTLTLNKLSID 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   364 HIFTsdglhaevtgvgynQFGEVIVDGDVVHGFYnpaVSRivEAGcvcNDAVirNNTLMGKptegaLIALAMKMgldglq 443
Cdd:TIGR01647 306 EILP--------------FFNGFDKDDVLLYAAL---ASR--EED---QDAI--DTAVLGS-----AKDLKEAR------ 350
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   444 qDYIRKAEY-PFSSEQKwmAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYqskgqtltltQQQRDVYQQEKARMGSAGL 522
Cdd:TIGR01647 351 -DGYKVLEFvPFDPVDK--RTEATVEDPETGKRFKVTKGAPQVILDLCDNK----------KEIEEKVEEKVDELASRGY 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   523 RVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK--TSQSVSGEEID 600
Cdd:TIGR01647 418 RALGVARTDEEGRWHFLGLLPLFDPPRHDTKETIERARHLGVEVKMVTGDHLAIAKETARRLGLGTNiyTADVLLKGDNR 497
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   601 AMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDD 680
Cdd:TIGR01647 498 DDLPSGLGEMVEDADGFAEVFPEHKYEIVEILQKRGHLVGMTGDGVNDAPALKKADVGIAV-AGATDAARSAADIVLTEP 576
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 48762685   681 DFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATL-MNFpnPLNAMQILWINIIMDGP 744
Cdd:TIGR01647 577 GLSVIVDAILESRKIFQRMKSYVIYRIAETIRIVFFFGLLILiLNF--YFPPIMVVIIAILNDGT 639
P-type_ATPases cd01431
ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, ...
346-749 2.94e-107

ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319764 [Multi-domain]  Cd Length: 319  Bit Score: 334.03  E-value: 2.94e-107
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 346 VICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnntlmgkp 425
Cdd:cd01431   1 VICSDKTGTLTKNGMTVTKLFI---------------------------------------------------------- 22
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 426 tegalialamkmgldglqqdyirkAEYPFSSEQKWMAVKCVHrtqqDRPEICFMKGAYEQVIKYCTTyqskgqtlTLTQQ 505
Cdd:cd01431  23 ------------------------EEIPFNSTRKRMSVVVRL----PGRYRAIVKGAPETILSRCSH--------ALTEE 66
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 506 QRDVYQQEKARMGSAGLRVLALASGP---------ELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQET 576
Cdd:cd01431  67 DRNKIEKAQEESAREGLRVLALAYREfdpetskeaVELNLVFLGLIGLQDPPRPEVKEAIAKCRTAGIKVVMITGDNPLT 146
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 577 AVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAAD 656
Cdd:cd01431 147 AIAIAREIGIDTKASGVILGEEADEMSEEELLDLIAKVAVFARVTPEQKLRIVKALQARGEVVAMTGDGVNDAPALKQAD 226
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 657 IGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILW 736
Cdd:cd01431 227 VGIAMGSTGTDVAKEAADIVLLDDNFATIVEAVEEGRAIYDNIKKNITYLLANNVAEVFAIALALFLGGPLPLLAFQILW 306
                       410
                ....*....|...
gi 48762685 737 INIIMDGPPAQSL 749
Cdd:cd01431 307 INLVTDLIPALAL 319
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
18-794 1.79e-104

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 345.13  E-value: 1.79e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   18 IPVLTSKKASELPVSEVASILQA--DLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV 95
Cdd:PRK10517  38 VPPSLSARCLKAAVMPEEELWKTfdTHPEGLNEAEVESAREQHGENELPAQKPLPWWVHLWVCYRNPFNILLTILGAISY 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   96 LMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR--EGKLEHTLA----RDLVPGDTVCLSVGDRV 169
Cdd:PRK10517 118 ATEDLFAAGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRviNDKGENGWLeipiDQLVPGDIIKLAAGDMI 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  170 PADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ 249
Cdd:PRK10517 198 PADLRILQARDLFVAQASLTGESLPVEKFATTRQPEHSNPL-ECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLAGRVS 276
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  250 AEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV-GWLLGkDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 328
Cdd:PRK10517 277 EQDSEPNAFQQGISRVSWLLIRFMLVMAPVVLLInGYTKG-DWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQ 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  329 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEmtvthIFTSDglHAEVtgvgynqFGEviVDGDVVH-----GFYNPAVSR 403
Cdd:PRK10517 356 KVIVKRLDAIQNFGAMDILCTDKTGTLTQDK-----IVLEN--HTDI-------SGK--TSERVLHsawlnSHYQTGLKN 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  404 IVEAgcvcndAVIrnntlmgkptEGALIALAMKMGldglqQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPE-ICfmKGA 482
Cdd:PRK10517 420 LLDT------AVL----------EGVDEESARSLA-----SRWQKIDEIPFDFERRRMSV--VVAENTEHHQlIC--KGA 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  483 YEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQLTFLGLVGIIDPPRTG 551
Cdd:PRK10517 475 LEEILNVCSQVRHNGEIVPLDDIMLRRIKRVTDTLNRQGLRVVAVATKYlparegdyqraDESDLILEGYIAFLDPPKET 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  552 VKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKS 631
Cdd:PRK10517 555 TAPALKALKASGVTVKILTGDSELVAAKVCHEVGL--DAGEVLIGSDIETLSDDELANLAERTTLFARLTPMHKERIVTL 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  632 LQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSI 711
Cdd:PRK10517 633 LKREGHVVGFMGDGINDAPALRAADIGISV-DGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNF 711
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  712 AAL--TLISLATLmnfPN-PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKPPRnWKDSILTKNLILKILVSSII-I 786
Cdd:PRK10517 712 GNVfsVLVASAFL---PFlPMLPLHLLIQNLLYD--VSQvAIPFDNVDDEQIQKPQR-WNPADLGRFMVFFGPISSIFdI 785
                        810
                 ....*....|
gi 48762685  787 VCGTL--FVF 794
Cdd:PRK10517 786 LTFCLmwWVF 795
ATPase-IIIB_Mg TIGR01524
magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ...
25-795 2.53e-103

magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms. These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 130587 [Multi-domain]  Cd Length: 867  Bit Score: 341.08  E-value: 2.53e-103
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    25 KASELPVSEVASILQAdLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAV 104
Cdd:TIGR01524  14 KESQMGKETLLRKLGV-HETGLTNVEVTERLAEFGPNQTVEEKKVPNLRLLIRAFNNPFIYILAMLMGVSYLTDDLEATV 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   105 SITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR------EGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEA 178
Cdd:TIGR01524  93 IIALMVLASGLLGFIQESRAERAAYALKNMVKNTATVLRvinengNGSMDEVPIDALVPGDLIELAAGDIIPADARVISA 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   179 VDLSIDESSLTGETTPCSKVTAPQPAATNgDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMqAEEAPKTPL 258
Cdd:TIGR01524 173 RDLFINQSALTGESLPVEKFVEDKRARDP-EILERENLCFMGTNVLSGHAQAVVLATGSSTWFGSLAIAA-TERRGQTAF 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   259 QKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIV 338
Cdd:TIGR01524 251 DKGVKSVSKLLIRFMLVMVPVVLMINGLMKGDWLEAFLFALAVAVGLTPEMLPMIVSSNLAKGAINMSKKKVIVKELSAI 330
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   339 ETLGCCNVICSDKTGTLTKNEMTVTHiftsdglHAEVTGVGYNQfgevivdgdVVHGFYNPAVSRiVEAGCVCNDAVIRn 418
Cdd:TIGR01524 331 QNFGAMDILCTDKTGTLTQDKIELEK-------HIDSSGETSER---------VLKMAWLNSYFQ-TGWKNVLDHAVLA- 392
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   419 ntlmgKPTEGALIALAMKmgldglqqdYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYCTTYQSKGQ 498
Cdd:TIGR01524 393 -----KLDESAARQTASR---------WKKVDEIPFDFDRRRLSV-VVENRAEVTRLIC--KGAVEEMLTVCTHKRFGGA 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   499 TLTLTQQQRDVYQQEKARMGSAGLRVLALAS--GPELG---------QLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIK 567
Cdd:TIGR01524 456 VVTLSESEKSELQDMTAEMNRQGIRVIAVATktLKVGEadftktdeeQLIIEGFLGFLDPPKESTKEAIAALFKNGINVK 535
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   568 MITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVN 647
Cdd:TIGR01524 536 VLTGDNEIVTARICQEVGI--DANDFLLGADIEELSDEELARELRKYHIFARLTPMQKSRIIGLLKKAGHTVGFLGDGIN 613
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   648 DAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPN 727
Cdd:TIGR01524 614 DAPALRKADVGISV-DTAADIAKEASDIILLEKSLMVLEEGVIEGRNTFGNILKYLKMTASSNFGNVFSVLVASAFIPFL 692
                         730       740       750       760       770       780
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 48762685   728 PLNAMQILWINIIMDGPPAqSLGVEPVDKDVIRKpPRNWKDSILTKNLILKILVSSIIIVCGTLFVFW 795
Cdd:TIGR01524 693 PMLSLHLLIQNLLYDFSQL-TLPWDKMDREFLKK-PHQWEQKGMGRFMLCIGPVSSIFDIATFLLMWF 758
PRK15122 PRK15122
magnesium-transporting ATPase; Provisional
43-766 5.34e-91

magnesium-transporting ATPase; Provisional


Pssm-ID: 237914 [Multi-domain]  Cd Length: 903  Bit Score: 308.49  E-value: 5.34e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   43 QNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLM------HQFDDAVSITVAILIV-VT 115
Cdd:PRK15122  43 RQGLTEEDAAERLQRYGPNEVAHEKPPHALVQLLQAFNNPFIYVLMVLAAISFFTdywlplRRGEETDLTGVIIILTmVL 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  116 VA----FVQEYRSEKSLEELSKLVPPECHCVR------EGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDE 185
Cdd:PRK15122 123 LSgllrFWQEFRSNKAAEALKAMVRTTATVLRrghagaEPVRREIPMRELVPGDIVHLSAGDMIPADVRLIESRDLFISQ 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  186 SSLTGETTPCSKV---------TAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEaPKT 256
Cdd:PRK15122 203 AVLTGEALPVEKYdtlgavagkSADALADDEGSLLDLPNICFMGTNVVSGTATAVVVATGSRTYFGSLAKSIVGTR-AQT 281
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  257 PLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLP 336
Cdd:PRK15122 282 AFDRGVNSVSWLLIRFMLVMVPVVLLINGFTKGDWLEALLFALAVAVGLTPEMLPMIVSSNLAKGAIAMARRKVVVKRLN 361
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  337 IVETLGCCNVICSDKTGTLTKNEMTVTHiftsdglHaevtgvgynqfgeviVDgdvVHGFYNPAVSRIV------EAGcv 410
Cdd:PRK15122 362 AIQNFGAMDVLCTDKTGTLTQDRIILEH-------H---------------LD---VSGRKDERVLQLAwlnsfhQSG-- 414
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  411 cndavIRNntLMGKptegALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYC 490
Cdd:PRK15122 415 -----MKN--LMDQ----AVVAFAEGNPEIVKPAGYRKVDELPFDFVRRRLSV-VVEDAQGQHLLIC--KGAVEEMLAVA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  491 TTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASgPELGQ--------------LTFLGLVGIIDPPRTGVKEAV 556
Cdd:PRK15122 481 THVRDGDTVRPLDEARRERLLALAEAYNADGFRVLLVAT-REIPGgesraqystaderdLVIRGFLTFLDPPKESAAPAI 559
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  557 TTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNG 636
Cdd:PRK15122 560 AALRENGVAVKVLTGDNPIVTAKICREVGL--EPGEPLLGTEIEAMDDAALAREVEERTVFAKLTPLQKSRVLKALQANG 637
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  637 SVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTsiaaltl 716
Cdd:PRK15122 638 HTVGFLGDGINDAPALRDADVGISV-DSGADIAKESADIILLEKSLMVLEEGVIKGRETFGNIIKYLNMTASS------- 709
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 48762685  717 islatlmNFPN--------------PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKpPRNW 766
Cdd:PRK15122 710 -------NFGNvfsvlvasafipflPMLAIHLLLQNLMYD--ISQlSLPWDKMDKEFLRK-PRKW 764
P-type_ATPase cd02609
uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized ...
86-766 2.62e-82

uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7; This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319795 [Multi-domain]  Cd Length: 661  Bit Score: 278.78  E-value: 2.62e-82
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  86 LLLASAVISVLMHQFDDAVSITVAILIVVtVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSV 165
Cdd:cd02609  42 INFVIAVLLILVGSYSNLAFLGVIIVNTV-IGIVQEIRAKRQLDKLSILNAPKVTVIRDGQEVKIPPEELVLDDILILKP 120
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 166 GDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTapqpaatnGDLAsrsniaFMGTLVRCGKAKGVVIGTGENSefgevF 245
Cdd:cd02609 121 GEQIPADGEVVEGGGLEVDESLLTGESDLIPKKA--------GDKL------LSGSFVVSGAAYARVTAVGAES-----Y 181
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 246 KMMQAEEAPK-----TPLQKSMDLLGKqlsFYSFGII--GIIMLVG--WLLGKDILEMFTISVSLAVAAIPEGLPIVVTV 316
Cdd:cd02609 182 AAKLTLEAKKhklinSELLNSINKILK---FTSFIIIplGLLLFVEalFRRGGGWRQAVVSTVAALLGMIPEGLVLLTSV 258
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 317 TLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLhaevtgvgynqfgevivdgdvvhgf 396
Cdd:cd02609 259 ALAVGAIRLAKKKVLVQELYSIETLARVDVLCLDKTGTITEGKMKVERVEPLDEA------------------------- 313
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 397 YNPAVSRIVEAGCvcnDAVIRNNtlmgkPTEGALialamkmgLDGLQQD--YIRKAEYPFSSEQKWMAVkcvhrTQQDR- 473
Cdd:cd02609 314 NEAEAAAALAAFV---AASEDNN-----ATMQAI--------RAAFFGNnrFEVTSIIPFSSARKWSAV-----EFRDGg 372
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 474 ------PEIcFMKGAYEQVikycttyqskgqtltltQQQRDVYQQEkarmgsaGLRVLALASGPE-------LGQLTFLG 540
Cdd:cd02609 373 twvlgaPEV-LLGDLPSEV-----------------LSRVNELAAQ-------GYRVLLLARSAGaltheqlPVGLEPLA 427
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 541 LVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysktsqsvSGEEIDA-----MDVQQLSQIVPKVA 615
Cdd:cd02609 428 LILLTDPIRPEAKETLAYFAEQGVAVKVISGDNPVTVSAIAKRAGL--------EGAESYIdastlTTDEELAEAVENYT 499
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 616 VFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGI 695
Cdd:cd02609 500 VFGRVTPEQKRQLVQALQALGHTVAMTGDGVNDVLALKEADCSIAMA-SGSDATRQVAQVVLLDSDFSALPDVVFEGRRV 578
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 696 YNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRK----------PPRN 765
Cdd:cd02609 579 VNNIERVASLFLVKTIYSVLLALICVITALPFPFLPIQITLISLFTIGIPSFFLALEPNKRRIEGGflrrvltkalPPLN 658

                .
gi 48762685 766 W 766
Cdd:cd02609 659 R 659
ATPase-IB_hvy TIGR01525
heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the ...
84-731 4.23e-58

heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the copper and cadmium-type heavy metal transporting P-type ATPases (TIGR01511 and TIGR01512) as well as those species which score ambiguously between both models. For more comments and references, see the files on TIGR01511 and 01512.


Pssm-ID: 273669 [Multi-domain]  Cd Length: 558  Bit Score: 209.02  E-value: 4.23e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    84 IMLLLASAVI-SVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR-EGKLEHTLARDLVPGDTV 161
Cdd:TIGR01525   1 MDTLMALAAIaAYAMGLVLEGALLLFLFLLGETLEERAKSRASDALSALLALAPSTARVLQgDGSEEEVPVEELQVGDIV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   162 CLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSNIAFMGTLVRCGKAKGVVIGTGENSEF 241
Cdd:TIGR01525  81 IVRPGERIPVDGVVISGES-EVDESALTGESMPVEK--------------KEGDEVFAGTINGDGSLTIRVTKLGEDSTL 145
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   242 GEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALG 321
Cdd:TIGR01525 146 AQIVELVEEAQSSKAPIQRLADRIASYYVPAVLAIALLTFVVWLALGALWREALYRALTVLVVACPCALGLATPVAILVA 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   322 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHI-FTSDGLHAEVTGVgynqfgevivdgdvvhgfynpa 400
Cdd:TIGR01525 226 IGAAARRGILIKGGDALEKLAKVKTVVFDKTGTLTTGKPTVVDIePLDDASEEELLAL---------------------- 283
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   401 vsriveAGCvcndavirnntlMGKPTEGAlIALAMkmgldglqQDYIRKAEYPFSSEQkwmavkcvhrtQQDRPEiCFMK 480
Cdd:TIGR01525 284 ------AAA------------LEQSSSHP-LARAI--------VRYAKERGLELPPED-----------VEEVPG-KGVE 324
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   481 GAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELgqltfLGLVGIIDPPRTGVKEAVTTLI 560
Cdd:TIGR01525 325 ATVDGGREVRIGNPRFLGNRELAIEPISASPDLLNEGESQGKTVVFVAVDGEL-----LGVIALRDQLRPEAKEAIAALK 399
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   561 ASGV-SIKMITGDSQETAVAIASRLGLYSKtsqsvsgeeidamdvqqlsqivpkvaVFYRASPRHKMKIIKSLQKNGSVV 639
Cdd:TIGR01525 400 RAGGiKLVMLTGDNRSAAEAVAAELGIDDE--------------------------VHAELLPEDKLAIVKKLQEEGGPV 453
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   640 AMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NFVrfqlstsiAALTLIS 718
Cdd:TIGR01525 454 AMVGDGINDAPALAAADVGIAMG-SGSDVAIEAADIVLLNDDLRSLPTAIDLSRKTRRIIKqNLA--------WALGYNL 524
                         650
                  ....*....|....*.
gi 48762685   719 LA---TLMNFPNPLNA 731
Cdd:TIGR01525 525 VAiplAAGGLLPLWLA 540
ZntA COG2217
Cation transport ATPase [Inorganic ion transport and metabolism];
84-732 4.85e-56

Cation transport ATPase [Inorganic ion transport and metabolism];


Pssm-ID: 225127 [Multi-domain]  Cd Length: 713  Bit Score: 206.29  E-value: 4.85e-56
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  84 IMLLLASAVISVLMHQFDDAVSITVAILIVvtvAFVQEY---RSEKSLEELSKLVPPECHCVREGKLEHTL-ARDLVPGD 159
Cdd:COG2217 158 IGAYAYSLYATLFPVYFEEAAMLIFLFLLG---RYLEARakgRARRAIRALLDLAPKTATVVRGDGEEEEVpVEEVQVGD 234
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 160 TVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaaTNGDlasrsnIAFMGTLVRCGKAKGVVIGTGENS 239
Cdd:COG2217 235 IVLVRPGERIPVDGVVVSGSS-SVDESMLTGESLPVEK--------KPGD------EVFAGTVNLDGSLTIRVTRVGADT 299
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 240 EFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTL 318
Cdd:COG2217 300 TLARIIRLVEEAQSSKAPIQRLADRVASYFVPVVLVIAALTFALWPLFGGgDWETALYRALAVLVIACPCALGLATPTAI 379
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 319 ALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYN-------QFGEVIVDGD 391
Cdd:COG2217 380 LVGIGRAARRGILIKGGEALERLAKVDTVVFDKTGTLTEGKPEVTDVVALDGDEDELLALAAAleqhsehPLAKAIVKAA 459
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 392 VVHGfyNPAVSRIVE-AGC-----VCNDAVirnntLMGKPtegalialamkmgldglqqdyirkaeypfsseqKWMavkc 465
Cdd:COG2217 460 AERG--LPDVEDFEEiPGRgveaeVDGERV-----LVGNA---------------------------------RLL---- 495
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 466 vhrtQQDRPEICFMKGAYEQvikycttYQSKGQTltltqqqrdvyqqekarmgsaglrVLALASGPELgqltfLGLVGII 545
Cdd:COG2217 496 ----GEEGIDLPLLSERIEA-------LESEGKT------------------------VVFVAVDGKL-----VGVIALA 535
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 546 DPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGlysktsqsvsgeeIDAmdvqqlsqivpkvaVFYRASPRHK 625
Cdd:COG2217 536 DELRPDAKEAIAALKALGIKVVMLTGDNRRTAEAIAKELG-------------IDE--------------VRAELLPEDK 588
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 626 MKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NFVr 704
Cdd:COG2217 589 AEIVRELQAEGRKVAMVGDGINDAPALAAADVGIAMG-SGTDVAIEAADVVLMRDDLSAVPEAIDLSRATRRIIKqNLF- 666
                       650       660
                ....*....|....*....|....*...
gi 48762685 705 FQLSTSIAALTLislaTLMNFPNPLNAM 732
Cdd:COG2217 667 WAFGYNAIAIPL----AAGGLLTPWIAA 690
P-type_ATPase_HM cd02079
P-type heavy metal-transporting ATPase; Heavy metal-transporting ATPases (Type IB ATPases) ...
82-732 1.15e-53

P-type heavy metal-transporting ATPase; Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319774 [Multi-domain]  Cd Length: 617  Bit Score: 197.44  E-value: 1.15e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685  82 PLIMLLLASAVI-----SVLMHQ------FDDAVSITVAILIVvtvAFVQEY---RSEKSLEELSKLVPPECHCVREGKL 147
Cdd:cd02079  59 LNMDVLVSLAAIgafvaSLLTPLlggigyFEEAAMLLFLFLLG---RYLEERarsRARSALKALLSLAPETATVLEDGST 135
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 148 EHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKVTapqpaatnGDLAsrsniaFMGTLVRCGK 227
Cdd:cd02079 136 EEVPVDDLKVGDVVLVKPGERIPVDGVVVSGES-SVDESSLTGESLPVEKGA--------GDTV------FAGTINLNGP 200
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 228 AKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIP 307
Cdd:cd02079 201 LTIEVTKTGEDTTLAKIIRLVEEAQSSKPPLQRLADRFARYFTPAVLVLAALVFLFWPLVGGPPSLALYRALAVLVVACP 280
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 308 EGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEvtgvgynqfgEVI 387
Cdd:cd02079 281 CALGLATPTAIVAGIGRAARKGILIKGGDVLETLAKVDTVAFDKTGTLTEGKPEVTEIEPLEGFSED----------ELL 350
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 388 vdgdvvhgfynpAVSRIVEAGCvcndavirnntlmGKPtegalIALAMkmgldglqQDYIRKAEypfsseqkwmAVKCVH 467
Cdd:cd02079 351 ------------ALAAALEQHS-------------EHP-----LARAI--------VEAAEEKG----------LPPLEV 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 468 RTQQDRPEicfmKGAYEQVIkycttyqskGQTLTLTQQ---QRDVYQQEKARMGSAG-LRVLALASGPELgqltfLGLVG 543
Cdd:cd02079 383 EDVEEIPG----KGISGEVD---------GREVLIGSLsfaEEEGLVEAADALSDAGkTSAVYVGRDGKL-----VGLFA 444
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 544 IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSktsqsvsgeeidamdvqqlsqivpkvaVFYRASPR 623
Cdd:cd02079 445 LEDQLRPEAKEVIAELKSGGIKVVMLTGDNEAAAQAVAKELGIDE---------------------------VHAGLLPE 497
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 624 HKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQtGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NF 702
Cdd:cd02079 498 DKLAIVKALQAEGGPVAMVGDGINDAPALAQADVGIAMGS-GTDVAIETADIVLLSNDLSKLPDAIRLARRTRRIIKqNL 576
                       650       660       670
                ....*....|....*....|....*....|
gi 48762685 703 VrFQLSTSIAALTLislaTLMNFPNPLNAM 732
Cdd:cd02079 577 A-WALGYNAIALPL----AALGLLTPWIAA 601
ATPase-IB2_Cd TIGR01512
heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ...
86-731 2.09e-50

heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes. These transporters are found in prokaryotes and plants. Experimentally characterized members of the seed alignment include: SP|P37617 from E. coli, SP|Q10866 from Mycobacterium tuberculosis and SP|Q59998 from Synechocystis PCC6803. The cadmium P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the copper-ATPases (TIGR01511) are well separated, and thus we further type the copper-ATPases as IB1 and the cadmium-ATPases as IB2. Several sequences which have not been characterized experimentally fall just below trusted cutoff for both of these models (SP|Q9CCL1 from Mycobacterium leprae, GP|13816263 from Sulfolobus solfataricus, OMNI|NTL01CJ01098 from Campylobacter jejuni, OMNI|NTL01HS01687 from Halobacterium sp., GP|6899169 from Ureaplasma urealyticum and OMNI|HP1503 from Helicobacter pylori). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273665 [Multi-domain]  Cd Length: 550  Bit Score: 186.76  E-value: 2.09e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    86 LLLASAVISVLMHQFDDAVSItvaILIVVTVAFVQEY---RSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVC 162
Cdd:TIGR01512   4 LMALAALGAVAIGEYLEGALL---LLLFSIGETLEEYasgRARRALKALMELAPDTARRLQGDSLEEVAVEELKVGDVVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   163 LSVGDRVPADLRLfEAVDLSIDESSLTGETTPCSKvtapqpaatngdlaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFG 242
Cdd:TIGR01512  81 VKPGERVPVDGEV-LSGTSSVDESALTGESVPVEK--------------APGDEVFAGAINLDGVLTIEVTKLPADSTIA 145
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   243 EVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKD-ILEMFTISVSLAVAAIPEGLPIVVTVTLALG 321
Cdd:TIGR01512 146 KIVNLVEEAQSRKAPTQRFIDRFARYYTPAVLAIALAAALVPPLLGAGpFLEWIYRALVLLVVASPCALVISAPAAYLSA 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   322 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEvtgvgynqfgevivdgdvvhGFYNPAV 401
Cdd:TIGR01512 226 ISAAARHGILIKGGAALEALAKIKTVAFDKTGTLTTGKPKVTDVHPADGHSES--------------------EVLRLAA 285
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   402 SriVEAGCVcndavirnntlmgKPtegalIALAMkmgldglqQDYIRKAEYPFSSEQkwmavkcvhrtQQDRPEicfmKG 481
Cdd:TIGR01512 286 A--AEQGST-------------HP-----LARAI--------VDYARARELAPPVED-----------VEEVPG----EG 322
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   482 AYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQekarmgSAGLRVLALASGpelgqlTFLGLVGIIDPPRTGVKEAVTTLIA 561
Cdd:TIGR01512 323 VRAVVDGGEVRIGNPRSLSEAVGASIAVPES------AGKTIVLVARDG------TLLGYIALSDELRPDAAEAIAELKA 390
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   562 SGVS-IKMITGDSQETAVAIASRLGlysktsqsvsgeeIDamdvqqlsqivpkvAVFYRASPRHKMKIIKSLQKNGSVVA 640
Cdd:TIGR01512 391 LGIKrLVMLTGDRRAVAEAVARELG-------------ID--------------EVHAELLPEDKLEIVKELREKAGPVA 443
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   641 MTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFqlstSIAALTLISLA 720
Cdd:TIGR01512 444 MVGDGINDAPALAAADVGIAMGASGSDVALETADVVLLNDDLSRLPQAIRLARRTRRIIKQNVVI----ALGIILVLILL 519
                         650
                  ....*....|.
gi 48762685   721 TLMNFPNPLNA 731
Cdd:TIGR01512 520 ALFGVLPLWLA 530
P-type_ATPase_Cu-like cd07552
P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+) ...
128-733 8.51e-49

P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+)-ATPase; Archaeoglobus fulgidus CopB transports Cu(2+) from the cytoplasm to the exterior of the cell using ATP as energy source, it transports preferentially Cu(2+) over Cu(+), it is activated by Cu(2+) with high affinity and partially by Cu(+) and Ag(+). This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319850 [Multi-domain]  Cd Length: 632  Bit Score: 183.66  E-value: 8.51e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 128 LEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAvDLSIDESSLTGETTPCSKVTAPQ--PAA 205
Cdd:cd07552 122 LKKLAELLPKTAHLVTDGSIEDVPVSELKVGDVVLVRAGEKIPADGTILEG-ESSVNESMVTGESKPVEKKPGDEviGGS 200
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 206 TNGDlasrsniafmGTL-VRcgkakgvVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLsFYSFGIIGIIMLVG 284
Cdd:cd07552 201 VNGN----------GTLeVK-------VTKTGEDSYLSQVMELVAQAQASKSRAENLADKVAGWL-FYIALGVGIIAFII 262
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 285 WLLGKDILEMFTISVSLAVAAIPEGL----PIVVTVTLALGVMR--MVKKRaivKKLPIVETLgccNVICSDKTGTLTKN 358
Cdd:cd07552 263 WLILGDLAFALERAVTVLVIACPHALglaiPLVVARSTSIAAKNglLIRNR---EALERARDI---DVVLFDKTGTLTEG 336
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 359 EMTVTHIFTSDGLHAEvtgvgynqfgEVI-----VDGDVVHgfynPAVSRIVEAgcvcndavirnntlmgkptegalial 433
Cdd:cd07552 337 KFGVTDVITFDEYDED----------EILslaaaLEAGSEH----PLAQAIVSA-------------------------- 376
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 434 amkmgldgLQQdyiRKAEYPFSSEQKWMAVKCVHRTQQDRpeicfmkgayeqvikyctTYQSKGQTLtLTQQQRDVYQQE 513
Cdd:cd07552 377 --------AKE---KGIRPVEVENFENIPGVGVEGTVNGK------------------RYQVVSPKY-LKELGLKYDEEL 426
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 514 KARMGSAGLRVLALASGPELgqltfLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSktsqs 593
Cdd:cd07552 427 VKRLAQQGNTVSFLIQDGEV-----IGAIALGDEIKPESKEAIRALKAQGITPVMLTGDNEEVAQAVAEELGIDE----- 496
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685 594 vsgeeidamdvqqlsqivpkvaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAA 673
Cdd:cd07552 497 ----------------------YFAEVLPEDKAKKVKELQAEGKKVAMVGDGVNDAPALAQADVGIAIG-AGTDVAIESA 553
                       570       580       590       600       610       620       630
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 48762685 674 DMILVDDDFQTIMSAIEEGKGIYNNIK---------NFVRFQLSTSIAALTLISL-----ATLMNFPN---PLNAMQ 733
Cdd:cd07552 554 DVVLVKSDPRDIVDFLELAKATYRKMKqnlwwgagyNVIAIPLAAGVLAPIGIILspavgAVLMSLSTvivAINAMT 630
E1-E2_ATPase pfam00122
E1-E2 ATPase;
136-328 1.50e-48

E1-E2 ATPase;


Pssm-ID: 333857 [Multi-domain]  Cd Length: 178  Bit Score: 170.05  E-value: 1.50e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   136 PPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSN 215
Cdd:pfam00122   1 PPTATVLRDGTEEEIPADELVPGDIVLLKPGERVPADGRIVEGSA-SVDESALTGESLPVEK--------------EKGD 65
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685   216 IAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMF 295
Cdd:pfam00122  66 MVFSGTVVVSGSAKAVVTATGEDTELGKIARLVEEAKSKKTPLQRLLDKLAKYFTPVVLLLALAVFLLWLFVGGPPLEAL 145
                         170       180       190
                  ....*....|....*....|....*....|...
gi 48762685   296 TISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 328
Cdd:pfam00122 146 LRALALLVAACPCALPLATPLALALGARRLAKK 178
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
43-869 3.76e-48

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 185.65  E-value: 3.76e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685     43 QNGLNKCEVSHRRAFHGWNEFDI---SEDEPLWKkyisQFKNPLIMLLLASaVISVLMHQFDDAVSITVAILIVVTVAFV 119
Cdd:TIGR01657  137 SNGLTTGDIAQRKAKYGKNEIEIpvpSFLELLKE----EVLHPFYVFQVFS-VILWLLDEYYYYSLCIVFMSSTSISLSV 211
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    120 QEYRseKSLEELSKLV-PPECHCV-REGKLEHTLARDLVPGDtvCLSVGDR----VPADLRLFEAvDLSIDESSLTGETT 193
Cdd:TIGR01657  212 YQIR--KQMQRLRDMVhKPQSVIViRNGKWVTIASDELVPGD--IVSIPRPeektMPCDSVLLSG-SCIVNESMLTGESV 286
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    194 PCSKVTAPQPAATNGDLA----SRSNIAFMGTLV-------RCGKAKGVVIGTGENSEFGE-VFKMMQAEEAPKTPLQKS 261
Cdd:TIGR01657  287 PVLKFPIPDNGDDDEDLFlyetSKKHVLFGGTKIlqirpypGDTGCLAIVVRTGFSTSKGQlVRSILYPKPRVFKFYKDS 366
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    262 MDLLGKQLSFYSFGIIGIImLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMvKKRAIVKKLPI-VET 340
Cdd:TIGR01657  367 FKFILFLAVLALIGFIYTI-IELIKDGRPLGKIILRSLDIITIVVPPALPAELSIGINNSLARL-KKKGIFCTSPFrINF 444
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    341 LGCCNVICSDKTGTLTknemtvthiftSDGLHAE-VTGVGYNQFGEVIVDGDVvhgfyNPAVSRIVEAGCVCNDAVIRNN 419
Cdd:TIGR01657  445 AGKIDVCCFDKTGTLT-----------EDGLDLRgVQGLSGNQEFLKIVTEDS-----SLKPSITHKALATCHSLTKLEG 508
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    420 TLMGKPTEGAL-------------------IALAMKMGLDGLQQDYIRKaeYPFSSEQKWMAVKCvhRTQQDRPEICFMK 480
Cdd:TIGR01657  509 KLVGDPLDKKMfeatgwtleeddesaeptsILAVVRTDDPPQELSIIRR--FQFSSALQRMSVIV--STNDERSPDAFVK 584
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    481 GAYEQVIKYCttyqsKGQTLtltqqQRDvYQQEKARMGSAGLRVLALASGPeLGQ-----------------LTFLGLVG 543
Cdd:TIGR01657  585 GAPETIQSLC-----SPETV-----PSD-YQEVLKSYTREGYRVLALAYKE-LPKltlqkaqdlsrdavesnLTFLGFIV 652
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    544 IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK---------------------------TSQSVSG 596
Cdd:TIGR01657  653 FENPLKPDTKEVIKELKRASIRTVMITGDNPLTAVHVARECGIVNPsntlilaeaeppesgkpnqikfevidsIPFASTQ 732
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48762685    597 EEID-----------------------------AMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVN 647
Cdd:TIGR01657  733 VEIPyplgqdsvedllasryhlamsgkafavlqAHSPELLLRLLSHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGAN 812