NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|145701025|ref|NP_001401.2|]
View 

multiple epidermal growth factor-like domains protein 8 isoform 2 precursor [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
49-139 3.02e-23

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


:

Pssm-ID: 238001  Cd Length: 113  Bit Score: 99.79  E-value: 3.02e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025   49 GNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLLHLFS 124
Cdd:cd00041    20 NNYPNNLNCVWTIEAP-PGYRIRLTFEDFDLEsspnCSYDYLEIYDGPSTSSPLLGRFCGSTLPPPIISSGNSLTVRFRS 98
                          90
                  ....*....|....*
gi 145701025  125 DANYNLLGFNASFRF 139
Cdd:cd00041    99 DSSVTGRGFKATYSA 113
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1143-1192 2.07e-10

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


:

Pssm-ID: 238012  Cd Length: 50  Bit Score: 60.83  E-value: 2.07e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 145701025 1143 PCQCNGHGDpRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSC 1192
Cdd:cd00055     1 PCDCNGHGS-LSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologs. This family includes ...
1011-1045 1.81e-05

EGF domain; This family includes a variety of EGF-like domain homologs. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


:

Pssm-ID: 315598  Cd Length: 36  Bit Score: 45.98  E-value: 1.81e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 145701025  1011 CRLGLARCHPRATCLNTPLSYECHCQRGYQGDGIS 1045
Cdd:pfam12947    1 CSDNNGGCHPNATCTNTDGSFTCTCNDGYTGDGVT 35
Kelch_3 pfam13415
Galactose oxidase, central domain;
1566-1613 2.17e-04

Galactose oxidase, central domain;


:

Pssm-ID: 315978  Cd Length: 48  Bit Score: 43.04  E-value: 2.17e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025  1566 LLLVGGYSPENGFNQQLLEYQLATGTWvsgAQSGTPPTGLYGHSAVYH 1613
Cdd:pfam13415    4 LYIFGGLGGGGTRLNDLYVYDLDTNTW---TQIGDLPPPRAGHSATVI 48
PLN02193 super family cl26061
nitrile-specifier protein
1713-1791 7.52e-04

nitrile-specifier protein


The actual alignment was detected with superfamily member PLN02153:

Pssm-ID: 330882  Cd Length: 341  Bit Score: 44.21  E-value: 7.52e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025 1713 KEPRPRLFHASALLGDTMVVLGGRSDPDE-FSSDVLLYQVNCNAWLLPdltrSASVGPPMEESVAHAVAAVGSRLYISGG 1791
Cdd:PLN02153   18 KGPGPRCSHGIAVVGDKLYSFGGELKPNEhIDKDLYVFDFNTHTWSIA----PANGDVPRISCLGVRMVAVGTKLYIFGG 93
Kelch_3 pfam13415
Galactose oxidase, central domain;
240-286 4.99e-03

Galactose oxidase, central domain;


:

Pssm-ID: 315978  Cd Length: 48  Bit Score: 38.80  E-value: 4.99e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025   240 GLLAVFGGQDLNN-ALGDLVLYNFSANTWESwdLSPAPAARHSHVAVA 286
Cdd:pfam13415    2 NKLYIFGGLGGGGtRLNDLYVYDLDTNTWTQ--IGDLPPPRAGHSATV 47
PLN02193 super family cl26061
nitrile-specifier protein
337-465 5.17e-03

nitrile-specifier protein


The actual alignment was detected with superfamily member PLN02153:

Pssm-ID: 330882  Cd Length: 341  Bit Score: 41.51  E-value: 5.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025  337 HAAALVDDVwLYVSGGR-TPHDLFSSGLFRFRLDSTSggyWeQVIPAGGRPPAATGHSMVFHAPSRALLVHGGhRPSTAR 415
Cdd:PLN02153   26 HGIAVVGDK-LYSFGGElKPNEHIDKDLYVFDFNTHT---W-SIAPANGDVPRISCLGVRMVAVGTKLYIFGG-RDEKRE 99
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 145701025  416 FSvrvnstELFHVD--RHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGG 465
Cdd:PLN02153  100 FS------DFYSYDtvKNEWTFLTKLDEEGGPEARTFHSMASDENHVYVFGG 145
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
883-931 6.75e-03

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


:

Pssm-ID: 307546  Cd Length: 53  Bit Score: 38.48  E-value: 6.75e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 145701025   883 CSQRLTCEDCL-ANSSQCAWCQSTHTCFLFAAYlARYPHGGCRGWDDSVH 931
Cdd:pfam01437    2 CSQYTSCSSCLaARDPYCGWCSSEGRCVRRSAC-PGAPEGNCEEWEQASS 50
 
Name Accession Description Interval E-value
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
49-139 3.02e-23

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 99.79  E-value: 3.02e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025   49 GNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLLHLFS 124
Cdd:cd00041    20 NNYPNNLNCVWTIEAP-PGYRIRLTFEDFDLEsspnCSYDYLEIYDGPSTSSPLLGRFCGSTLPPPIISSGNSLTVRFRS 98
                          90
                  ....*....|....*
gi 145701025  125 DANYNLLGFNASFRF 139
Cdd:cd00041    99 DSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
49-137 9.00e-21

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 92.07  E-value: 9.00e-21
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025     49 GNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSG-KMLLHLF 123
Cdd:smart00042   10 QSYPNNLDCVWTIRAP-PGYRIELQFTDFDLEssdnCEYDYVEIYDGPSASSPLLGRFCGSEAPPPVISSSSnSLTLTFV 88
                            90
                    ....*....|....
gi 145701025    124 SDANYNLLGFNASF 137
Cdd:smart00042   89 SDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
30-137 3.48e-19

CUB domain;


Pssm-ID: 278839  Cd Length: 110  Bit Score: 87.74  E-value: 3.48e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025    30 CKGqrqVLREAPG--FVTDGAGNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLS 103
Cdd:pfam00431    1 CGG---VLTDSSGsiSSPNYPNPYPPNKDCVWLIRAP-PGFRVKLTFQDFELEdhdeCGYDYVEIRDGPSASSPLLGRFC 76
                           90       100       110
                   ....*....|....*....|....*....|....
gi 145701025   104 GSTRPPPIEASSGKMLLHLFSDANYNLLGFNASF 137
Cdd:pfam00431   77 GSGIPEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1143-1192 2.07e-10

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 60.83  E-value: 2.07e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 145701025 1143 PCQCNGHGDpRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSC 1192
Cdd:cd00055     1 PCDCNGHGS-LSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1144-1192 4.00e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 278482  Cd Length: 49  Bit Score: 53.90  E-value: 4.00e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 145701025  1144 CQCNGHGDPRrGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRA-GGSC 1192
Cdd:pfam00053    1 CDCNPHGSLS-DTCDPETGQCLCKPGVTGRHCDRCKPGYYGLPSDpPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1144-1189 1.05e-05

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 46.92  E-value: 1.05e-05
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 145701025   1144 CQCNGHGDpRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAG 1189
Cdd:smart00180    1 CDCDPGGS-ASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPG 45
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologs. This family includes ...
1011-1045 1.81e-05

EGF domain; This family includes a variety of EGF-like domain homologs. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


Pssm-ID: 315598  Cd Length: 36  Bit Score: 45.98  E-value: 1.81e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 145701025  1011 CRLGLARCHPRATCLNTPLSYECHCQRGYQGDGIS 1045
Cdd:pfam12947    1 CSDNNGGCHPNATCTNTDGSFTCTCNDGYTGDGVT 35
Kelch_3 pfam13415
Galactose oxidase, central domain;
1566-1613 2.17e-04

Galactose oxidase, central domain;


Pssm-ID: 315978  Cd Length: 48  Bit Score: 43.04  E-value: 2.17e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025  1566 LLLVGGYSPENGFNQQLLEYQLATGTWvsgAQSGTPPTGLYGHSAVYH 1613
Cdd:pfam13415    4 LYIFGGLGGGGTRLNDLYVYDLDTNTW---TQIGDLPPPRAGHSATVI 48
EGF_CA smart00179
Calcium-binding EGF-like domain;
1007-1040 5.18e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 41.85  E-value: 5.18e-04
                            10        20        30
                    ....*....|....*....|....*....|....
gi 145701025   1007 DVDECRLGlARCHPRATCLNTPLSYECHCQRGYQ 1040
Cdd:smart00179    1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYT 33
PLN02153 PLN02153
epithiospecifier protein
1713-1791 7.52e-04

epithiospecifier protein


Pssm-ID: 177814  Cd Length: 341  Bit Score: 44.21  E-value: 7.52e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025 1713 KEPRPRLFHASALLGDTMVVLGGRSDPDE-FSSDVLLYQVNCNAWLLPdltrSASVGPPMEESVAHAVAAVGSRLYISGG 1791
Cdd:PLN02153   18 KGPGPRCSHGIAVVGDKLYSFGGELKPNEhIDKDLYVFDFNTHTWSIA----PANGDVPRISCLGVRMVAVGTKLYIFGG 93
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1007-1042 8.73e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.08  E-value: 8.73e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 145701025 1007 DVDECRLGlARCHPRATCLNTPLSYECHCQRGYQGD 1042
Cdd:cd00054     1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGR 35
Kelch_3 pfam13415
Galactose oxidase, central domain;
240-286 4.99e-03

Galactose oxidase, central domain;


Pssm-ID: 315978  Cd Length: 48  Bit Score: 38.80  E-value: 4.99e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025   240 GLLAVFGGQDLNN-ALGDLVLYNFSANTWESwdLSPAPAARHSHVAVA 286
Cdd:pfam13415    2 NKLYIFGGLGGGGtRLNDLYVYDLDTNTWTQ--IGDLPPPRAGHSATV 47
PLN02153 PLN02153
epithiospecifier protein
337-465 5.17e-03

epithiospecifier protein


Pssm-ID: 177814  Cd Length: 341  Bit Score: 41.51  E-value: 5.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025  337 HAAALVDDVwLYVSGGR-TPHDLFSSGLFRFRLDSTSggyWeQVIPAGGRPPAATGHSMVFHAPSRALLVHGGhRPSTAR 415
Cdd:PLN02153   26 HGIAVVGDK-LYSFGGElKPNEHIDKDLYVFDFNTHT---W-SIAPANGDVPRISCLGVRMVAVGTKLYIFGG-RDEKRE 99
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 145701025  416 FSvrvnstELFHVD--RHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGG 465
Cdd:PLN02153  100 FS------DFYSYDtvKNEWTFLTKLDEEGGPEARTFHSMASDENHVYVFGG 145
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
883-931 6.75e-03

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


Pssm-ID: 307546  Cd Length: 53  Bit Score: 38.48  E-value: 6.75e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 145701025   883 CSQRLTCEDCL-ANSSQCAWCQSTHTCFLFAAYlARYPHGGCRGWDDSVH 931
Cdd:pfam01437    2 CSQYTSCSSCLaARDPYCGWCSSEGRCVRRSAC-PGAPEGNCEEWEQASS 50
 
Name Accession Description Interval E-value
CUB cd00041
CUB domain; extracellular domain; present in proteins mostly known to be involved in ...
49-139 3.02e-23

CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.


Pssm-ID: 238001  Cd Length: 113  Bit Score: 99.79  E-value: 3.02e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025   49 GNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLLHLFS 124
Cdd:cd00041    20 NNYPNNLNCVWTIEAP-PGYRIRLTFEDFDLEsspnCSYDYLEIYDGPSTSSPLLGRFCGSTLPPPIISSGNSLTVRFRS 98
                          90
                  ....*....|....*
gi 145701025  125 DANYNLLGFNASFRF 139
Cdd:cd00041    99 DSSVTGRGFKATYSA 113
CUB smart00042
Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found ...
49-137 9.00e-21

Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein; This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.


Pssm-ID: 214483  Cd Length: 102  Bit Score: 92.07  E-value: 9.00e-21
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025     49 GNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSG-KMLLHLF 123
Cdd:smart00042   10 QSYPNNLDCVWTIRAP-PGYRIELQFTDFDLEssdnCEYDYVEIYDGPSASSPLLGRFCGSEAPPPVISSSSnSLTLTFV 88
                            90
                    ....*....|....
gi 145701025    124 SDANYNLLGFNASF 137
Cdd:smart00042   89 SDSSVQKRGFSARY 102
CUB pfam00431
CUB domain;
30-137 3.48e-19

CUB domain;


Pssm-ID: 278839  Cd Length: 110  Bit Score: 87.74  E-value: 3.48e-19
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025    30 CKGqrqVLREAPG--FVTDGAGNYSVNGNCEWLIEAPsPQHRILLDFLFLDTE----CTYDYLFVYDGDSPRGPLLASLS 103
Cdd:pfam00431    1 CGG---VLTDSSGsiSSPNYPNPYPPNKDCVWLIRAP-PGFRVKLTFQDFELEdhdeCGYDYVEIRDGPSASSPLLGRFC 76
                           90       100       110
                   ....*....|....*....|....*....|....
gi 145701025   104 GSTRPPPIEASSGKMLLHLFSDANYNLLGFNASF 137
Cdd:pfam00431   77 GSGIPEDIVSSSNQMTIKFVSDASVQKRGFKATY 110
EGF_Lam cd00055
Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous ...
1143-1192 2.07e-10

Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies


Pssm-ID: 238012  Cd Length: 50  Bit Score: 60.83  E-value: 2.07e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 145701025 1143 PCQCNGHGDpRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSC 1192
Cdd:cd00055     1 PCDCNGHGS-LSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQGGGC 49
Laminin_EGF pfam00053
Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.
1144-1192 4.00e-08

Laminin EGF domain; This family is like pfam00008 but has 8 conserved cysteines instead of six.


Pssm-ID: 278482  Cd Length: 49  Bit Score: 53.90  E-value: 4.00e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 145701025  1144 CQCNGHGDPRrGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRA-GGSC 1192
Cdd:pfam00053    1 CDCNPHGSLS-DTCDPETGQCLCKPGVTGRHCDRCKPGYYGLPSDpPQGC 49
EGF_Lam smart00180
Laminin-type epidermal growth factor-like domai;
1144-1189 1.05e-05

Laminin-type epidermal growth factor-like domai;


Pssm-ID: 214543  Cd Length: 46  Bit Score: 46.92  E-value: 1.05e-05
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*.
gi 145701025   1144 CQCNGHGDpRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAG 1189
Cdd:smart00180    1 CDCDPGGS-ASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPG 45
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologs. This family includes ...
1011-1045 1.81e-05

EGF domain; This family includes a variety of EGF-like domain homologs. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


Pssm-ID: 315598  Cd Length: 36  Bit Score: 45.98  E-value: 1.81e-05
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 145701025  1011 CRLGLARCHPRATCLNTPLSYECHCQRGYQGDGIS 1045
Cdd:pfam12947    1 CSDNNGGCHPNATCTNTDGSFTCTCNDGYTGDGVT 35
Kelch_3 pfam13415
Galactose oxidase, central domain;
1566-1613 2.17e-04

Galactose oxidase, central domain;


Pssm-ID: 315978  Cd Length: 48  Bit Score: 43.04  E-value: 2.17e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025  1566 LLLVGGYSPENGFNQQLLEYQLATGTWvsgAQSGTPPTGLYGHSAVYH 1613
Cdd:pfam13415    4 LYIFGGLGGGGTRLNDLYVYDLDTNTW---TQIGDLPPPRAGHSATVI 48
EGF_CA smart00179
Calcium-binding EGF-like domain;
1007-1040 5.18e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 41.85  E-value: 5.18e-04
                            10        20        30
                    ....*....|....*....|....*....|....
gi 145701025   1007 DVDECRLGlARCHPRATCLNTPLSYECHCQRGYQ 1040
Cdd:smart00179    1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYT 33
PLN02153 PLN02153
epithiospecifier protein
1713-1791 7.52e-04

epithiospecifier protein


Pssm-ID: 177814  Cd Length: 341  Bit Score: 44.21  E-value: 7.52e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025 1713 KEPRPRLFHASALLGDTMVVLGGRSDPDE-FSSDVLLYQVNCNAWLLPdltrSASVGPPMEESVAHAVAAVGSRLYISGG 1791
Cdd:PLN02153   18 KGPGPRCSHGIAVVGDKLYSFGGELKPNEhIDKDLYVFDFNTHTWSIA----PANGDVPRISCLGVRMVAVGTKLYIFGG 93
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1007-1042 8.73e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.08  E-value: 8.73e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 145701025 1007 DVDECRLGlARCHPRATCLNTPLSYECHCQRGYQGD 1042
Cdd:cd00054     1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGR 35
EGF_CA pfam07645
Calcium-binding EGF domain;
1007-1046 4.93e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 38.87  E-value: 4.93e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 145701025  1007 DVDECRLGLARCHPRATCLNTPLSYECHCQRGYQGDGISH 1046
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYENNEDGT 40
Kelch_3 pfam13415
Galactose oxidase, central domain;
240-286 4.99e-03

Galactose oxidase, central domain;


Pssm-ID: 315978  Cd Length: 48  Bit Score: 38.80  E-value: 4.99e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 145701025   240 GLLAVFGGQDLNN-ALGDLVLYNFSANTWESwdLSPAPAARHSHVAVA 286
Cdd:pfam13415    2 NKLYIFGGLGGGGtRLNDLYVYDLDTNTWTQ--IGDLPPPRAGHSATV 47
PLN02153 PLN02153
epithiospecifier protein
337-465 5.17e-03

epithiospecifier protein


Pssm-ID: 177814  Cd Length: 341  Bit Score: 41.51  E-value: 5.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145701025  337 HAAALVDDVwLYVSGGR-TPHDLFSSGLFRFRLDSTSggyWeQVIPAGGRPPAATGHSMVFHAPSRALLVHGGhRPSTAR 415
Cdd:PLN02153   26 HGIAVVGDK-LYSFGGElKPNEHIDKDLYVFDFNTHT---W-SIAPANGDVPRISCLGVRMVAVGTKLYIFGG-RDEKRE 99
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 145701025  416 FSvrvnstELFHVD--RHVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGG 465
Cdd:PLN02153  100 FS------DFYSYDtvKNEWTFLTKLDEEGGPEARTFHSMASDENHVYVFGG 145
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
883-931 6.75e-03

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


Pssm-ID: 307546  Cd Length: 53  Bit Score: 38.48  E-value: 6.75e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 145701025   883 CSQRLTCEDCL-ANSSQCAWCQSTHTCFLFAAYlARYPHGGCRGWDDSVH 931
Cdd:pfam01437    2 CSQYTSCSSCLaARDPYCGWCSSEGRCVRRSAC-PGAPEGNCEEWEQASS 50
Kelch_4 pfam13418
Galactose oxidase, central domain;
227-276 7.48e-03

Galactose oxidase, central domain;


Pssm-ID: 315981  Cd Length: 49  Bit Score: 38.35  E-value: 7.48e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 145701025   227 ARIGAAgAFLSPPGLLAVFGGQDLNN-ALGDLVLYNFSANTWESwdLSPAP 276
Cdd:pfam13418    1 PRAGHT-STSIPDDTLYLFGGEGEKGkLLSDLWVFDLSTNTWTR--LGSLP 48
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH