NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|398366163|ref|NP_013515.3|]
View 

high-affinity Cu transporter CTR3 [Saccharomyces cerevisiae S288C]

Protein Classification

Ctr domain-containing protein (domain architecture ID 10514254)

Ctr domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ctr pfam04145
Ctr copper transporter family; The redox active metal copper is an essential cofactor in ...
20-210 4.07e-37

Ctr copper transporter family; The redox active metal copper is an essential cofactor in critical biological processes such as respiration, iron transport, oxidative stress protection, hormone production, and pigmentation. A widely conserved family of high-affinity copper transport proteins (Ctr proteins) mediates copper uptake at the plasma membrane. A series of clustered methionine residues in the hydrophilic extracellular domain, and an MXXXM motif in the second transmembrane domain, are important for copper uptake. These methionine probably coordinate copper during the process of metal transport.


:

Pssm-ID: 309321  Cd Length: 149  Bit Score: 130.09  E-value: 4.07e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   20 MLWNWYTIDTcFIARSWRNDTKGKFAGSCIGCFALVVVAQWL----TRFSRQFDVELLKRQKIKHLASYSPEEYvvkcge 95
Cdd:pfam04145   1 MLFNWSTIDT-LLFKSWHPTSGGAFAGSCIGLFLLAVLYEFLralrARLEREWDRHLARFARGASRSQGAAASA------ 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   96 edaksdieelqgfynepswkttlislqksfiysfyvwGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFldHMIRVTIFV 175
Cdd:pfam04145  74 -------------------------------------ADASDVSGSGSEESSVNLANDANPPPPFRPSP--DLIRALLHT 114
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 398366163  176 LQWGLSYIIMLLFMYYNGYIIISCLIGAIVGRFIF 210
Cdd:pfam04145 115 VQVGLGYILMLAVMTYNGYIILSVLLGAFLGYFLF 149
 
Name Accession Description Interval E-value
Ctr pfam04145
Ctr copper transporter family; The redox active metal copper is an essential cofactor in ...
20-210 4.07e-37

Ctr copper transporter family; The redox active metal copper is an essential cofactor in critical biological processes such as respiration, iron transport, oxidative stress protection, hormone production, and pigmentation. A widely conserved family of high-affinity copper transport proteins (Ctr proteins) mediates copper uptake at the plasma membrane. A series of clustered methionine residues in the hydrophilic extracellular domain, and an MXXXM motif in the second transmembrane domain, are important for copper uptake. These methionine probably coordinate copper during the process of metal transport.


Pssm-ID: 309321  Cd Length: 149  Bit Score: 130.09  E-value: 4.07e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   20 MLWNWYTIDTcFIARSWRNDTKGKFAGSCIGCFALVVVAQWL----TRFSRQFDVELLKRQKIKHLASYSPEEYvvkcge 95
Cdd:pfam04145   1 MLFNWSTIDT-LLFKSWHPTSGGAFAGSCIGLFLLAVLYEFLralrARLEREWDRHLARFARGASRSQGAAASA------ 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   96 edaksdieelqgfynepswkttlislqksfiysfyvwGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFldHMIRVTIFV 175
Cdd:pfam04145  74 -------------------------------------ADASDVSGSGSEESSVNLANDANPPPPFRPSP--DLIRALLHT 114
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 398366163  176 LQWGLSYIIMLLFMYYNGYIIISCLIGAIVGRFIF 210
Cdd:pfam04145 115 VQVGLGYILMLAVMTYNGYIILSVLLGAFLGYFLF 149
 
Name Accession Description Interval E-value
Ctr pfam04145
Ctr copper transporter family; The redox active metal copper is an essential cofactor in ...
20-210 4.07e-37

Ctr copper transporter family; The redox active metal copper is an essential cofactor in critical biological processes such as respiration, iron transport, oxidative stress protection, hormone production, and pigmentation. A widely conserved family of high-affinity copper transport proteins (Ctr proteins) mediates copper uptake at the plasma membrane. A series of clustered methionine residues in the hydrophilic extracellular domain, and an MXXXM motif in the second transmembrane domain, are important for copper uptake. These methionine probably coordinate copper during the process of metal transport.


Pssm-ID: 309321  Cd Length: 149  Bit Score: 130.09  E-value: 4.07e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   20 MLWNWYTIDTcFIARSWRNDTKGKFAGSCIGCFALVVVAQWL----TRFSRQFDVELLKRQKIKHLASYSPEEYvvkcge 95
Cdd:pfam04145   1 MLFNWSTIDT-LLFKSWHPTSGGAFAGSCIGLFLLAVLYEFLralrARLEREWDRHLARFARGASRSQGAAASA------ 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 398366163   96 edaksdieelqgfynepswkttlislqksfiysfyvwGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFldHMIRVTIFV 175
Cdd:pfam04145  74 -------------------------------------ADASDVSGSGSEESSVNLANDANPPPPFRPSP--DLIRALLHT 114
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 398366163  176 LQWGLSYIIMLLFMYYNGYIIISCLIGAIVGRFIF 210
Cdd:pfam04145 115 VQVGLGYILMLAVMTYNGYIILSVLLGAFLGYFLF 149
DUF2935 pfam11155
Domain of unknown function (DUF2935); This family of proteins with unknown function appears to ...
144-170 8.72e-04

Domain of unknown function (DUF2935); This family of proteins with unknown function appears to be restricted to Firmicutes. The structure of this protein has been solved and each domain is composed of four alpha helices. A metal cluster composed of iron and magnesium lies between the two domains.


Pssm-ID: 314158  Cd Length: 121  Bit Score: 37.97  E-value: 8.72e-04
                          10        20
                  ....*....|....*....|....*..
gi 398366163  144 LLKKVLSCCTLITpvdLYPTFLDHMIR 170
Cdd:pfam11155  88 LLELILSCKIFSI---LYPLLLDHMLR 111
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH