NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|365823348|ref|NP_045689.2|]
View 

outer surface protein B (plasmid) [Borrelia burgdorferi B31]

Protein Classification

similar to outer surface protein A (domain architecture ID 10467087)

protein similar to outer surface protein A

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Lipoprotein_1 pfam00820
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
42-296 1.47e-127

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


:

Pssm-ID: 307114  Cd Length: 259  Bit Score: 367.93  E-value: 1.47e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348   42 HQNAKQDLPAVTEDSVSLFNGNKIFVSKEKNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNT 121
Cdd:pfam00820   1 HNNAKQDLPASMEDSVSLFNGNKIFVSKEKNADGKYDLIATIDALELKGTSDKNNGSGTLEGSKADASKVKLTISADLGQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  122 VTLEAFDASNQK-ISSKVTKKQGSITEETL-KANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGG 199
Cdd:pfam00820  81 TTLEAFDADGQKlISKKVTKKGGSITEEKIiDAGIIDEKIITRADGTRLEYSGITDADGAGKAKETLKGSIKLEGSLTAE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  200 KTTVEIKEGTVTLKREIEKDGKVKVFLNDT--AGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTS 277
Cdd:pfam00820 161 KTTLEIKEGTVTLKKEIEKDGEVKVELNDTdsAAANKKTAAWEDGTSTLTISADSKKTKDLVFLSDGTITVQQYDSAGTS 240
                         250
                  ....*....|....*....
gi 365823348  278 LEGSASEIKNLSELKNALK 296
Cdd:pfam00820 241 LEGSASEIKKLDEIKNALK 259
 
Name Accession Description Interval E-value
Lipoprotein_1 pfam00820
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
42-296 1.47e-127

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


Pssm-ID: 307114  Cd Length: 259  Bit Score: 367.93  E-value: 1.47e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348   42 HQNAKQDLPAVTEDSVSLFNGNKIFVSKEKNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNT 121
Cdd:pfam00820   1 HNNAKQDLPASMEDSVSLFNGNKIFVSKEKNADGKYDLIATIDALELKGTSDKNNGSGTLEGSKADASKVKLTISADLGQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  122 VTLEAFDASNQK-ISSKVTKKQGSITEETL-KANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGG 199
Cdd:pfam00820  81 TTLEAFDADGQKlISKKVTKKGGSITEEKIiDAGIIDEKIITRADGTRLEYSGITDADGAGKAKETLKGSIKLEGSLTAE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  200 KTTVEIKEGTVTLKREIEKDGKVKVFLNDT--AGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTS 277
Cdd:pfam00820 161 KTTLEIKEGTVTLKKEIEKDGEVKVELNDTdsAAANKKTAAWEDGTSTLTISADSKKTKDLVFLSDGTITVQQYDSAGTS 240
                         250
                  ....*....|....*....
gi 365823348  278 LEGSASEIKNLSELKNALK 296
Cdd:pfam00820 241 LEGSASEIKKLDEIKNALK 259
 
Name Accession Description Interval E-value
Lipoprotein_1 pfam00820
Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The ...
42-296 1.47e-127

Borrelia lipoprotein; This family of lipoproteins is found in Borrelia spirochetes. The function of these proteins is uncertain.


Pssm-ID: 307114  Cd Length: 259  Bit Score: 367.93  E-value: 1.47e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348   42 HQNAKQDLPAVTEDSVSLFNGNKIFVSKEKNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLNT 121
Cdd:pfam00820   1 HNNAKQDLPASMEDSVSLFNGNKIFVSKEKNADGKYDLIATIDALELKGTSDKNNGSGTLEGSKADASKVKLTISADLGQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  122 VTLEAFDASNQK-ISSKVTKKQGSITEETL-KANKLDSKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVGG 199
Cdd:pfam00820  81 TTLEAFDADGQKlISKKVTKKGGSITEEKIiDAGIIDEKIITRADGTRLEYSGITDADGAGKAKETLKGSIKLEGSLTAE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 365823348  200 KTTVEIKEGTVTLKREIEKDGKVKVFLNDT--AGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTS 277
Cdd:pfam00820 161 KTTLEIKEGTVTLKKEIEKDGEVKVELNDTdsAAANKKTAAWEDGTSTLTISADSKKTKDLVFLSDGTITVQQYDSAGTS 240
                         250
                  ....*....|....*....
gi 365823348  278 LEGSASEIKNLSELKNALK 296
Cdd:pfam00820 241 LEGSASEIKKLDEIKNALK 259
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH