NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4506813|ref|NP_002968.1|]
View 

sodium channel protein type 9 subunit alpha [Homo sapiens]

Protein Classification

Na_trans_assoc and Ion_trans domain-containing protein (domain architecture ID 11999295)

protein containing domains Na_trans_cytopl, Na_trans_assoc, Ion_trans, and Na_channel_gate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
488-670 3.17e-76

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


:

Pssm-ID: 314757  Cd Length: 164  Bit Score: 253.50  E-value: 3.17e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     488 LSSGEEKGDAEKLSKSESEDSIRRKSFHLGVegHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSE 567
Cdd:pfam11933    5 KSEGEEKGDDEKFPKSESDDSIRRKGFRFSV--DRLAYKKKVSSPHQSLLSIPGSPFSPRRNSRGSIFSFRGRGRDAGSE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     568 TEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSP---PMLPVNGKMHSAVDcngvvslvdgrsalmlpngql 644
Cdd:pfam11933   83 NDFADDENSTFEESESRRGSLFVPRRNGERRSSYTSQASRSSrshPGLPQNGKRNSTVD--------------------- 141
                          170       180
                   ....*....|....*....|....*..
gi 4506813     645 lpegTTNQIH-KKRRCSSYLLSEDMLN 670
Cdd:pfam11933  142 ----TTTESElRKRRSSSKQLSMDYLE 164
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
971-1176 2.00e-65

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


:

Pssm-ID: 310839  Cd Length: 195  Bit Score: 223.74  E-value: 2.00e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     971 DPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTlaemskghnflkekdkisg 1050
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDFCHRPCLRPPPPVKKPLSSLKAARSKENHIANHT------------------- 61
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1051 fGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSD-SDSEYSKVR-------LNRSSSSECSTVDNP 1122
Cdd:pfam06512   62 -ATGPEAPRELEDDHLDFITNPNLTVSVPIAEGESDLENEEDDDEDSQsSDEEKSKQSqeqlqeeLDDSSSSEGSTVDLQ 140
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 4506813    1123 LPGEGEEAEAEPM-NSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYK 1176
Cdd:pfam06512  141 DPEEELEKIPEEAeELEEPEDCFTEGCVRRFPCCAVDITKGPWKIWWNLRKTCYR 195
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1180-1455 1.46e-61

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 214.05  E-value: 1.46e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1180 HSWFESFIVLMILLSSGALAFEDIYIERKKTiKIILEYADKIFTYIFILEMLLKWIAYGY-KTYFTNAWCWLDFLIVDVS 1258
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1259 LVTLVANTlgYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYE 1338
Cdd:pfam00520   80 LISLVLSS--VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1339 CINTTDGsrfpasqvpnrsecfalmnvsqnvrwknlKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSvnvdkqpkyEY 1418
Cdd:pfam00520  158 WENPDNG-----------------------------RTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KG 199
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 4506813    1419 SLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKK 1455
Cdd:pfam00520  200 EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1503-1759 7.37e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 200.57  E-value: 7.37e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1503 NQAFDISIMVLICLNMVTMMVEKEGQSQH-MTEVLYWINVVFIILFTGECVLKLISLR--HYYFTVGWNIFDFVVVIISI 1579
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1580 VGMFLadlieTYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV- 1658
Cdd:pfam00520   81 ISLVL-----SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1659 -KKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPpdcdpkkvhpgssvegdcgnPSVGIFYFVSYIIISF 1737
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG--------------------EFWAYIYFVSFIILGG 215
                          250       260
                   ....*....|....*....|..
gi 4506813    1738 LVVVNMYIAVILENFSVATEES 1759
Cdd:pfam00520  216 FLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
732-945 3.30e-53

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 190.17  E-value: 3.30e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     732 DPFVDLAITICIVLNTLFMAMEHHPMTEE-FKNVLAIGNLVFTGIFAAEMVLKLIAMDP-YEYFQVGWNIFDSLIVTLSL 809
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     810 VELFLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVC 886
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWEN 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     887 KINddctlPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVYMMVMVIGN 945
Cdd:pfam00520  161 PDN-----GRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
125-410 1.60e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 182.47  E-value: 1.60e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     125 HSLFSMLIMCTILTNCIFMTMNNPP-------DWTKNVEYTFTGIYTFESLVKILARGFCvgeFTFLRDPWNWLDFVVIV 197
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFqpeepltTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     198 FAYLT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLkh 273
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     274 kcfrnslennetlesimntleseedfrkyfyylegskdallcgfstdsgqcpegytcvKIGRNPDYGYTSFDTFSWAFLA 353
Cdd:pfam00520  156 ----------------------------------------------------------KTWENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 4506813     354 LFRLMTQDYWENLYQQTLRAAGKTYM-IFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1447-1499 3.04e-30

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 117.67  E-value: 3.04e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 4506813  1447 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFD 1499
Cdd:cd13433    1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
GPHH super family cl25190
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1763-1826 2.26e-05

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


The actual alignment was detected with superfamily member pfam16905:

Pssm-ID: 318993  Cd Length: 71  Bit Score: 45.68  E-value: 2.26e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4506813    1763 LSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAK--PNKV---QLIAMDLPMVSGDRIH 1826
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARVaykRLIRMNMPVDEDNTVH 70
 
Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
488-670 3.17e-76

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 314757  Cd Length: 164  Bit Score: 253.50  E-value: 3.17e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     488 LSSGEEKGDAEKLSKSESEDSIRRKSFHLGVegHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSE 567
Cdd:pfam11933    5 KSEGEEKGDDEKFPKSESDDSIRRKGFRFSV--DRLAYKKKVSSPHQSLLSIPGSPFSPRRNSRGSIFSFRGRGRDAGSE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     568 TEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSP---PMLPVNGKMHSAVDcngvvslvdgrsalmlpngql 644
Cdd:pfam11933   83 NDFADDENSTFEESESRRGSLFVPRRNGERRSSYTSQASRSSrshPGLPQNGKRNSTVD--------------------- 141
                          170       180
                   ....*....|....*....|....*..
gi 4506813     645 lpegTTNQIH-KKRRCSSYLLSEDMLN 670
Cdd:pfam11933  142 ----TTTESElRKRRSSSKQLSMDYLE 164
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
971-1176 2.00e-65

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 310839  Cd Length: 195  Bit Score: 223.74  E-value: 2.00e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     971 DPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTlaemskghnflkekdkisg 1050
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDFCHRPCLRPPPPVKKPLSSLKAARSKENHIANHT------------------- 61
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1051 fGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSD-SDSEYSKVR-------LNRSSSSECSTVDNP 1122
Cdd:pfam06512   62 -ATGPEAPRELEDDHLDFITNPNLTVSVPIAEGESDLENEEDDDEDSQsSDEEKSKQSqeqlqeeLDDSSSSEGSTVDLQ 140
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 4506813    1123 LPGEGEEAEAEPM-NSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYK 1176
Cdd:pfam06512  141 DPEEELEKIPEEAeELEEPEDCFTEGCVRRFPCCAVDITKGPWKIWWNLRKTCYR 195
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1180-1455 1.46e-61

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 214.05  E-value: 1.46e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1180 HSWFESFIVLMILLSSGALAFEDIYIERKKTiKIILEYADKIFTYIFILEMLLKWIAYGY-KTYFTNAWCWLDFLIVDVS 1258
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1259 LVTLVANTlgYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYE 1338
Cdd:pfam00520   80 LISLVLSS--VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1339 CINTTDGsrfpasqvpnrsecfalmnvsqnvrwknlKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSvnvdkqpkyEY 1418
Cdd:pfam00520  158 WENPDNG-----------------------------RTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KG 199
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 4506813    1419 SLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKK 1455
Cdd:pfam00520  200 EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1503-1759 7.37e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 200.57  E-value: 7.37e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1503 NQAFDISIMVLICLNMVTMMVEKEGQSQH-MTEVLYWINVVFIILFTGECVLKLISLR--HYYFTVGWNIFDFVVVIISI 1579
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1580 VGMFLadlieTYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV- 1658
Cdd:pfam00520   81 ISLVL-----SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1659 -KKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPpdcdpkkvhpgssvegdcgnPSVGIFYFVSYIIISF 1737
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG--------------------EFWAYIYFVSFIILGG 215
                          250       260
                   ....*....|....*....|..
gi 4506813    1738 LVVVNMYIAVILENFSVATEES 1759
Cdd:pfam00520  216 FLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
732-945 3.30e-53

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 190.17  E-value: 3.30e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     732 DPFVDLAITICIVLNTLFMAMEHHPMTEE-FKNVLAIGNLVFTGIFAAEMVLKLIAMDP-YEYFQVGWNIFDSLIVTLSL 809
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     810 VELFLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVC 886
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWEN 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     887 KINddctlPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVYMMVMVIGN 945
Cdd:pfam00520  161 PDN-----GRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
125-410 1.60e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 182.47  E-value: 1.60e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     125 HSLFSMLIMCTILTNCIFMTMNNPP-------DWTKNVEYTFTGIYTFESLVKILARGFCvgeFTFLRDPWNWLDFVVIV 197
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFqpeepltTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     198 FAYLT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLkh 273
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     274 kcfrnslennetlesimntleseedfrkyfyylegskdallcgfstdsgqcpegytcvKIGRNPDYGYTSFDTFSWAFLA 353
Cdd:pfam00520  156 ----------------------------------------------------------KTWENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 4506813     354 LFRLMTQDYWENLYQQTLRAAGKTYM-IFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1447-1499 3.04e-30

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 117.67  E-value: 3.04e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 4506813  1447 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFD 1499
Cdd:cd13433    1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1763-1826 2.26e-05

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 318993  Cd Length: 71  Bit Score: 45.68  E-value: 2.26e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4506813    1763 LSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAK--PNKV---QLIAMDLPMVSGDRIH 1826
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARVaykRLIRMNMPVDEDNTVH 70
 
Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
488-670 3.17e-76

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 314757  Cd Length: 164  Bit Score: 253.50  E-value: 3.17e-76
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     488 LSSGEEKGDAEKLSKSESEDSIRRKSFHLGVegHRRAHEKRLSTPNQSPLSIRGSLFSARRSSRTSLFSFKGRGRDIGSE 567
Cdd:pfam11933    5 KSEGEEKGDDEKFPKSESDDSIRRKGFRFSV--DRLAYKKKVSSPHQSLLSIPGSPFSPRRNSRGSIFSFRGRGRDAGSE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     568 TEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSP---PMLPVNGKMHSAVDcngvvslvdgrsalmlpngql 644
Cdd:pfam11933   83 NDFADDENSTFEESESRRGSLFVPRRNGERRSSYTSQASRSSrshPGLPQNGKRNSTVD--------------------- 141
                          170       180
                   ....*....|....*....|....*..
gi 4506813     645 lpegTTNQIH-KKRRCSSYLLSEDMLN 670
Cdd:pfam11933  142 ----TTTESElRKRRSSSKQLSMDYLE 164
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
971-1176 2.00e-65

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 310839  Cd Length: 195  Bit Score: 223.74  E-value: 2.00e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     971 DPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKISREIRQAEDLNTKKENYISNHTlaemskghnflkekdkisg 1050
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRNLRDFCHRPCLRPPPPVKKPLSSLKAARSKENHIANHT------------------- 61
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1051 fGSSVDKHLMEDSDGQSFIHNPSLTVTVPIAPGESDLENMNAEELSSD-SDSEYSKVR-------LNRSSSSECSTVDNP 1122
Cdd:pfam06512   62 -ATGPEAPRELEDDHLDFITNPNLTVSVPIAEGESDLENEEDDDEDSQsSDEEKSKQSqeqlqeeLDDSSSSEGSTVDLQ 140
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 4506813    1123 LPGEGEEAEAEPM-NSDEPEACFTDGCVRRFSCCQVNIESGKGKIWWNIRKTCYK 1176
Cdd:pfam06512  141 DPEEELEKIPEEAeELEEPEDCFTEGCVRRFPCCAVDITKGPWKIWWNLRKTCYR 195
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1180-1455 1.46e-61

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 214.05  E-value: 1.46e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1180 HSWFESFIVLMILLSSGALAFEDIYIERKKTiKIILEYADKIFTYIFILEMLLKWIAYGY-KTYFTNAWCWLDFLIVDVS 1258
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPL-TTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1259 LVTLVANTlgYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYE 1338
Cdd:pfam00520   80 LISLVLSS--VGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1339 CINTTDGsrfpasqvpnrsecfalmnvsqnvrwknlKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSvnvdkqpkyEY 1418
Cdd:pfam00520  158 WENPDNG-----------------------------RTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDG---------KG 199
                          250       260       270
                   ....*....|....*....|....*....|....*..
gi 4506813    1419 SLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKK 1455
Cdd:pfam00520  200 EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1503-1759 7.37e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 200.57  E-value: 7.37e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1503 NQAFDISIMVLICLNMVTMMVEKEGQSQH-MTEVLYWINVVFIILFTGECVLKLISLR--HYYFTVGWNIFDFVVVIISI 1579
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1580 VGMFLadlieTYFVSPTLFRVIRLARIGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV- 1658
Cdd:pfam00520   81 ISLVL-----SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKl 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1659 -KKEDGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPpdcdpkkvhpgssvegdcgnPSVGIFYFVSYIIISF 1737
Cdd:pfam00520  156 kTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG--------------------EFWAYIYFVSFIILGG 215
                          250       260
                   ....*....|....*....|..
gi 4506813    1738 LVVVNMYIAVILENFSVATEES 1759
Cdd:pfam00520  216 FLLLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
732-945 3.30e-53

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 190.17  E-value: 3.30e-53
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     732 DPFVDLAITICIVLNTLFMAMEHHPMTEE-FKNVLAIGNLVFTGIFAAEMVLKLIAMDP-YEYFQVGWNIFDSLIVTLSL 809
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     810 VELFLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVC 886
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTWEN 160
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     887 KINddctlPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVYMMVMVIGN 945
Cdd:pfam00520  161 PDN-----GRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
125-410 1.60e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 182.47  E-value: 1.60e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     125 HSLFSMLIMCTILTNCIFMTMNNPP-------DWTKNVEYTFTGIYTFESLVKILARGFCvgeFTFLRDPWNWLDFVVIV 197
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFqpeepltTVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     198 FAYLT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLkh 273
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813     274 kcfrnslennetlesimntleseedfrkyfyylegskdallcgfstdsgqcpegytcvKIGRNPDYGYTSFDTFSWAFLA 353
Cdd:pfam00520  156 ----------------------------------------------------------KTWENPDNGRTNFDNFPNAFLW 177
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 4506813     354 LFRLMTQDYWENLYQQTLRAAGKTYM-IFFVVVIFLGSFYLINLILAVVAMAYEEQNQ 410
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1447-1499 3.04e-30

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 117.67  E-value: 3.04e-30
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....
gi 4506813  1447 DNFNQQKKKLGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKIQGCIFD 1499
Cdd:cd13433    1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1535-1753 3.32e-07

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 285288  Cd Length: 426  Bit Score: 54.66  E-value: 3.32e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1535 VLYWINVVFIILFTGECVLKLISLRHYYFTVGWNIFDFVVVIISIVGM-------FLAD-LIETYFVSPTLF----RVIR 1602
Cdd:pfam08016  213 LCEVVFLVFFLYFVVAEILKIRYHRPHYLRSVWNLLDLAIVVLSVVLIvlniyrdFLADrLIKSVEASPVTFidfdRVAQ 292
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1603 LARIGRI-------LRLVKGAKGIR---TL-LF--ALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAyvkkedgiNDMFN 1669
Cdd:pfam08016  293 LDNAYRIilafllfLTWVKLFKVLRfnkTMsLFtkTLSRALKDLAGFALMFVIFFFAYAQLGYLLFG--------TQVDN 364
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4506813    1670 FETFGNSMICLFQITTSA-GWDGLlapilnskppdcdpkkvhpgssvegDCGNPSVGIFYFVSYIIISFLVVVNMYIAVI 1748
Cdd:pfam08016  365 FSNFIKSILTLFRTICGAfGYNEI-------------------------FSGNRVLGPLLFLTLVFLVIFILLNLFLAII 419

                   ....*
gi 4506813    1749 LENFS 1753
Cdd:pfam08016  420 NDSYV 424
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1763-1826 2.26e-05

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 318993  Cd Length: 71  Bit Score: 45.68  E-value: 2.26e-05
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4506813    1763 LSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAK--PNKV---QLIAMDLPMVSGDRIH 1826
Cdd:pfam16905    2 LGPHHLDEFVRAWAEYDPAATGRIHYTDMYLLLRHIEPPLGFGKkcPARVaykRLIRMNMPVDEDNTVH 70
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH