NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1387629617|ref|NP_001350022.1|]
View 

probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 isoform 3 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PLN02607 super family cl30162
1-aminocyclopropane-1-carboxylate synthase
9-352 5.38e-62

1-aminocyclopropane-1-carboxylate synthase


The actual alignment was detected with superfamily member PLN02607:

Pssm-ID: 215327  Cd Length: 447  Bit Score: 204.35  E-value: 5.38e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVHLESqv 88
Cdd:PLN02607   99 SFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDS-- 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prSNldSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPS-- 166
Cdd:PLN02607  177 --SN--NFQVTPQALEAAYQEAEAANIRVRGVLITNPSNPLGATVQRSVLEDILDFVVRKNIHLVSDEIYSGSVFSASef 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 VTFHSVLSIKDLPDP-NMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWiSKV 245
Cdd:PLN02607  253 VSVAEIVEARGYKGVaERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLVSSQTQHLLASMLSDEEF-TEN 331
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFDQEQILHQR-FRDKKLLLSSGKSYMCIEPGW 324
Cdd:PLN02607  332 YIRTNRERLRKRYEMIVQGLRRAGIECLKGNAGLFCWMNLSPLLETPTREGELALWDSiLREVKLNISPGSSCHCSEPGW 411
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 325 FRLVFAETHLH-LQVAMDRFcHVLAEHKK 352
Cdd:PLN02607  412 FRVCFANMSEDtLEVALKRI-HRFMDRRK 439
 
Name Accession Description Interval E-value
PLN02607 PLN02607
1-aminocyclopropane-1-carboxylate synthase
9-352 5.38e-62

1-aminocyclopropane-1-carboxylate synthase


Pssm-ID: 215327  Cd Length: 447  Bit Score: 204.35  E-value: 5.38e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVHLESqv 88
Cdd:PLN02607   99 SFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDS-- 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prSNldSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPS-- 166
Cdd:PLN02607  177 --SN--NFQVTPQALEAAYQEAEAANIRVRGVLITNPSNPLGATVQRSVLEDILDFVVRKNIHLVSDEIYSGSVFSASef 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 VTFHSVLSIKDLPDP-NMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWiSKV 245
Cdd:PLN02607  253 VSVAEIVEARGYKGVaERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLVSSQTQHLLASMLSDEEF-TEN 331
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFDQEQILHQR-FRDKKLLLSSGKSYMCIEPGW 324
Cdd:PLN02607  332 YIRTNRERLRKRYEMIVQGLRRAGIECLKGNAGLFCWMNLSPLLETPTREGELALWDSiLREVKLNISPGSSCHCSEPGW 411
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 325 FRLVFAETHLH-LQVAMDRFcHVLAEHKK 352
Cdd:PLN02607  412 FRVCFANMSEDtLEVALKRI-HRFMDRRK 439
AAT_like cd00609
Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
9-343 1.72e-49

Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. The major groups in this CD corresponds to Aspartate aminotransferase a, b and c, Tyrosine, Alanine, Aromatic-amino-acid, Glutamine phenylpyruvate, 1-Aminocyclopropane-1-carboxylate synthase, Histidinol-phosphate, gene products of malY and cobC, Valine-pyruvate aminotransferase and Rhizopine catabolism regulatory protein.


Pssm-ID: 99734 [Multi-domain]  Cd Length: 350  Bit Score: 169.06  E-value: 1.72e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKapTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYsKIELIPVHLESQv 88
Cdd:cd00609    40 ELREAIAEWLGRRGG--VDVPPEEIVVTNGAQEALSLLLRALLNPGDEVLVPDPTYPGYEAAARLA-GAEVVPVPLDEE- 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prsnlDSFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVt 168
Cdd:cd00609   116 -----GGFLLDLELLEAAKTPKTK------LLYLNNPNNPTGAVLSEEELEELAELAKKHGILIISDEAYAELVYDGEP- 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 169 fHSVLSIKDLPDPnmTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAF--GYHHGVSGITQYKLCRLLQDKEwiskVY 246
Cdd:cd00609   184 -PPALALLDAYER--VIVLRSFSKTFGLPGLRIGYLIAPPEELLERLKKLlpYTTSGPSTLSQAAAAAALDDGE----EH 256
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 247 LPKNHSRLQKAYSYITKILKDLKIPFYNGGSG-LFVWINLKAYLSpctfdqEQILHQRFRDKKLLLSSGKSYMCIEPGWF 325
Cdd:cd00609   257 LEELRERYRRRRDALLEALKELGPLVVVKPSGgFFLWLDLPEGDD------EEFLERLLLEAGVVVRPGSAFGEGGEGFV 330
                         330
                  ....*....|....*...
gi 1387629617 326 RLVFAETHLHLQVAMDRF 343
Cdd:cd00609   331 RLSFATPEEELEEALERL 348
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
9-347 5.02e-41

Aminotransferase class I and II;


Pssm-ID: 333884 [Multi-domain]  Cd Length: 357  Bit Score: 147.09  E-value: 5.02e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFltHYCKAPTPLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPcyngfVFSSHL----YSKIELIPVH 83
Cdd:pfam00155  43 ELREALAKF--LGRSPVLKLDPERaVVFGSGAGANIEALIFLLANPGDAILVPAP-----TYPSYIriarLAGGEVVPYP 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  84 LESQvprsnlDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF 163
Cdd:pfam00155 116 LYSS------NDFHLDFDALEAALKEAPEGNIKTKVVLHTSPHNPTGTVAPLEELEKLLDLAKEHNILLLVDEAYAGFVF 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 164 EPSVTFHSVLSIKDLPDpnmTHMIWGTSKDFGMSGIRFGVLYThNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWIS 243
Cdd:pfam00155 190 GSLDAVAIRALLAEGPN---LLVVGSFSKAFGLAGWRVGYILG-NAAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVA 265
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 244 KvYLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFdqeQILHQRFrdkKLLLSSGKSYMCiePG 323
Cdd:pfam00155 266 S-ELEEMRQRIKKRRDYLRDGLEAAGLSVLPSQAGFFLLTGLDPETAKELA---QVLLEEV---GVYVTPGSSPGV--PG 336
                         330       340
                  ....*....|....*....|....
gi 1387629617 324 WFRLVFAethLHLQVAMDRFCHVL 347
Cdd:pfam00155 337 WLRITVA---GGTEEELEELLEAI 357
AspB COG0436
Aspartate/methionine/tyrosine aminotransferase [Amino acid transport and metabolism];
9-351 1.09e-35

Aspartate/methionine/tyrosine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 223513 [Multi-domain]  Cd Length: 393  Bit Score: 133.55  E-value: 1.09e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPtpLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLyskIELIPVHLESQ 87
Cdd:COG0436    69 ELREAIAEKYKRRYGLD--VDPEEeIIVTAGAKEALFLAFLALLNPGDEVLIPDPGYPSYEAAVKL---AGGKPVPVPLD 143
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  88 VPRSNldsFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSV 167
Cdd:COG0436   144 EEENG---FKPDLEDLEAAITPKTK------AIILNSPNNPTGAVYSKEELKAIVELAREHDIIIISDEIYEELVYDGAE 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 168 tFHSVLSIKDLPDpnMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAF-GYH-HGVSGITQYKLCRLLQDkeWISKV 245
Cdd:COG0436   215 -HPSILELAGARD--RTITINSFSKTYGMTGWRIGWVVGPPEELIAALRKLkSYLtSCAPTPAQYAAIAALNG--PQSDE 289
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLK-IPFYNGGSG-LFVWINLKAYLSPCTFdQEQILHQrfrdKKLLLSSGKSY-MCIEP 322
Cdd:COG0436   290 VVEEMREEYRERRDLLVEALNEIGgLSVVKPPEGaFYLFPKIPELLDSEEF-AKKLLEE----AGVAVVPGSGFgEPPGE 364
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 323 GWFRLVFAETHLHLQVAMDRFCHVLAEHK 351
Cdd:COG0436   365 GYVRLSLATSEETLEEALRRLARFLAEYR 393
tyr_nico_aTase TIGR01265
tyrosine/nicotianamine family aminotransferase; This subfamily of pyridoxal ...
11-344 9.01e-20

tyrosine/nicotianamine family aminotransferase; This subfamily of pyridoxal phosphate-dependent enzymes includes known examples of both tyrosine aminotransferase from animals and nicotianamine aminotransferase from barley.


Pssm-ID: 188123  Cd Length: 403  Bit Score: 89.32  E-value: 9.01e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLThyCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPcynGFVFSSHL--YSKIELIPVHL--ES 86
Cdd:TIGR01265  79 REAVAEYLS--SDLPGKLTADDVVLTSGCSQAIEICIEALANPGANILVPRP---GFPLYDTRaaFSGLEVRLYDLlpEK 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 QVpRSNLDSFQLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFePS 166
Cdd:TIGR01265 154 DW-EIDLDGLESLADEKTVAI-------------VVINPSNPCGSVFSRDHLQKIAEVAEKLGIPIIADEIYGHMVF-GD 218
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 VTFHSVLSIKDLPdPNMThmIWGTSKDFGMSGIRFGVLYTHN------KEVASAMKAF-GYHHGVSGITQYKLCRLLQDK 239
Cdd:TIGR01265 219 APFIPMASFASIV-PVLS--LGGISKRWVVPGWRLGWIIIHDphgifrDTVLQGLKNLlQRILGPATIVQGALPDILENT 295
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 240 EwisKVYLPKNHSRLQKAYSYITKILKD---LKIPFYNGGSGLFVWINLKAYlsPCTFDQEQILHQRFRDKKLLLSSGKs 316
Cdd:TIGR01265 296 P---QEFFDGKISVLKSNAELCYEELKDipgLVCPKPEGAMYLMVKLELELF--PEIKDDVDFCEKLAREESVICLPGS- 369
                         330       340       350
                  ....*....|....*....|....*....|..
gi 1387629617 317 ymCIE-PGWFRLVFAETHLHLQVAMDR---FC 344
Cdd:TIGR01265 370 --AFGlPNWVRITITVPESMLEEACSRikeFC 399
 
Name Accession Description Interval E-value
PLN02607 PLN02607
1-aminocyclopropane-1-carboxylate synthase
9-352 5.38e-62

1-aminocyclopropane-1-carboxylate synthase


Pssm-ID: 215327  Cd Length: 447  Bit Score: 204.35  E-value: 5.38e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVHLESqv 88
Cdd:PLN02607   99 SFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDS-- 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prSNldSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPS-- 166
Cdd:PLN02607  177 --SN--NFQVTPQALEAAYQEAEAANIRVRGVLITNPSNPLGATVQRSVLEDILDFVVRKNIHLVSDEIYSGSVFSASef 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 VTFHSVLSIKDLPDP-NMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWiSKV 245
Cdd:PLN02607  253 VSVAEIVEARGYKGVaERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLVSSQTQHLLASMLSDEEF-TEN 331
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFDQEQILHQR-FRDKKLLLSSGKSYMCIEPGW 324
Cdd:PLN02607  332 YIRTNRERLRKRYEMIVQGLRRAGIECLKGNAGLFCWMNLSPLLETPTREGELALWDSiLREVKLNISPGSSCHCSEPGW 411
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 325 FRLVFAETHLH-LQVAMDRFcHVLAEHKK 352
Cdd:PLN02607  412 FRVCFANMSEDtLEVALKRI-HRFMDRRK 439
PLN02450 PLN02450
1-aminocyclopropane-1-carboxylate synthase
9-342 7.29e-58

1-aminocyclopropane-1-carboxylate synthase


Pssm-ID: 178069  Cd Length: 468  Bit Score: 194.20  E-value: 7.29e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVHLESqv 88
Cdd:PLN02450   90 AFKNALAEFMSEIRGNKVTFDPNKLVLTAGATSANETLMFCLAEPGDAFLLPTPYYPGFDRDLKWRTGVEIVPIHCSS-- 167
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prSNldSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEpSVT 168
Cdd:PLN02450  168 --SN--GFQITESALEEAYQQAQKLNLKVKGVLITNPSNPLGTTTTRTELNLLVDFITAKNIHLISDEIYSGTVFD-SPG 242
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 169 FHSVLSI---KDLPDP---NMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASA---MKAFGYhhgVSGITQYKLCRLLQDK 239
Cdd:PLN02450  243 FVSVMEVlkdRKLENTdvsNRVHIVYSLSKDLGLPGFRVGAIYSNDEMVVSAatkMSSFGL---VSSQTQYLLSALLSDK 319
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 240 EWiSKVYLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFDQEQILHQRF-RDKKLLLSSGKSYM 318
Cdd:PLN02450  320 KF-TKNYLEENQKRLKQRQKKLVSGLEAAGIKCLKSNAGLFCWVDMRHLLKSNTFEAEMELWKKIvYEVKLNISPGSSCH 398
                         330       340
                  ....*....|....*....|....*...
gi 1387629617 319 CIEPGWFRLVFA----EThlhLQVAMDR 342
Cdd:PLN02450  399 CTEPGWFRVCFAnmseET---LDLAMKR 423
AAT_like cd00609
Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent ...
9-343 1.72e-49

Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. The major groups in this CD corresponds to Aspartate aminotransferase a, b and c, Tyrosine, Alanine, Aromatic-amino-acid, Glutamine phenylpyruvate, 1-Aminocyclopropane-1-carboxylate synthase, Histidinol-phosphate, gene products of malY and cobC, Valine-pyruvate aminotransferase and Rhizopine catabolism regulatory protein.


Pssm-ID: 99734 [Multi-domain]  Cd Length: 350  Bit Score: 169.06  E-value: 1.72e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKapTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYsKIELIPVHLESQv 88
Cdd:cd00609    40 ELREAIAEWLGRRGG--VDVPPEEIVVTNGAQEALSLLLRALLNPGDEVLVPDPTYPGYEAAARLA-GAEVVPVPLDEE- 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prsnlDSFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVt 168
Cdd:cd00609   116 -----GGFLLDLELLEAAKTPKTK------LLYLNNPNNPTGAVLSEEELEELAELAKKHGILIISDEAYAELVYDGEP- 183
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 169 fHSVLSIKDLPDPnmTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAF--GYHHGVSGITQYKLCRLLQDKEwiskVY 246
Cdd:cd00609   184 -PPALALLDAYER--VIVLRSFSKTFGLPGLRIGYLIAPPEELLERLKKLlpYTTSGPSTLSQAAAAAALDDGE----EH 256
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 247 LPKNHSRLQKAYSYITKILKDLKIPFYNGGSG-LFVWINLKAYLSpctfdqEQILHQRFRDKKLLLSSGKSYMCIEPGWF 325
Cdd:cd00609   257 LEELRERYRRRRDALLEALKELGPLVVVKPSGgFFLWLDLPEGDD------EEFLERLLLEAGVVVRPGSAFGEGGEGFV 330
                         330
                  ....*....|....*...
gi 1387629617 326 RLVFAETHLHLQVAMDRF 343
Cdd:cd00609   331 RLSFATPEEELEEALERL 348
PLN02376 PLN02376
1-aminocyclopropane-1-carboxylate synthase
10-351 2.06e-49

1-aminocyclopropane-1-carboxylate synthase


Pssm-ID: 178004  Cd Length: 496  Bit Score: 172.57  E-value: 2.06e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVhlesqvP 89
Cdd:PLN02376   99 FRQAIAHFMGKARGGKVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDLRWRTGVEIIPV------P 172
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  90 RSNLDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPS--V 167
Cdd:PLN02376  173 CSSSDNFKLTVDAADWAYKKAQESNKKVKGLILTNPSNPLGTMLDKDTLTNLVRFVTRKNIHLVVDEIYAATVFAGGdfV 252
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 168 TFHSVLSIKDLPDPN--MTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWISKv 245
Cdd:PLN02376  253 SVAEVVNDVDISEVNvdLIHIVYSLSKDMGLPGFRVGIVYSFNDSVVSCARKMSSFGLVSSQTQLMLASMLSDDQFVDN- 331
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSP-CTFDQE-QILHQRFRDKKLLLSSGKSYMCIEPG 323
Cdd:PLN02376  332 FLMESSRRLGIRHKVFTTGIKKADIACLTSNAGLFAWMDLRHLLRDrNSFESEiELWHIIIDKVKLNVSPGSSFRCTEPG 411
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 324 WFRLVFAETHLH-LQVAMDRFCHVLAEHK 351
Cdd:PLN02376  412 WFRICFANMDDDtLHVALGRIQDFVSKNK 440
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
9-347 5.02e-41

Aminotransferase class I and II;


Pssm-ID: 333884 [Multi-domain]  Cd Length: 357  Bit Score: 147.09  E-value: 5.02e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFltHYCKAPTPLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPcyngfVFSSHL----YSKIELIPVH 83
Cdd:pfam00155  43 ELREALAKF--LGRSPVLKLDPERaVVFGSGAGANIEALIFLLANPGDAILVPAP-----TYPSYIriarLAGGEVVPYP 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  84 LESQvprsnlDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF 163
Cdd:pfam00155 116 LYSS------NDFHLDFDALEAALKEAPEGNIKTKVVLHTSPHNPTGTVAPLEELEKLLDLAKEHNILLLVDEAYAGFVF 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 164 EPSVTFHSVLSIKDLPDpnmTHMIWGTSKDFGMSGIRFGVLYThNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWIS 243
Cdd:pfam00155 190 GSLDAVAIRALLAEGPN---LLVVGSFSKAFGLAGWRVGYILG-NAAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVA 265
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 244 KvYLPKNHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYLSPCTFdqeQILHQRFrdkKLLLSSGKSYMCiePG 323
Cdd:pfam00155 266 S-ELEEMRQRIKKRRDYLRDGLEAAGLSVLPSQAGFFLLTGLDPETAKELA---QVLLEEV---GVYVTPGSSPGV--PG 336
                         330       340
                  ....*....|....*....|....
gi 1387629617 324 WFRLVFAethLHLQVAMDRFCHVL 347
Cdd:pfam00155 337 WLRITVA---GGTEEELEELLEAI 357
AspB COG0436
Aspartate/methionine/tyrosine aminotransferase [Amino acid transport and metabolism];
9-351 1.09e-35

Aspartate/methionine/tyrosine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 223513 [Multi-domain]  Cd Length: 393  Bit Score: 133.55  E-value: 1.09e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPtpLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLyskIELIPVHLESQ 87
Cdd:COG0436    69 ELREAIAEKYKRRYGLD--VDPEEeIIVTAGAKEALFLAFLALLNPGDEVLIPDPGYPSYEAAVKL---AGGKPVPVPLD 143
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  88 VPRSNldsFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSV 167
Cdd:COG0436   144 EEENG---FKPDLEDLEAAITPKTK------AIILNSPNNPTGAVYSKEELKAIVELAREHDIIIISDEIYEELVYDGAE 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 168 tFHSVLSIKDLPDpnMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAF-GYH-HGVSGITQYKLCRLLQDkeWISKV 245
Cdd:COG0436   215 -HPSILELAGARD--RTITINSFSKTYGMTGWRIGWVVGPPEELIAALRKLkSYLtSCAPTPAQYAAIAALNG--PQSDE 289
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 246 YLPKNHSRLQKAYSYITKILKDLK-IPFYNGGSG-LFVWINLKAYLSPCTFdQEQILHQrfrdKKLLLSSGKSY-MCIEP 322
Cdd:COG0436   290 VVEEMREEYRERRDLLVEALNEIGgLSVVKPPEGaFYLFPKIPELLDSEEF-AKKLLEE----AGVAVVPGSGFgEPPGE 364
                         330       340
                  ....*....|....*....|....*....
gi 1387629617 323 GWFRLVFAETHLHLQVAMDRFCHVLAEHK 351
Cdd:COG0436   365 GYVRLSLATSEETLEEALRRLARFLAEYR 393
HisC COG0079
Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase [Amino acid ...
10-327 4.70e-23

Histidinol-phosphate/aromatic aminotransferase or cobyric acid decarboxylase [Amino acid transport and metabolism];


Pssm-ID: 223157  Cd Length: 356  Bit Score: 98.15  E-value: 4.70e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHyckaptpLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFvfssHLYSKIELIPVHlesQVP 89
Cdd:COG0079    62 LRAALAEYYGV-------VDPENVLVGNGSDELIELLVRAFVEPGDTVLIPEPTFSMY----EIAAQLAGAEVV---KVP 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  90 rsnLDSFQLTVDKLKLALTQakkkakkVKGLVLI-NPQNPLGDVYTQSSLQEyLVFAKTHKLHVIMDEIYMlsvfEpsvt 168
Cdd:COG0079   128 ---LKEFRLDLDAILAAIRD-------KTKLVFLcNPNNPTGTLLPREELRA-LLEALPEGGLVVIDEAYI----E---- 188
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 169 FHSVLSIKDLPDPNMTHMIWGTSKDFGMSGIRFGVLYTHnKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWISKVylp 248
Cdd:COG0079   189 FSPESSLELLKYPPNLIVLRTFSKAFGLAGLRVGYAIAN-PELIAALNKVRPPFNVSSPALAAAIAALRDADYLEES--- 264
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1387629617 249 knHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINlkaylspCTFDQEQILHQRFRDKKLLLSSGKSYMCIePGWFRL 327
Cdd:COG0079   265 --VERIREERERLYAALKALGLFGVFPSQANFVLVR-------VPDAEAAALAEALLKKGILVRDCSSVGLL-PGYLRI 333
PRK07568 PRK07568
aspartate aminotransferase; Provisional
9-216 3.18e-21

aspartate aminotransferase; Provisional


Pssm-ID: 181036  Cd Length: 397  Bit Score: 93.38  E-value: 3.18e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFlthYCKAPTPLDPENVVVLNGCSS--VFAslAMVLCDPGDALLIPTPCY---NGFVfsshLYSKIELIPVh 83
Cdd:PRK07568   70 ELREAFAKY---YKKWGIDVEPDEILITNGGSEaiLFA--MMAICDPGDEILVPEPFYanyNGFA----TSAGVKIVPV- 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  84 lesqvPRSNLDSFQL-TVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSV 162
Cdd:PRK07568  140 -----TTKIEEGFHLpSKEEIEKLITPKTK------AILISNPGNPTGVVYTKEELEMLAEIAKKHDLFLISDEVYREFV 208
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 1387629617 163 FEpSVTFHSVLSIKDLPDpNMThMIWGTSKDFGMSGIRFGVLYTHNKEV-ASAMK 216
Cdd:PRK07568  209 YD-GLKYTSALSLEGLED-RVI-IIDSVSKRYSACGARIGCLISKNKELiAAAMK 260
tyr_nico_aTase TIGR01265
tyrosine/nicotianamine family aminotransferase; This subfamily of pyridoxal ...
11-344 9.01e-20

tyrosine/nicotianamine family aminotransferase; This subfamily of pyridoxal phosphate-dependent enzymes includes known examples of both tyrosine aminotransferase from animals and nicotianamine aminotransferase from barley.


Pssm-ID: 188123  Cd Length: 403  Bit Score: 89.32  E-value: 9.01e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLThyCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPcynGFVFSSHL--YSKIELIPVHL--ES 86
Cdd:TIGR01265  79 REAVAEYLS--SDLPGKLTADDVVLTSGCSQAIEICIEALANPGANILVPRP---GFPLYDTRaaFSGLEVRLYDLlpEK 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 QVpRSNLDSFQLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFePS 166
Cdd:TIGR01265 154 DW-EIDLDGLESLADEKTVAI-------------VVINPSNPCGSVFSRDHLQKIAEVAEKLGIPIIADEIYGHMVF-GD 218
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 VTFHSVLSIKDLPdPNMThmIWGTSKDFGMSGIRFGVLYTHN------KEVASAMKAF-GYHHGVSGITQYKLCRLLQDK 239
Cdd:TIGR01265 219 APFIPMASFASIV-PVLS--LGGISKRWVVPGWRLGWIIIHDphgifrDTVLQGLKNLlQRILGPATIVQGALPDILENT 295
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 240 EwisKVYLPKNHSRLQKAYSYITKILKD---LKIPFYNGGSGLFVWINLKAYlsPCTFDQEQILHQRFRDKKLLLSSGKs 316
Cdd:TIGR01265 296 P---QEFFDGKISVLKSNAELCYEELKDipgLVCPKPEGAMYLMVKLELELF--PEIKDDVDFCEKLAREESVICLPGS- 369
                         330       340       350
                  ....*....|....*....|....*....|..
gi 1387629617 317 ymCIE-PGWFRLVFAETHLHLQVAMDR---FC 344
Cdd:TIGR01265 370 --AFGlPNWVRITITVPESMLEEACSRikeFC 399
tyr_amTase_E TIGR01264
tyrosine aminotransferase, eukaryotic; This model describes tyrosine aminotransferase as found ...
9-288 7.34e-19

tyrosine aminotransferase, eukaryotic; This model describes tyrosine aminotransferase as found in animals and Trypanosoma cruzi. It is the first enzyme of a pathway of tyrosine degradation via homogentisate. Several plant enzyme designated as probable tyrosine aminotransferases are very closely related to an experimentally demonstrated nicotianamine aminotransferase, an enzyme in a siderophore (iron uptake chelator) biosynthesis pathway. These plant sequences are excluded from the model seed and score between the trusted an noise cutoffs. [Energy metabolism, Amino acids and amines]


Pssm-ID: 273529  Cd Length: 401  Bit Score: 86.76  E-value: 7.34e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFlthYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPcynGFVFSSHLYSKIElIPVHLESQV 88
Cdd:TIGR01264  77 SAREAIASY---YHNPDGPIEADDVVLCSGCSHAIEMCIAALANAGQNILVPRP---GFPLYETLAESMG-IEVKLYNLL 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 P----RSNLDSF-QLTVDKLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF 163
Cdd:TIGR01264 150 PdkswEIDLKQLeSLIDEKTAA--------------LIVNNPSNPCGSVFSRQHLEEILAVAERQCLPIIADEIYGDMVF 215
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 164 ePSVTFHSVLSIkdlpDPNMTHMIW-GTSKDFGMSGIRFGVLYTHNKE----------VASAMKAFGYHHGVSGITQYKL 232
Cdd:TIGR01264 216 -SGATFEPLASL----SSTVPILSCgGLAKRWLVPGWRLGWIIIHDRRgilrdirdglVKLSQRILGPCTIVQGALPSIL 290
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 1387629617 233 CRLLQDkewiskvYLPKNHSRLQKAYSYITKILKD---LKIPFYNGGSGLFVWINLKAY 288
Cdd:TIGR01264 291 LRTPQE-------YFDGTLSVLESNAMLCYGALAAvpgLRPVMPSGAMYMMVGIEMEHF 342
PRK08363 PRK08363
alanine aminotransferase; Validated
28-343 1.37e-18

alanine aminotransferase; Validated


Pssm-ID: 181402  Cd Length: 398  Bit Score: 86.01  E-value: 1.37e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIeliPVHLESqvprSNLDSFQLTVDKLKLAL 107
Cdd:PRK08363   91 ITPDDVRVTAAVTEALQLIFGALLDPGDEILIPGPSYPPYTGLVKFYGGV---PVEYRT----IEEEGWQPDIDDIRKKI 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 108 TQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSvtFHSVLSI-KDLPDPNMThm 186
Cdd:PRK08363  164 TEKTK------AIAVINPNNPTGALYEKKTLKEILDIAGEHDLPVISDEIYDLMTYEGK--HVSPGSLtKDVPVIVMN-- 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 187 iwGTSKDFGMSGIRFGVLYTHNKEvasaMKAFGYHHGVSGITQYKLC-------------RLLQDkewiskvYLPKNHSR 253
Cdd:PRK08363  234 --GLSKVYFATGWRLGYIYFVDPE----GKLAEVREAIDKLARIRLCpntpaqfaaiaglTGPMD-------YLEEYMKK 300
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 254 LQKAYSYITKILKDlkIPFYNGGS--GLFvWINLKAYLSPCTFDQE---QILHqrfrDKKLLLSSGKSYMCIEPGWFRLV 328
Cdd:PRK08363  301 LKERRDYIYKRLNE--IPGISTTKpqGAF-YIFPRIEEGPWKDDKEfvlDVLH----EAHVLFVHGSGFGEYGAGHFRLV 373
                         330
                  ....*....|....*
gi 1387629617 329 FAETHLHLQVAMDRF 343
Cdd:PRK08363  374 FLPPVEILEEAMDRF 388
PRK07682 PRK07682
hypothetical protein; Validated
9-202 1.80e-18

hypothetical protein; Validated


Pssm-ID: 181082  Cd Length: 378  Bit Score: 85.17  E-value: 1.80e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHycKAPTPLDPENVVVLNGCSSVFASLAM-VLCDPGDALLIPTPCyngFVFSSHLYSKIELIPVHLESq 87
Cdd:PRK07682   61 ELRQEIAKYLKK--RFAVSYDPNDEIIVTVGASQALDVAMrAIINPGDEVLIVEPS---FVSYAPLVTLAGGVPVPVAT- 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  88 vprSNLDSFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYM-LSVFEPS 166
Cdd:PRK07682  135 ---TLENEFKVQPAQIEAAITAKTK------AILLCSPNNPTGAVLNKSELEEIAVIVEKHDLIVLSDEIYAeLTYDEAY 205
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1387629617 167 VTFHSVLSIKDlpdpnMTHMIWGTSKDFGMSGIRFG 202
Cdd:PRK07682  206 TSFASIKGMRE-----RTILISGFSKGFAMTGWRLG 236
PRK05764 PRK05764
aspartate aminotransferase; Provisional
29-215 6.47e-17

aspartate aminotransferase; Provisional


Pssm-ID: 235596  Cd Length: 393  Bit Score: 80.94  E-value: 6.47e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  29 DPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYngfvfsshlYSKIELI------PVHlesqVPRSNLDSFQLTVDK 102
Cdd:PRK05764   90 DPSQVIVTTGAKQALYNAFMALLDPGDEVIIPAPYW---------VSYPEMVklaggvPVF----VPTGEENGFKLTVEQ 156
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 103 LKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEpSVTFHSVLSIkdlpDPN 182
Cdd:PRK05764  157 LEAAITPKTK------ALILNSPSNPTGAVYSPEELEAIADVAVEHDIWVLSDEIYEKLVYD-GAEFTSIASL----SPE 225
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1387629617 183 M---THMIWGTSKDFGMSGIRFGVLyTHNKEVASAM 215
Cdd:PRK05764  226 LrdrTITVNGFSKAYAMTGWRLGYA-AGPKELIKAM 260
PRK07309 PRK07309
aromatic amino acid aminotransferase; Validated
10-351 1.72e-16

aromatic amino acid aminotransferase; Validated


Pssm-ID: 235985  Cd Length: 391  Bit Score: 79.77  E-value: 1.72e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHycKAPTPLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLyskielipVHLESQV 88
Cdd:PRK07309   72 LRQAAADFVKE--KYNLDYAPENeILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPIVNL--------VGAEIVE 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 PRSNLDSFQLTVDKLKLALTQAKKKAKkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMlsvfEPSVT 168
Cdd:PRK07309  142 IDTTENDFVLTPEMLEKAILEQGDKLK---AVILNYPANPTGVTYSREQIKALADVLKKYDIFVISDEVYS----ELTYT 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 169 FHSVLSIKDLPdPNMTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYH-HGVSGITQYKLCRLL----QDKEWIS 243
Cdd:PRK07309  215 GEPHVSIAEYL-PDQTILINGLSKSHAMTGWRIGLIFAPAEFTAQLIKSHQYLvTAATTMAQFAAVEALtngkDDALPMK 293
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 244 KVYLpknhsrlqKAYSYITKILKDL--KIPFYNGGSGLFVWInlkaylsPCTFDQE--QILHQRFRDKKLLLSSGKSYMC 319
Cdd:PRK07309  294 KEYI--------KRRDYIIEKMTDLgfKIIKPDGAFYIFAKI-------PAGYNQDsfKFLQDFARKKAVAFIPGAAFGP 358
                         330       340       350
                  ....*....|....*....|....*....|..
gi 1387629617 320 IEPGWFRLVFAETHLHLQVAMDRFCHVLAEHK 351
Cdd:PRK07309  359 YGEGYVRLSYAASMETIKEAMKRLKEYMEEHA 390
ARO8 COG1167
DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain ...
9-330 3.60e-16

DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain [Transcription, Amino acid transport and metabolism];


Pssm-ID: 224089 [Multi-domain]  Cd Length: 459  Bit Score: 78.91  E-value: 3.60e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHYCKAPtpLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGF--VFSSHlysKIELIPVHles 86
Cdd:COG1167   136 ELREAIAAYLLARRGIS--CEPEQIVITSGAQQALDLLLRLLLDPGDTVLVEDPTYPGAlqALEAL---GARVIPVP--- 207
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 qvprsnLDSFQLTVDKLKLALTQAKKKakkvkgLVLINP--QNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE 164
Cdd:COG1167   208 ------VDEDGIDPEALEEALAQWKPK------AVYVTPtfQNPTGVTMSLERRKALLALAEKYDVLIIEDDYYGELRYD 275
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 165 PSvtfhSVLSIKDLPDPNMTHMIWGTSKDFgMSGIRFG--VLYTHNKEVASAMKAFGYHHgVSGITQYKLCRLLQDKEWI 242
Cdd:COG1167   276 GP----PPPPLKALDAPGRVIYLGSFSKTL-APGLRLGyvVAPPELIEKLLRLKQAADLG-PSSLSQAALAAFLLSGHYD 349
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 243 SkvYLPKNHSRLQKAYSYITKILKDLK---IPFYNGGSGLFVWINLKAYLSpctfdqEQILHQRFRDKKLLLSSGKSYMC 319
Cdd:COG1167   350 R--HLRRLRREYARRRDALLEALAEYLpelATWTRPEGGLFLWLELPEGID------ARELLAAALEKGVVVTPLGSAFS 421
                         330
                  ....*....|....
gi 1387629617 320 IEPGW---FRLVFA 330
Cdd:COG1167   422 ADGDPrngLRLSFS 435
PTZ00377 PTZ00377
alanine aminotransferase; Provisional
11-182 1.59e-15

alanine aminotransferase; Provisional


Pssm-ID: 240391  Cd Length: 481  Bit Score: 77.31  E-value: 1.59e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLTHycKAPTPLDPENVVVLNGCSS-VFASLAMVLCDPGDALLIPTPCYNgfvfsshLYS-KIEL-----IPVH 83
Cdd:PTZ00377  121 RKAVAAFIER--RDGVPKDPSDIFLTDGASSgIKLLLQLLIGDPSDGVMIPIPQYP-------LYSaAITLlggkqVPYY 191
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  84 LESQvprsnlDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF 163
Cdd:PTZ00377  192 LDEE------KGWSLDQEELEEAYEQAVRNGITPRALVVINPGNPTGQVLTRDVMEEIIKFCYEKGIVLMADEVYQENIY 265
                         170       180
                  ....*....|....*....|
gi 1387629617 164 EPSVTFHSVLSI-KDLPDPN 182
Cdd:PTZ00377  266 DGEKPFISFRKVlLELPAEY 285
PRK06348 PRK06348
aspartate aminotransferase; Provisional
10-202 7.26e-14

aspartate aminotransferase; Provisional


Pssm-ID: 180537  Cd Length: 384  Bit Score: 71.68  E-value: 7.26e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHYCKAPTPLDpENVVVLNGCSSVFASLAMVLcDPGDALLIPTPcyngfVFSSHLySKIEL---IPVHLES 86
Cdd:PRK06348   71 LIEEIIKYYSKNYDLSFKRN-EIMATVGACHGMYLALQSIL-DPGDEVIIHEP-----YFTPYK-DQIEMvggKPIILET 142
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 qvprSNLDSFQLTVDKLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIY-MLSVFEP 165
Cdd:PRK06348  143 ----YEEDGFQINVKKLEALITSKTK------AIILNSPNNPTGAVFSKETLEEIAKIAIEYDLFIISDEVYdGFSFYED 212
                         170       180       190
                  ....*....|....*....|....*....|....*..
gi 1387629617 166 svtFHSVLSIKDLPDPNMThmIWGTSKDFGMSGIRFG 202
Cdd:PRK06348  213 ---FVPMATLAGMPERTIT--FGSFSKDFAMTGWRIG 244
PLN02368 PLN02368
alanine transaminase
10-173 2.72e-13

alanine transaminase


Pssm-ID: 177996  Cd Length: 407  Bit Score: 70.21  E-value: 2.72e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHycKAPTPLDPENVVVLNGCS-SVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIeLIPVHLESQv 88
Cdd:PLN02368  112 VRKEVAEFIER--RDGYPSDPELIFLTDGASkGVMQILNAVIRGEKDGVLVPVPQYPLYSATISLLGGT-LVPYYLEES- 187
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 prsnlDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE---P 165
Cdd:PLN02368  188 -----ENWGLDVNNLRQSVAQARSKGITVRAMVIINPGNPTGQCLSEANLREILKFCYQERLVLLGDEVYQQNIYQderP 262

                  ....*...
gi 1387629617 166 SVTFHSVL 173
Cdd:PLN02368  263 FISAKKVL 270
PTZ00433 PTZ00433
tyrosine aminotransferase; Provisional
7-202 3.21e-13

tyrosine aminotransferase; Provisional


Pssm-ID: 185613  Cd Length: 412  Bit Score: 69.82  E-value: 3.21e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   7 SNSLREELASFL-THYCKAPT---PLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSkIELIPV 82
Cdd:PTZ00433   77 SPEAREAVATYWrNSFVHKESlksTIKKDNVVLCSGVSHAILMALTALCDEGDNILVPAPGFPHYETVCKAYG-IEMRFY 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  83 HLE-SQVPRSNLDSFQLTVD-KLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYML 160
Cdd:PTZ00433  156 NCRpEKDWEADLDEIRRLVDdRTKA--------------LIMTNPSNPCGSNFSRKHVEDIIRLCEELRLPLISDEIYAG 221
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 1387629617 161 SVFEpSVTFHSVLSIkDLPDPNMthMIWGTSKDFGMSGIRFG 202
Cdd:PTZ00433  222 MVFN-GATFTSVADF-DTTVPRV--ILGGTAKNLVVPGWRLG 259
MalY COG1168
Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor ...
12-342 7.59e-13

Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism, General function prediction only];


Pssm-ID: 224090  Cd Length: 388  Bit Score: 68.85  E-value: 7.59e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  12 EELASFLTHYCKAP--TPLDPENVVVlngCSSVFASLAMV---LCDPGDALLIPTPCYNGFvfsshlYSKI-----ELIP 81
Cdd:COG1168    63 DELYAAIAHWFKQRhqWEIKPEWIVF---VPGVVPGISLAiraLTKPGDGVVIQTPVYPPF------YNAIklngrKVIE 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  82 VHLESQVPRsnldsFQLTVDKLKLALTQAKKKAkkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLS 161
Cdd:COG1168   134 NPLVEDDGR-----YEIDFDALEKAFVDERVKL-----FILCNPHNPTGRVWTKEELRKIAELCLRHGVRVISDEIHADL 203
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 162 VFEPS--VTFHSVlsikDLPDPNMTHMIWGTSKDFGMSGIRFGVLYTHNKE----VASAMKAFGYHH----GVSG-ITQY 230
Cdd:COG1168   204 VLGGHkhIPFASL----SERFADNSITLTSASKTFNLAGLKCAYIIISNRElrakFLKRLKRNGLHGpsalGIIAtEAAY 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 231 KlcrllQDKEWIS--KVYLPKNhsrLQKAYSYITKILKDLKIpfYNGGSGLFVWINLKAYlspcTFDQEQiLHQRFRDK- 307
Cdd:COG1168   280 N-----QGEPWLDelLEYLKDN---RDYVADFLNKHLPGVKV--TEPQGTYLAWLDCREL----GLDDSE-LAEFLLEEa 344
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 1387629617 308 KLLLSSGKSYMCIEPGWFRLVFAETHLHLQVAMDR 342
Cdd:COG1168   345 KVALSPGSTFGEEGSGFVRLNFACPRAILEEALER 379
PRK08960 PRK08960
hypothetical protein; Provisional
10-204 8.68e-13

hypothetical protein; Provisional


Pssm-ID: 181595  Cd Length: 387  Bit Score: 68.54  E-value: 8.68e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFL-THYckaPTPLDPENVVVLNGCSSVFAsLAM-VLCDPGDALLIPTPCY--NGFvFSSHLYSKIELIPVHLE 85
Cdd:PRK08960   74 LREAIAGFYaQRY---GVDVDPERILVTPGGSGALL-LASsLLVDPGKHWLLADPGYpcNRH-FLRLVEGAAQLVPVGPD 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  86 SQvprsnldsFQLTVDKLKLALTQakkkakKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEp 165
Cdd:PRK08960  149 SR--------YQLTPALVERHWNA------DTVGALVASPANPTGTLLSRDELAALSQALRARGGHLVVDEIYHGLTYG- 213
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1387629617 166 sVTFHSVLSIKDlpdpnMTHMIWGTSKDFGMSGIRFGVL 204
Cdd:PRK08960  214 -VDAASVLEVDD-----DAFVLNSFSKYFGMTGWRLGWL 246
PRK06108 PRK06108
aspartate aminotransferase; Provisional
2-202 1.21e-12

aspartate aminotransferase; Provisional


Pssm-ID: 180404  Cd Length: 382  Bit Score: 68.05  E-value: 1.21e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   2 TVQRSSNSLREELASFLT-HYCKaptPLDPENVVVL-NGCSSVFASLAMVLcDPGDALLIPTPCYNGFVfsshlySKIEL 79
Cdd:PRK06108   58 THNLGIPELREALARYVSrLHGV---ATPPERIAVTsSGVQALMLAAQALV-GPGDEVVAVTPLWPNLV------AAPKI 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  80 IPVHLEsQVP-RSNLDSFQLTVDKLKLALTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEI 157
Cdd:PRK06108  128 LGARVV-CVPlDFGGGGWTLDLDRLLAAITPRTR-------ALFINsPNNPTGWTASRDDLRAILAHCRRHGLWIVADEV 199
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 1387629617 158 YMLSVFEPSVTFHSVLSIKDlPDPNM--THMIwgtSKDFGMSGIRFG 202
Cdd:PRK06108  200 YERLYYAPGGRAPSFLDIAE-PDDRIifVNSF---SKNWAMTGWRLG 242
PRK07550 PRK07550
hypothetical protein; Provisional
10-217 1.41e-12

hypothetical protein; Provisional


Pssm-ID: 181026  Cd Length: 386  Bit Score: 67.68  E-value: 1.41e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHYCKAPtpLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYngfvFSSHLYSKIELI-PVHLESQV 88
Cdd:PRK07550   72 LREAYAAHYSRLYGAA--ISPEQVHITSGCNQAFWAAMVTLAGAGDEVILPLPWY----FNHKMWLDMLGIrPVYLPCDE 145
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 PRSNLDSfqltVDKLKLALTqakkkaKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYmlSVFEP-SV 167
Cdd:PRK07550  146 GPGLLPD----PAAAEALIT------PRTRAIALVTPNNPTGVVYPPELLHELYDLARRHGIALILDETY--RDFDSgGG 213
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 1387629617 168 TFHSVLSIKDLPDpNMTHmIWGTSKDFGMSGIRFGVLYTHNKEVASAMKA 217
Cdd:PRK07550  214 APHDLFADPDWDD-TLVH-LYSFSKSYALTGHRVGAVVASPARIAEIEKF 261
PRK07683 PRK07683
aminotransferase A; Validated
10-342 1.66e-12

aminotransferase A; Validated


Pssm-ID: 236075  Cd Length: 387  Bit Score: 67.83  E-value: 1.66e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLTHycKAPTPLDPEN-VVVLNGCS-SVFASLAMVLcDPGDALLIPTPCYNGFvfsshlyskiELI------- 80
Cdd:PRK07683   70 LRKAACNFVKD--KYDLHYSPESeIIVTIGASeAIDIAFRTIL-EPGTEVILPAPIYPGY----------EPIirlcgak 136
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  81 PVHLESqvpRSNldSFQLTVDKLKLALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYML 160
Cdd:PRK07683  137 PVFIDT---RST--GFRLTAEALENAITEKTRC------VVLPYPSNPTGVTLSKEELQDIADVLKDKNIFVLSDEIYSE 205
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 161 SVFEPsvTFHSVLSIKDLPDpnMTHMIWGTSKDFGMSGIRFGVLYThNKEVASAMKAFgYHHGV---SGITQYKLCRLL- 236
Cdd:PRK07683  206 LVYEQ--PHTSIAHFPEMRE--KTIVINGLSKSHSMTGWRIGFLFA-PSYLAKHILKV-HQYNVtcaSSISQYAALEALt 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 237 ---QDKEWISKVYlpknHSRLQKAYSYITKILKDLKIP---FYnggsgLFVWInlkAYLSPCTFDQEQILhqrFRDKKLL 310
Cdd:PRK07683  280 agkDDAKMMRHQY----KKRRDYVYNRLISMGLDVEKPtgaFY-----LFPSI---GHFTMSSFDFALDL---VEEAGLA 344
                         330       340       350
                  ....*....|....*....|....*....|..
gi 1387629617 311 LSSGKSYMCIEPGWFRLVFAETHLHLQVAMDR 342
Cdd:PRK07683  345 VVPGSAFSEYGEGYVRLSYAYSIETLKEGLDR 376
C_S_lyase_PatB TIGR04350
putative C-S lyase; Members of this subfamily are probable C-S lyases from a family of ...
28-348 5.70e-12

putative C-S lyase; Members of this subfamily are probable C-S lyases from a family of pyridoxal phosphate-dependent enzymes that tend to be (mis)annotated as probable aminotransferases. One member is PatB of Bacillus subtilis, a proven C-S-lyase. Another is the virulence factor cystalysin from Treponema denticola, whose hemolysin activity may stem from H2S production. Members of the seed alignment occur next to examples of the enzyme 5-histidylcysteine sulfoxide synthase, from ovothiol A biosynthesis, and would be expected to perform a C-S cleavage of 5-histidylcysteine sulfoxide to leave 1-methyl-4-mercaptohistidine (ovothiol A).


Pssm-ID: 275146  Cd Length: 384  Bit Score: 66.19  E-value: 5.70e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVlngCSSVFASLAMV---LCDPGDALLIPTPCYNGFvFSSHLYSKIELIPVHLESQVPRSNLDsfqltVDKLK 104
Cdd:TIGR04350  81 IDPEDIVF---LPGVVPSLFAAvraLTAPGEGVIVQTPVYPPF-LSAVKSNGRELVLNPLKLDEGRYRFD-----LEDLE 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 105 LALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSvTFHSVLSIKDLPDPNmT 184
Cdd:TIGR04350 152 DAITEKARL------LLLCSPHNPVGRVWTREELTRLAELCLRHNVVVVSDEIHADLVYPPN-KHIPLASLSPEPAER-T 223
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 185 HMIWGTSKDFGMSGIRFGVLYTHNKEVASAMK------------AFGYhhgVSGITQYKlcrllQDKEWIS--KVYLPKN 250
Cdd:TIGR04350 224 VTLLSPGKTFNIAGLNISFAIIPNPELRRAFQeaaqrvhiqhgnLFGY---VAFEAAYR-----DGEPWLDalLAYLRGN 295
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 251 HSRLQKaysYITKILKDLKIPFYNGgsGLFVWINLKAYLSpctfDQEQILHQRFRDKKLLLSSGKSYMCIEPGWFRLVFA 330
Cdd:TIGR04350 296 RDLVEE---FIAKRLPQIRVRPPEA--TYLAWLDCRALGL----DDADLRAFFIEQAGLGLNPGISFGDGGSGFMRLNFG 366
                         330
                  ....*....|....*...
gi 1387629617 331 ETHLHLQVAMDRFCHVLA 348
Cdd:TIGR04350 367 CPRSTLEQALERLRQALA 384
PRK13355 PRK13355
bifunctional HTH-domain containing protein/aminotransferase; Provisional
29-352 1.86e-11

bifunctional HTH-domain containing protein/aminotransferase; Provisional


Pssm-ID: 237361 [Multi-domain]  Cd Length: 517  Bit Score: 64.76  E-value: 1.86e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  29 DPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIeliPVHLesqvpRSNLDS-FQLTVDKLKLAL 107
Cdd:PRK13355  207 DVDDIYTGNGVSELINLSMSALLDDGDEVLIPSPDYPLWTACVNLAGGT---AVHY-----RCDEQSeWYPDIDDIRSKI 278
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 108 TQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVtfHsvLSIKDLPDPNMTHMI 187
Cdd:PRK13355  279 TSRTK------AIVIINPNNPTGALYPREVLQQIVDIAREHQLIIFSDEIYDRLVMDGLE--H--TSIASLAPDLFCVTF 348
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 188 WGTSKDFGMSGIRFG-VLYTHNKEVASamkafGYHHGVSGITQYKLCRLLQDKEWIS---------KVYLPKNhSRLQKA 257
Cdd:PRK13355  349 SGLSKSHMIAGYRIGwMILSGNKRIAK-----DYIEGLNMLANMRLCSNVPAQSIVQtalgghqsvKDYLVPG-GRVYEQ 422
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 258 YSYITKILKDL--------KIPFYnggsgLFVWINLKAYlsPCTfDQEQILHQRFRDKKLLLSSGKSYMCIEPGWFRLVF 329
Cdd:PRK13355  423 RELVYNALNAIpgisavkpKAAFY-----IFPKIDVKKF--NIH-DDEQFALDLLHDKKVLIVQGTGFNWDKPDHFRVVY 494
                         330       340
                  ....*....|....*....|...
gi 1387629617 330 AETHLHLQVAMDRFCHVLAEHKK 352
Cdd:PRK13355  495 LPRLEDLEDAMDRLADFFSYYRQ 517
hisC TIGR01141
histidinol-phosphate aminotransferase; Alternate names: histidinol-phosphate transaminase; ...
10-215 1.78e-10

histidinol-phosphate aminotransferase; Alternate names: histidinol-phosphate transaminase; imidazole acetol-phosphate transaminase Histidinol-phosphate aminotransferase is a pyridoxal-phosphate dependent enzyme. [Amino acid biosynthesis, Histidine family]


Pssm-ID: 273467  Cd Length: 350  Bit Score: 61.13  E-value: 1.78e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFLThyckaptpLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPcynGFVFSSHlYSKIELIPVhleSQVP 89
Cdd:TIGR01141  60 LKQALADYYG--------VDPEQILLGNGSDEIIDLLIRAFLEPGDAVLVPPP---TYSMYEI-SAKIHGAEV---VKVP 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  90 RsnLDSFQLTVDKLKLALTQAKKkakkvkgLVLI-NPQNPLGDVYTQSSLQEYLVFAKTHKLhVIMDEIYMLSVFEPSVT 168
Cdd:TIGR01141 125 L--DEDGQLDLEDILVAIDDKPK-------LVFLcSPNNPTGNLFSRGDIEAVLERTPGDAL-VVVDEAYGEFSGEPSTL 194
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 1387629617 169 fhsvlsiKDLPD-PNMthMIWGT-SKDFGMSGIRFGVLYThNKEVASAM 215
Cdd:TIGR01141 195 -------PLLAEyPNL--IVLRTlSKAFGLAGLRIGYAIA-NAEIIDAL 233
PLN02231 PLN02231
alanine transaminase
27-171 2.37e-10

alanine transaminase


Pssm-ID: 177876 [Multi-domain]  Cd Length: 534  Bit Score: 61.49  E-value: 2.37e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  27 PLDPENVVVLNGCS-SVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKiELIPVHLESQVprsnldSFQLTVDKLKL 105
Cdd:PLN02231  188 PADPNDIFLTDGASpAVHMMMQLLIRSEKDGILCPIPQYPLYSASIALHGG-TLVPYYLDEAT------GWGLEISELKK 260
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1387629617 106 ALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTFHS 171
Cdd:PLN02231  261 QLEDARSKGITVRALVVINPGNPTGQVLAEENQRDIVEFCKQEGLVLLADEVYQENVYVPDKKFHS 326
PRK06225 PRK06225
aspartate aminotransferase; Provisional
21-245 3.20e-10

aspartate aminotransferase; Provisional


Pssm-ID: 235749  Cd Length: 380  Bit Score: 60.54  E-value: 3.20e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  21 YCKAPTP---------------LDPENVVVLNGCSSvfaSLAMV---LCDPGDALLIPTPCY---NGFV--FSSHLYSki 77
Cdd:PRK06225   59 YCKYPPPegfpelrelilkdlgLDDDEALITAGATE---SLYLVmraFLSPGDNAVTPDPGYliiDNFAsrFGAEVIE-- 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  78 elIPVHLESqvprsnlDSFQLTVDKLKLALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEI 157
Cdd:PRK06225  134 --VPIYSEE-------CNYKLTPELVKENMDENTRL------IYLIDPLNPLGSSYTEEEIKEFAEIARDNDAFLLHDCT 198
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 158 YmlSVFEPSVTfhsvLSIKDLPDPNMThmIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQ 237
Cdd:PRK06225  199 Y--RDFAREHT----LAAEYAPEHTVT--SYSFSKIFGMAGLRIGAVVATPDLIEVVKSIVINDLGTNVIAQEAAIAGLK 270

                  ....*....
gi 1387629617 238 DK-EWISKV 245
Cdd:PRK06225  271 VKdEWIDRI 279
PRK07337 PRK07337
aminotransferase; Validated
10-204 3.34e-10

aminotransferase; Validated


Pssm-ID: 180937  Cd Length: 388  Bit Score: 60.46  E-value: 3.34e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASfltHYCKA-PTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCY--NgfvfsSHLYSKIELIPVhles 86
Cdd:PRK07337   72 LREAIAA---WYARRfGLDVAPERIVVTAGASAALLLACLALVERGDEVLMPDPSYpcN-----RHFVAAAEGRPV---- 139
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 QVPRSNLDSFQLTVDKLKLALTQakkkakKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYM-LSVFEP 165
Cdd:PRK07337  140 LVPSGPAERFQLTAADVEAAWGE------RTRGVLLASPSNPTGTSIAPDELRRIVEAVRARGGFTIVDEIYQgLSYDAA 213
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 1387629617 166 SvtfHSVLSIkdlpDPNMThMIWGTSKDFGMSGIRFGVL 204
Cdd:PRK07337  214 P---VSALSL----GDDVI-TINSFSKYFNMTGWRLGWL 244
PRK05957 PRK05957
aspartate aminotransferase; Provisional
28-202 3.70e-10

aspartate aminotransferase; Provisional


Pssm-ID: 235654  Cd Length: 389  Bit Score: 60.47  E-value: 3.70e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYngfvFSSHLYSKIE-----LIPVHlesqvprsnlDSFQLTVD 101
Cdd:PRK05957   86 LNNEQaIVVTAGSNMAFMNAILAITDPGDEIILNTPYY----FNHEMAITMAgcqpiLVPTD----------DNYQLQPE 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 102 KLKLALTQAKKkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEpSVTFHSVLSIKDlpDP 181
Cdd:PRK05957  152 AIEQAITPKTR------AIVTISPNNPTGVVYPEALLRAVNQICAEHGIYHISDEAYEYFTYD-GVKHFSPGSIPG--SG 222
                         170       180
                  ....*....|....*....|.
gi 1387629617 182 NMTHMIWGTSKDFGMSGIRFG 202
Cdd:PRK05957  223 NHTISLYSLSKAYGFASWRIG 243
PRK07681 PRK07681
aspartate aminotransferase; Provisional
28-282 8.94e-10

aspartate aminotransferase; Provisional


Pssm-ID: 181081  Cd Length: 399  Bit Score: 59.43  E-value: 8.94e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLySKIELIPVHLESQvprsnlDSFQLTVDKLKLA 106
Cdd:PRK07681   90 LNADKeVLLLMGSQDGLVHLPMVYANPGDIILVPDPGYTAYETGIQM-AGATSYYMPLKKE------NDFLPDLELIPEE 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 107 LTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE--PSVTFHSVLSIKDLPDPnm 183
Cdd:PRK07681  163 IADKAK-------MMILNfPGNPVPAMAHEDFFKEVIAFAKKHNIIVVHDFAYAEFYFDgnKPISFLSVPGAKEVGVE-- 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 184 thmIWGTSKDFGMSGIRFGVLyTHNKEVASAMKAFGYH--HGVSGITQYKLCRLLQDkewiSKVYLPKNHSRLQKAYSYI 261
Cdd:PRK07681  234 ---INSLSKSYSLAGSRIGYM-IGNEEIVRALTQFKSNtdYGVFLPIQKAACAALRN----GAAFCEKNRGIYQERRDTL 305
                         250       260
                  ....*....|....*....|.
gi 1387629617 262 TKILKDLKIPFYNGGSGLFVW 282
Cdd:PRK07681  306 VDGFRTFGWNVDKPAGSMFVW 326
PRK06855 PRK06855
aminotransferase; Validated
119-269 1.58e-09

aminotransferase; Validated


Pssm-ID: 180734  Cd Length: 433  Bit Score: 58.81  E-value: 1.58e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 119 GLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTFHsvLS--IKDLPDPNMThmiwGTSKDFGM 196
Cdd:PRK06855  174 GILLINPDNPTGAVYPKEILREIVDIAREYDLFIICDEIYNNIVYNGKKTVP--LSevIGDVPGIALK----GISKELPW 247
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 197 SGIRFGVLYTHNKEVASAMKAFgyhhgVSGITQYKL---C----------RLLQDKEWisKVYLPKNHSRLQKAYSYITK 263
Cdd:PRK06855  248 PGSRCGWIEVYNADKDEVFKKY-----INSILNAKMievCsttlpqmaipRIMSHPEY--KNYLKERNKRYEKRSNIAYE 320

                  ....*.
gi 1387629617 264 ILKDLK 269
Cdd:PRK06855  321 KLKDVP 326
PLN02656 PLN02656
tyrosine transaminase
11-158 1.10e-08

tyrosine transaminase


Pssm-ID: 178262  Cd Length: 409  Bit Score: 56.09  E-value: 1.10e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLTHycKAPTPLDPENVVVLNGCS-SVFASLAMvLCDPGDALLIPTPCYNGFVFSS---HLYSK-IELIPvhle 85
Cdd:PLN02656   79 RRAIAEYLSR--DLPYKLSLDDVFITSGCTqAIDVALSM-LARPGANILLPRPGFPIYELCAafrHLEVRyVDLLP---- 151
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1387629617  86 SQVPRSNLDSFQLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIY 158
Cdd:PLN02656  152 EKGWEVDLDAVEALADQNTVAL-------------VIINPGNPCGNVYSYQHLKKIAETAEKLKILVIADEVY 211
PLN00143 PLN00143
tyrosine/nicotianamine aminotransferase; Provisional
9-189 1.18e-08

tyrosine/nicotianamine aminotransferase; Provisional


Pssm-ID: 165711  Cd Length: 409  Bit Score: 55.79  E-value: 1.18e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   9 SLREELASFLTHycKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCY---NGFVFSSHL-YSKIELIPvhl 84
Cdd:PLN00143   78 PARRAIADYLSN--DLPYQLSPDDVYLTLGCKHAAEIIIKVLARPEANILLPRPGFpdvETYAIFHHLeIRHFDLLP--- 152
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  85 eSQVPRSNLDSFQLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSV-- 162
Cdd:PLN00143  153 -EKGWEVDLDAVEAIADENTIAM-------------VIINPGNPCGSVYSYEHLNKIAETARKLGILVIADEVYGHIVfg 218
                         170       180       190
                  ....*....|....*....|....*....|..
gi 1387629617 163 ---FEPSVTFHSVLSIKDLPDPNMTHMI--WG 189
Cdd:PLN00143  219 skpFVPMGLFASIVPVITLGSISKRWMIpgWG 250
PLN00145 PLN00145
tyrosine/nicotianamine aminotransferase; Provisional
11-163 1.78e-08

tyrosine/nicotianamine aminotransferase; Provisional


Pssm-ID: 215074 [Multi-domain]  Cd Length: 430  Bit Score: 55.55  E-value: 1.78e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLThyCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGF----VFSSHLYSKIELIPvhlES 86
Cdd:PLN00145  100 RRAIAEYLS--RDLPYELSTDDIYLTAGCAQAIEIIMSVLAQPGANILLPRPGYPLYearaVFSGLEVRHFDLLP---ER 174
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1387629617  87 QVpRSNLDSFQLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF 163
Cdd:PLN00145  175 GW-EVDLEGVEALADENTVAM-------------VIINPNNPCGSVYSYEHLAKIAETARKLGILVIADEVYDHLTF 237
PRK06207 PRK06207
aspartate aminotransferase; Provisional
2-205 2.05e-08

aspartate aminotransferase; Provisional


Pssm-ID: 235742  Cd Length: 405  Bit Score: 55.16  E-value: 2.05e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   2 TVQRSSNSLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAmVLCDPGDALLIPTPCYngfvFSSHLYSKI---E 78
Cdd:PRK06207   75 TEYRGDADIRELLAARLAAFTGAPVDAADELIITPGTQGALFLAVA-ATVARGDKVAIVQPDY----FANRKLVEFfegE 149
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  79 LIPVHLE--SQVPRSNLDsfqltVDKLKLALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDE 156
Cdd:PRK06207  150 MVPVQLDylSADKRAGLD-----LDQLEEAFKAGVRV------FLFSNPNNPAGVVYSAEEIAQIAALARRYGATVIVDQ 218
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 1387629617 157 IYMLSVFEPSVTFHsvLSIKDLpDPNMTHMIWGTSKDFGMSGIRFGVLY 205
Cdd:PRK06207  219 LYSRLLYDGTSYTH--LRALPI-DPENVITIMGPSKTESLSGYRLGVAF 264
PLN00175 PLN00175
aminotransferase family protein; Provisional
28-202 2.54e-08

aminotransferase family protein; Provisional


Pssm-ID: 215089  Cd Length: 413  Bit Score: 54.87  E-value: 2.54e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGF-VFSSHLYSKIELIPVHLESqvprsnldsFQLTVDKLKL 105
Cdd:PLN00175  112 VDPEKeVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYeATLSMAGAKIKTVTLRPPD---------FAVPEDELKA 182
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 106 ALTQAKKKakkvkglVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSvtfH-SVLSIKDLPDPNM 183
Cdd:PLN00175  183 AFTSKTRA-------ILINtPHNPTGKMFTREELELIASLCKENDVLAFTDEVYDKLAFEGD---HiSMASLPGMYERTV 252
                         170
                  ....*....|....*....
gi 1387629617 184 THMIWGtsKDFGMSGIRFG 202
Cdd:PLN00175  253 TMNSLG--KTFSLTGWKIG 269
PRK06107 PRK06107
aspartate aminotransferase; Provisional
30-202 2.55e-08

aspartate aminotransferase; Provisional


Pssm-ID: 180403  Cd Length: 402  Bit Score: 54.74  E-value: 2.55e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  30 PENVVVLNGCSSVFASLAMVLCDPGDALLIPTP---CYNGFVFSShlyskiELIPVhlesQVPRSNLDSFQLTVDKLKLA 106
Cdd:PRK06107   93 DNEITVGGGAKQAIFLALMATLEAGDEVIIPAPywvSYPDMVLAN------DGTPV----IVACPEEQGFKLTPEALEAA 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 107 LTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYL-VFAKTHKLHVIMDEIYMLSVFEPSVTFHSVLSIKDLPDpnMTH 185
Cdd:PRK06107  163 ITPRTRW------LILNAPSNPTGAVYSRAELRALAdVLLRHPHVLVLTDDIYDHIRFDDEPTPHLLAAAPELRD--RVL 234
                         170
                  ....*....|....*..
gi 1387629617 186 MIWGTSKDFGMSGIRFG 202
Cdd:PRK06107  235 VTNGVSKTYAMTGWRIG 251
PRK09265 PRK09265
aminotransferase AlaT; Validated
20-352 2.83e-08

aminotransferase AlaT; Validated


Pssm-ID: 181738  Cd Length: 404  Bit Score: 54.82  E-value: 2.83e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  20 HYCKAP--TPLDPENVVVLNGCSSVFaSLAM-VLCDPGDALLIPTPCYNGFVFSSHLYSKIeliPVHL---ESQvprsnl 93
Cdd:PRK09265   83 QYYQQKgiPDVDVDDIYIGNGVSELI-VMAMqALLNNGDEVLVPAPDYPLWTAAVSLSGGK---PVHYlcdEEA------ 152
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  94 dSFQLTVDKLKLALTqakkkaKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEpSVTFHSVL 173
Cdd:PRK09265  153 -GWFPDLDDIRSKIT------PRTKAIVIINPNNPTGAVYSKELLEEIVEIARQHNLIIFADEIYDKILYD-GAVHISIA 224
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 174 SI-KDLPDPNMThmiwGTSKDFGMSGIRFG-VLYTHNKEVASamkafGYHHGVSGITQYKLC----------RLLQDKEW 241
Cdd:PRK09265  225 SLaPDLLCVTFN----GLSKAYRVAGFRVGwMVLSGPKKHAK-----GYIEGLDMLASMRLCanvpaqhaiqTALGGYQS 295
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 242 ISKVYLPKNHSRLQK--AYSYITKI----LKDLKIPFYnggsgLFVWINLKAYlsPCTFDQEQILhQRFRDKKLLLSSGK 315
Cdd:PRK09265  296 INELILPGGRLYEQRdrAWELLNAIpgvsCVKPKGALY-----AFPKLDPKVY--PIHDDEQFVL-DLLLQEKVLLVQGT 367
                         330       340       350
                  ....*....|....*....|....*....|....*..
gi 1387629617 316 SYMCIEPGWFRLVFAETHLHLQVAMDRFCHVLAEHKK 352
Cdd:PRK09265  368 GFNWPEPDHFRIVTLPRVDDLEEAIGRIGRFLSGYRQ 404
L_thr_O3P_dcar TIGR01140
L-threonine-O-3-phosphate decarboxylase; This family contains pyridoxal phosphate-binding ...
28-327 2.87e-08

L-threonine-O-3-phosphate decarboxylase; This family contains pyridoxal phosphate-binding class II aminotransferases (see pfamAM:pfam00222) closely related to, yet distinct from, histidinol-phosphate aminotransferase (HisC). It is found in cobalamin biosynthesis operons in Salmonella typhimurium and Bacillus halodurans (each of which also has HisC) and has been shown to have L-threonine-O-3-phosphate decarboxylase activity in Salmonella. Although the gene symbol cobD was assigned in Salmonella, cobD in other contexts refers to a different cobalamin biosynthesis enzyme, modeled by pfam03186 and called cbiB in Salmonella. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]


Pssm-ID: 273466  Cd Length: 330  Bit Score: 54.50  E-value: 2.87e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLNGCSSVFASLAMvLCDPGDALlIPTPCYN--GFVFSSHlyskiELIPVHLEsqvprsnldsfqlTVDKLKL 105
Cdd:TIGR01140  62 LPAASVLPVNGAQEAIYLLPR-LLAPGRVL-VLAPTYSeyARAWRAA-----GHEVVELP-------------DLDRLPA 121
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 106 ALTQAKkkakkvkGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVT-----------FHSvls 174
Cdd:TIGR01140 122 ALEEAD-------LLVVCNPNNPTGRLIPPETLLALAARLRARGGWLVVDEAFIDFTPDASLApqaarfpglvvLRS--- 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 175 ikdlpdpnMThmiwgtsKDFGMSGIRFGVLYTHNkEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWI--SKVYLPKNHS 252
Cdd:TIGR01140 192 --------LT-------KFFGLAGLRLGFVVAHP-ALIARLREALGPWTVNGPALAAGRAALADTAWQaaTRARLAAERA 255
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1387629617 253 RLQKAYSyitkilkdlKIPFY--NGGSGLFVWinlkaylspCTFDQEQILHQRFRDKKLLLSSGKSYMCIEPGWFRL 327
Cdd:TIGR01140 256 RLAALLA---------RLGGLrvVGGTALFLL---------VRTPDAAALHEALARRGILIRDFDNFPGLDPRYLRF 314
PRK07777 PRK07777
aminotransferase; Validated
29-164 5.15e-08

aminotransferase; Validated


Pssm-ID: 236095  Cd Length: 387  Bit Score: 53.89  E-value: 5.15e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  29 DPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIElIPVHLesqvpRSNLDSFQLTVDKLKLAL 107
Cdd:PRK07777   83 DPDTeVLVTVGATEAIAAAVLGLVEPGDEVLLIEPYYDSYAAVIAMAGAHR-VPVPL-----VPDGRGFALDLDALRAAV 156
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1387629617 108 TQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE 164
Cdd:PRK07777  157 TPRTR-------ALIVNsPHNPTGTVLTAAELAAIAELAVEHDLLVITDEVYEHLVFD 207
avtA PRK09440
valine--pyruvate transaminase; Provisional
8-317 8.52e-08

valine--pyruvate transaminase; Provisional


Pssm-ID: 236517  Cd Length: 416  Bit Score: 53.32  E-value: 8.52e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   8 NSLREELASFLTHYCKAPtpLDPENVVVLNGCSSVFASLAMVLCDPGD-----ALLIP-TPCYNGfvfsshlYSKIELIP 81
Cdd:PRK09440   77 DELIEALAALLNERYGWN--ISPQNIALTNGSQSAFFYLFNLFAGRRAdgslkKILFPlAPEYIG-------YADAGLEE 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  82 VHLESQVPR-SNLDS--FQLTVDKLKLALTQAKkkakkvkGLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEI 157
Cdd:PRK09440  148 DLFVSYRPNiELLPEgqFKYHVDFEHLHIDEDT-------GAICVSrPTNPTGNVLTDEELEKLDALARQHNIPLLIDNA 220
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 158 YMLsVFePSVTFHSVlsiKDLPDPNMTHMIwGTSKdFGMSGIRFGVLYThNKEVASAMKAFgyhHGV-----SGITQYKL 232
Cdd:PRK09440  221 YGP-PF-PGIIFSEA---TPLWNPNIILCM-SLSK-LGLPGVRCGIVIA-DEEIIEALSNM---NGIislapGRLGPAIA 289
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 233 CRLLQDKEWIS---KVYLPKNHSRLQKAYSYITKILKDlkIPFY--NGGSGLFVWINLKAYlsPCTfDQEqiLHQRFRDK 307
Cdd:PRK09440  290 AEMIESGDLLRlseTVIRPFYRQKVQLAIALLRRYLPD--EPCLihKPEGAIFLWLWFKDL--PIT-TEE--LYQRLKAR 362
                         330
                  ....*....|
gi 1387629617 308 KLLLSSGKSY 317
Cdd:PRK09440  363 GVLVVPGHYF 372
PRK06290 PRK06290
aspartate aminotransferase; Provisional
28-219 2.16e-07

aspartate aminotransferase; Provisional


Pssm-ID: 235772  Cd Length: 410  Bit Score: 51.96  E-value: 2.16e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLN-GCSSVFASLAMVLCDPGDALLIPTPCYNgfVFSSH---LYSKIELIPVHLESQ-VPrsNLDSFQLTV-D 101
Cdd:PRK06290  103 IDPVTEVIHSiGSKPALAMLPSCFINPGDVTLMTVPGYP--VTGTHtkyYGGEVYNLPLLEENNfLP--DLDSIPKDIkE 178
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 102 KLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTfhSVLSIKDLPDP 181
Cdd:PRK06290  179 KAKL--------------LYLNYPNNPTGAVATKEFYEEVVDFAKENNIIVVQDAAYAALTFDGKPL--SFLSVPGAKEV 242
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1387629617 182 NMThmIWGTSKDFGMSGIRFGVLYTHNKEVasamKAFG 219
Cdd:PRK06290  243 GVE--IHSLSKAYNMTGWRLAFVVGNELIV----KAFA 274
PRK08361 PRK08361
aspartate aminotransferase; Provisional
10-349 2.57e-07

aspartate aminotransferase; Provisional


Pssm-ID: 236248  Cd Length: 391  Bit Score: 51.80  E-value: 2.57e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFL-THYckaPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLY-SKIELIPVHLESQ 87
Cdd:PRK08361   75 LREAIAEYYkKFY---GVDVDVDNVIVTAGAYEATYLAFESLLEEGDEVIIPDPAFVCYVEDAKIAeAKPIRIPLREENE 151
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  88 vprsnldsFQLTVDKLKLALTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPS 166
Cdd:PRK08361  152 --------FQPDPDELLELITKRTR-------MIVINyPNNPTGATLDKEVAKAIADIAEDYNIYILSDEPYEHFLYEGA 216
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 167 vtfHSVLSIKDLPDPnmTHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHG-VSGITQYKLCRLLQDKE-Wisk 244
Cdd:PRK08361  217 ---KHYPMIKYAPDN--TILANSFSKTFAMTGWRLGFVIAPEQVIKDMIKLHAYIIGnVASFVQIAGIEALRSKEsW--- 288
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 245 vylpKNHSRLQKAYSYITKI-LKDLK----IPFYNGGSGLFVWINlkayLSPCTFDQEQILHQRFRDKKLLLSSGKSYMC 319
Cdd:PRK08361  289 ----KAVEEMRKEYNERRKLvLKRLKemphIKVFEPKGAFYVFAN----IDETGMSSEDFAEWLLEKARVVVIPGTAFGK 360
                         330       340       350
                  ....*....|....*....|....*....|
gi 1387629617 320 IEPGWFRLVFAETHLHLQVAMDRFCHVLAE 349
Cdd:PRK08361  361 AGEGYIRISYATSKEKLIEAMERMEKALEE 390
PRK14807 PRK14807
histidinol-phosphate aminotransferase; Provisional
6-311 3.59e-07

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 184829  Cd Length: 351  Bit Score: 51.01  E-value: 3.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   6 SSNSLREELAsfltHYCKAptplDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFvfssHLYSKI---ELIPV 82
Cdd:PRK14807   60 TAEKLREELA----RYCSV----VPTNIFVGNGSDEIIHLIMLAFINKGDVVIYPHPSFAMY----SVYSKIagaVEIPV 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  83 HLESQVpRSNLDSFQLTVDKLKLALtqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKThklHVIMDEIYmlsv 162
Cdd:PRK14807  128 KLKEDY-TYDVGSFIKVIEKYQPKL------------VFLCNPNNPTGSVIEREDIIKIIEKSRG---IVVVDEAY---- 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 163 FEpsvtFHSVlSIKDLPDPNMTHMIWGT-SKDFGMSGIRFGVLYThNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEW 241
Cdd:PRK14807  188 FE----FYGN-TIVDVINEFENLIVLRTlSKAFGLAGLRVGYAVA-NENILKYLNLVKSPYNINSLSQVIALKVLRTGVL 261
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1387629617 242 ISKV-YLPKNHSRLQKAYSyitkilkdlKIPfynggsGLFVWiNLKAYLSPCTFDQEQILHQRFRDKKLLL 311
Cdd:PRK14807  262 KERVnYILNERERLIKELS---------KIP------GIKVY-PSKTNFILVKFKDADYVYQGLLERGILV 316
PLN02187 PLN02187
rooty/superroot1
25-210 3.74e-07

rooty/superroot1


Pssm-ID: 215119  Cd Length: 462  Bit Score: 51.27  E-value: 3.74e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  25 PTPLDPENVVVLNGCSS----VFASLAMvlcdPGDALLIPTPCYNGF----VFSSHLYSKIELIPvHLESQVprsNLDSF 96
Cdd:PLN02187  126 PHKLTPEDIFLTAGCNQgieiVFESLAR----PNANILLPRPGFPHYdaraAYSGLEVRKFDLLP-EKEWEI---DLEGI 197
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  97 QLTVDKLKLALtqakkkakkvkglVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVF--EPSVTFHSVLS 174
Cdd:PLN02187  198 EAIADENTVAM-------------VVINPNNPCGNVYSHDHLKKVAETARKLGIMVISDEVYDRTIFgdNPFVSMGKFAS 264
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 1387629617 175 IKdlpdPNMThmIWGTSKDFGMSGIRFGVLYTHNKE 210
Cdd:PLN02187  265 IV----PVLT--LAGISKGWVVPGWKIGWIALNDPE 294
PRK07324 PRK07324
transaminase; Validated
7-218 4.37e-07

transaminase; Validated


Pssm-ID: 235989  Cd Length: 373  Bit Score: 51.09  E-value: 4.37e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   7 SNSLREELASFLTHyckaptpLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNgfvfssHLYSkielIPVHLES 86
Cdd:PRK07324   64 SPEFKEAVASLYQN-------VKPENILQTNGATGANFLVLYALVEPGDHVISVYPTYQ------QLYD----IPESLGA 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  87 QVPRSNL---DSFQLTVDKLKLALTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMlsv 162
Cdd:PRK07324  127 EVDYWQLkeeNGWLPDLDELRRLVRPNTK-------LICINnANNPTGALMDRAYLEEIVEIARSVDAYVLSDEVYR--- 196
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1387629617 163 fePSVTFHSVLSIKDLPDPNMT--HMiwgtSKDFGMSGIRFGVLYThNKEVASAMKAF 218
Cdd:PRK07324  197 --PLDEDGSTPSIADLYEKGIStnSM----SKTYSLPGIRVGWIAA-NEEVIDILRKY 247
3metArgNH2trans TIGR04544
beta-methylarginine biosynthesis bifunctional aminotransferase; Members of this family are the ...
120-211 4.12e-06

beta-methylarginine biosynthesis bifunctional aminotransferase; Members of this family are the bifunctional aminotransferase that catalyzes the first and third steps in the three-step conversion of arginine to beta-methylarginine. It first converts arginine to 2-ketoarginine, then converts 3-methyl-2-ketoarginine to 3-methylarginine. All members of the seed alignment are encoded next to a 2-ketoarginine methyltransferase (EC 2.1.1.243).


Pssm-ID: 275337  Cd Length: 366  Bit Score: 47.84  E-value: 4.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 120 LVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTFHSVLSIKDLPDpnmTHMIWGTSKDFGMSG 198
Cdd:TIGR04544 149 LVYLNfPHNPTGECLSEDTMRDLVALAERRGVSLVLDLVYDSFIFDPGVLRSPFALAVNWDD---LYTVNSMSKNYGAPG 225
                          90
                  ....*....|...
gi 1387629617 199 IRFGVLYTHNKEV 211
Cdd:TIGR04544 226 LRIGWIVADPKNI 238
PLN02994 PLN02994
1-aminocyclopropane-1-carboxylate synthase
9-66 4.13e-06

1-aminocyclopropane-1-carboxylate synthase


Pssm-ID: 166635 [Multi-domain]  Cd Length: 153  Bit Score: 46.15  E-value: 4.13e-06
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 1387629617   9 SLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNG 66
Cdd:PLN02994   96 NFRKAIANFMAEARGGRVKFDADMIVLSAGATAANEIIMFCIADPGDAFLVPTPYYAA 153
PRK08068 PRK08068
transaminase; Reviewed
5-240 4.17e-06

transaminase; Reviewed


Pssm-ID: 181219  Cd Length: 389  Bit Score: 48.00  E-value: 4.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   5 RSSNSLREELASF-LTHYckaPTPLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCY----NGFVFSShlySKIE 78
Cdd:PRK08068   70 RGYPFLKEAAADFyKREY---GVTLDPETeVAILFGGKAGLVELPQCLMNPGDTILVPDPGYpdylSGVALAR---AQFE 143
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  79 LIPVHLESQ-VPrsNLDSFQLTV-DKLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDE 156
Cdd:PRK08068  144 TMPLIAENNfLP--DYTKIPEEVaEKAKL--------------MYLNYPNNPTGAVATKAFFEETVAFAKKHNIGVVHDF 207
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 157 IYMLSVFE---PsVTFHSVLSIKDLPDPNMThmiwgTSKDFGMSGIR--FGVlytHNKEVASAMKAFGYHHGVS---GIT 228
Cdd:PRK08068  208 AYGAIGFDgqkP-VSFLQTPGAKDVGIELYT-----LSKTFNMAGWRvaFAV---GNESVIEAINLLQDHLFVSlfgAIQ 278
                         250
                  ....*....|..
gi 1387629617 229 QYKLCRLLQDKE 240
Cdd:PRK08068  279 DAAIEALLSDQS 290
PRK08636 PRK08636
aspartate aminotransferase; Provisional
28-216 1.05e-05

aspartate aminotransferase; Provisional


Pssm-ID: 236316  Cd Length: 403  Bit Score: 46.62  E-value: 1.05e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYngfvfsshlyskieliPVHLES------QVPRSNL---DSFQ 97
Cdd:PRK08636   92 LDPETeVVATMGSKEGYVHLVQAITNPGDVAIVPDPAY----------------PIHSQAfilaggNVHKMPLeynEDFE 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  98 LTVDKLKLALTQAKKKAKKVKGLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTfHSVLSI- 175
Cdd:PRK08636  156 LDEDQFFENLEKALRESSPKPKYVVVNfPHNPTTATVEKSFYERLVALAKKERFYIISDIAYADITFDGYKT-PSILEVe 234
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 1387629617 176 --KDLPDPNMThmiwgTSKDFGMSGIRFGVLYTHNKEVASAMK 216
Cdd:PRK08636  235 gaKDVAVESYT-----LSKSYNMAGWRVGFVVGNKKLVGALKK 272
PRK07366 PRK07366
succinyldiaminopimelate transaminase; Validated
27-202 4.51e-05

succinyldiaminopimelate transaminase; Validated


Pssm-ID: 180947  Cd Length: 388  Bit Score: 44.67  E-value: 4.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  27 PLDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYS-KIELIPVHLE-------SQVPrsnldsfQ 97
Cdd:PRK07366   88 AVDPETeVLPLIGSQEGTAHLPLAVLNPGDFALLLDPGYPSHAGGVYLAGgQIYPMPLRAEndflpvfADIP-------T 160
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  98 LTVDKLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVTFHSVLsikd 177
Cdd:PRK07366  161 EVLAQARL--------------MVLSYPHNPTTAIAPLSFFQEAVAFCQQHDLVLVHDFPYVDLVFDGEVEPPSIL---- 222
                         170       180
                  ....*....|....*....|....*..
gi 1387629617 178 LPDPNMTHMI--WGTSKDFGMSGIRFG 202
Cdd:PRK07366  223 QADPEKSVSIefFTLSKSYNMGGFRIG 249
PRK03967 PRK03967
histidinol-phosphate aminotransferase; Provisional
4-216 4.74e-05

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 167650  Cd Length: 337  Bit Score: 44.34  E-value: 4.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   4 QRSSNSLREELASFLThyckaptpLDPENVVVLNGCSSVFASLamVLCDPGDALLIPTPCYNGFVFsshlYSKIELIPVh 83
Cdd:PRK03967   54 HITSDPLREAIAEFYG--------LDAENIAVGNGSDELISYL--VKLFEGKHIVITPPTFGMYSF----YAKLNGIPV- 118
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  84 leSQVPRSNldSFQLTVDKLKLALTQAKKkakkvkgLVLINPQNPLGDVYTQsslQEYLVFAKTHKlHVIMDEIYmlsvf 163
Cdd:PRK03967  119 --IDVPLKE--DFTIDGERIAEKAKNASA-------VFICSPNNPTGNLQPE---EEILKVLETGK-PVVLDEAY----- 178
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1387629617 164 epsVTFhSVLSIKDLPD--PNMthMIWGT-SKDFGMSGIRFGVLYThNKEVASAMK 216
Cdd:PRK03967  179 ---AEF-SGKSLIGLIDeyPNL--ILLRTfSKAFGLAGIRAGYAIA-NEEIIDALY 227
PRK06358 PRK06358
threonine-phosphate decarboxylase; Provisional
10-246 8.05e-05

threonine-phosphate decarboxylase; Provisional


Pssm-ID: 180542  Cd Length: 354  Bit Score: 43.84  E-value: 8.05e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFlthyckapTPLDPENVVVLNGCSSVFASLAMVLcDPGDALlIPTPCyngfvFSSH----LYSKIELIPVHLE 85
Cdd:PRK06358   59 LRKRIASF--------EQLDLENVILGNGATELIFNIVKVT-KPKKVL-ILAPT-----FAEYeralKAFDAEIEYAELT 123
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  86 SQvprsnlDSFQLTVDKLKlALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYM--LSVF 163
Cdd:PRK06358  124 EE------TNFAANEIVLE-EIKEEIDL------VFLCNPNNPTGQLISKEEMKKILDKCEKRNIYLIIDEAFMdfLEEN 190
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 164 EPSVTFHSVLSIKDLpdpnmtHMIWGTSKDFGMSGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDKEWIS 243
Cdd:PRK06358  191 ETISMINYLENFKNL------IIIRAFTKFFAIPGLRLGYGLTSNKNLAEKLLQMREPWSINTFADLAGQTLLDDKEYIK 264

                  ...
gi 1387629617 244 KVY 246
Cdd:PRK06358  265 KTI 267
PLN03026 PLN03026
histidinol-phosphate aminotransferase; Provisional
7-202 1.29e-04

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 178597  Cd Length: 380  Bit Score: 43.15  E-value: 1.29e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617   7 SNSLREELAsflthyckAPTPLDPENVVVlnGCSSVFA-SLAM-VLCDPGDALLIPTPCYNGFVFSSHLySKIELIpvhl 84
Cdd:PLN03026   88 SRRLRAALA--------EDSGLESENILV--GCGADELiDLLMrCVLDPGDKIIDCPPTFGMYVFDAAV-NGAEVI---- 152
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  85 esQVPRsnLDSFQLTVDKLKLALTQAKKKAkkvkgLVLINPQNPLGDVYTQSSLQEYLVFAkthkLHVIMDEIYmlsvfe 164
Cdd:PLN03026  153 --KVPR--TPDFSLDVPRIVEAVETHKPKL-----LFLTSPNNPDGSIISDDDLLKILELP----ILVVLDEAY------ 213
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 1387629617 165 psVTFHSVLS-IKDLPD-PNMthMIWGT-SKDFGMSGIRFG 202
Cdd:PLN03026  214 --IEFSTQESrMKWVKKyDNL--IVLRTfSKRAGLAGLRVG 250
PRK08175 PRK08175
aminotransferase; Validated
28-215 1.31e-04

aminotransferase; Validated


Pssm-ID: 181268  Cd Length: 395  Bit Score: 43.16  E-value: 1.31e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYN----GFVFSSHLYSKIELIP-VHLESQVPRSNLDSFQltvd 101
Cdd:PRK08175   88 IDPESeAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPihiyGAVIAGAQVRSVPLVEgVDFFNELERAIRESYP---- 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 102 KLKLaltqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE----PSVTfhSVLSIKD 177
Cdd:PRK08175  164 KPKM--------------MILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDgwkaPSIM--QVPGAKD 227
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 1387629617 178 LPDPNMThmiwgTSKDFGMSGIRFGVLyTHNKEVASAM 215
Cdd:PRK08175  228 VAVEFFT-----LSKSYNMAGWRIGFM-VGNPELVSAL 259
DapC_direct TIGR03540
LL-diaminopimelate aminotransferase; This clade of the pfam00155 superfamily of ...
28-215 1.38e-04

LL-diaminopimelate aminotransferase; This clade of the pfam00155 superfamily of aminotransferases includes several which are adjacent to elements of the lysine biosynthesis via diaminopimelate pathway (GenProp0125). Every member of this clade is from a genome which possesses most of the lysine biosynthesis pathway but lacks any of the known aminotransferases, succinylases, desuccinylases, acetylases or deacetylases typical of the acylated versions of this pathway nor do they have the direct, NADPH-dependent enzyme (ddh). Although there is no experimental characterization of any of the sequences in this clade, a direct pathway is known in plants and Chlamydia and the clade containing the Chlamydia gene is a neighboring one in the same pfam00155 superfamily so it seems quite reasonable that these enzymes catalyze the same transformation.


Pssm-ID: 274638  Cd Length: 383  Bit Score: 43.13  E-value: 1.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPEN-VVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLY-SKIELIPVHLESQ-VPrsNLDSfqLTVDKLK 104
Cdd:TIGR03540  88 LDPETeVLSLIGSKEGIAHFPLAFVNPGDIVLVPDPGYPVYRIGTLFAgGEPYEMPLKEENGfLP--DFDA--IPEDIAK 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 105 LAltqakkkakkvKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFE----PS-----------VTF 169
Cdd:TIGR03540 164 KA-----------KIMFLNYPNNPTGAVADKEFFKEVVEFAKKYNIIVCHDNAYSEIYFDgykpPSflevdgakdvgIEF 232
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 1387629617 170 HSVlsikdlpdpnmthmiwgtSKDFGMSGIRFGvLYTHNKEVASAM 215
Cdd:TIGR03540 233 HSL------------------SKTYNMTGWRIG-MAVGNADLIAGL 259
AvtA COG3977
Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and ...
28-317 1.54e-04

Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 226485  Cd Length: 417  Bit Score: 43.21  E-value: 1.54e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLNGCSSVFASLAMVLC---DPGD--ALLIP-TPCYNGfvfsshlYSKIELIPVHLESQVPRSNLD---SFQL 98
Cdd:COG3977    95 ITAQNIALTNGSQSAFFYLFNLFAgrrSDGTekKILLPlAPEYIG-------YADAGLEEDLFVSAKPNIELLpagQFKY 167
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  99 TVDKLKLALTQAKkkakkvkGLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYmlSVFEPSVTFHSVlsiKD 177
Cdd:COG3977   168 HVDFEHLHIGEST-------GAICVSrPTNPTGNVLTDEELAKLDALARQHGIPLIIDNAY--GVPFPGIIFSDA---TP 235
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 178 LPDPNMTHMIwGTSKdFGMSGIRFGVLYThNKEVASAMKAFgyhHGV-----SGITQYKLCRLLQDKEWI---SKVYLPK 249
Cdd:COG3977   236 LWNENIILCM-SLSK-LGLPGSRCGIIIA-NEKVIQAITNM---NGIislapGRMGPAIAAEMIESGDLLrlsEQVIRPF 309
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1387629617 250 NHSRLQKAYSYITKILKDLKIPFYNGGSGLFVWINLKAYlsPCTfdqEQILHQRFRDKKLLLSSGKSY 317
Cdd:COG3977   310 YRNRVQTTIAILRRYLPEYRCLIHKPEGAIFLWLWFKDL--PIT---TEELYQRLKARGVLMVPGHYF 372
PRK06836 PRK06836
aspartate aminotransferase; Provisional
11-158 1.88e-04

aspartate aminotransferase; Provisional


Pssm-ID: 180720  Cd Length: 394  Bit Score: 42.87  E-value: 1.88e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  11 REELASFLTHycKAPTPLDPENVVVLNGCSsvfASLAMVL---CDPGDALLIPTPC---YNGFVfSSHlysKIELIPVhl 84
Cdd:PRK06836   79 REAIAESLNR--RFGTPLTADHIVMTCGAA---GALNVALkaiLNPGDEVIVFAPYfveYRFYV-DNH---GGKLVVV-- 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  85 esqvPrSNLDSFQLTVDKLKLALTQAKKKakkvkglVLIN-PQNPLGDVYTQSSLQEY--LVFAKT----HKLHVIMDEI 157
Cdd:PRK06836  148 ----P-TDTDTFQPDLDALEAAITPKTKA-------VIINsPNNPTGVVYSEETLKALaaLLEEKSkeygRPIYLISDEP 215

                  .
gi 1387629617 158 Y 158
Cdd:PRK06836  216 Y 216
PRK00950 PRK00950
histidinol-phosphate aminotransferase; Validated
10-158 9.37e-04

histidinol-phosphate aminotransferase; Validated


Pssm-ID: 234872  Cd Length: 361  Bit Score: 40.68  E-value: 9.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELASFlthyckapTPLDPENVVVL-NGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKielIPVHlesqV 88
Cdd:PRK00950   74 LREALSKY--------TGVPVENIIVGgDGMDEVIDTLMRTFIDPGDEVIIPTPTFSYYEISAKAHGA---KPVY----A 138
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  89 PRSNldSFQLTVDKLKLALTQAKKKakkvkgLVLINPQNPLGDVYTQSSLQEylVFAKTHKLhVIMDEIY 158
Cdd:PRK00950  139 KREE--DFSLDVDSVLNAITEKTKV------IFLCTPNNPTGNLIPEEDIRK--ILESTDAL-VFVDEAY 197
DapC TIGR03537
succinyldiaminopimelate transaminase; The four sequences which make up the seed for this model ...
60-225 1.19e-03

succinyldiaminopimelate transaminase; The four sequences which make up the seed for this model are not closely related, although they are all members of the pfam00155 family of aminotransferases and are more closely related to each other than to anything else. Additionally, all of them are found in the vicinity of genes involved in the biosynthesis of lysine via the diaminopimelate pathway (GenProp0125), although this amount to a separation of 12 genes in the case of Sulfurihydrogenibium azorense Az-Fu1. None of these genomes contain another strong candidate for this role in the pathway. Note: the detailed information included in the EC:2.6.1.17 record includes the assertions that the enzyme uses the pyridoxal pyrophosphate cofactor, which is consistent with the pfam00155 family, and the assertion that the amino group donor is L-glutamate, which is undetermined for the sequences in this clade.


Pssm-ID: 274636  Cd Length: 350  Bit Score: 40.19  E-value: 1.19e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  60 PTPCYNGFVFSShLYSKIELIPVHLESQvprsnlDSFQLTVDKLKLALTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSL 138
Cdd:TIGR03537  93 PTPGYPVYERGT-LFAGGEPTPVKLKKE------DGFLLRLDAVEKSILRETK-------IVWINyPHNPTGATAPASYL 158
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 139 QEYLVFAKTHKLHVIMDEIY-----------MLSV-FEPSVTFHSVlsikdlpdpnmthmiwgtSKDFGMSGIRFGVLyT 206
Cdd:TIGR03537 159 KRVAAMAREYGFIVCSDECYtdiyfgepphsMLEFgRENVLAFHSL------------------SKRSGMTGYRSGFM-A 219
                         170
                  ....*....|....*....
gi 1387629617 207 HNKEVASAMKAFGYHHGVS 225
Cdd:TIGR03537 220 GDEKLVSFYRKLRASFGVA 238
PRK14809 PRK14809
histidinol-phosphate aminotransferase; Provisional
28-202 1.43e-03

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 184830  Cd Length: 357  Bit Score: 40.12  E-value: 1.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYskielipvHLE-SQVPRSNLDSFQLTVDKlklA 106
Cdd:PRK14809   80 VSPEQVWLANGGDGALDYLARAMLDPGDTVLVPDPGFAYYGMSARYH--------HGEvREYPVSKADDFEQTADT---V 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 107 LTQAKKKAKkvkgLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLhVIMDEIYMlsvfepsvTFHSVLSIKDLPDPNMTHM 186
Cdd:PRK14809  149 LDAYDGERI----VYLTSPHNPTGSEIPLDEVEALAERTDEETL-VVVDEAYG--------EFAERPSAVALVEERDDVA 215
                         170
                  ....*....|....*..
gi 1387629617 187 IWGT-SKDFGMSGIRFG 202
Cdd:PRK14809  216 VLRTfSKAYGLAGLRLG 232
PRK08153 PRK08153
histidinol-phosphate aminotransferase; Provisional
10-245 1.69e-03

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 181255  Cd Length: 369  Bit Score: 39.59  E-value: 1.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  10 LREELAsflTHYckaptPLDPENVVVLNGCSSVFASLAMVLCDPGDALLI-----PTPCYNGFVFSSHLYSkielipvhl 84
Cdd:PRK08153   72 LRHALA---AHH-----GVAPENIMVGEGIDGLLGLIVRLYVEPGDPVVTslgayPTFNYHVAGFGGRLVT--------- 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  85 esqVP----RSNLDSFQLTVDKLKLALtqakkkakkvkgLVLINPQNPLGDVYTQSSLQEYL-VFAKTHKLhvIMDEIYm 159
Cdd:PRK08153  135 ---VPyrddREDLDALLDAARRENAPL------------VYLANPDNPMGSWHPAADIVAFIeALPETTLL--VLDEAY- 196
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 160 lSVFEPSVTFHSVlsikDLPDPNMTHMiwGT-SKDFGMSGIRFGVLYTHnkevASAMKAFGY---HHGVSGITQYKLCRL 235
Cdd:PRK08153  197 -CETAPAGAAPPI----DTDDPNVIRM--RTfSKAYGLAGARVGYAIGA----PGTIKAFDKvrnHFGMNRIAQAAALAA 265
                         250
                  ....*....|
gi 1387629617 236 LQDKEWISKV 245
Cdd:PRK08153  266 LKDQAYLAEV 275
PRK01688 PRK01688
histidinol-phosphate aminotransferase; Provisional
28-211 3.87e-03

histidinol-phosphate aminotransferase; Provisional


Pssm-ID: 234972  Cd Length: 351  Bit Score: 38.77  E-value: 3.87e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  28 LDPENVVVLNGCSSVFASLAMVLCDPG-DALLIPTPCYNGFVFSShlyskiELIPVHLESqVPrsNLDSFQLTVDKLKLA 106
Cdd:PRK01688   72 VKPEQVLVSRGADEGIELLIRAFCEPGkDAILYCPPTYGMYSVSA------ETIGVEIRT-VP--TLDNWQLDLPAIADN 142
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 107 LTQAKkkakkvkgLVLI-NPQNPLGDVYTQSSLQEYLVFAKTHKLhVIMDEIYMlsVFEPSVTFhsvlsIKDLPD-PNMt 184
Cdd:PRK01688  143 LDGVK--------VVYVcSPNNPTGNLINPQDLRTLLELTRGKAI-VVADEAYI--EFCPQASL-----AGWLAEyPHL- 205
                         170       180
                  ....*....|....*....|....*....
gi 1387629617 185 hMIWGT-SKDFGMSGIRFGvlYT-HNKEV 211
Cdd:PRK01688  206 -VILRTlSKAFALAGLRCG--FTlANEEV 231
viomycin_VioD TIGR03947
capreomycidine synthase; Members of this family are the enzyme capreomycidine synthase, which ...
26-202 4.84e-03

capreomycidine synthase; Members of this family are the enzyme capreomycidine synthase, which performs the second of two steps in the biosynthesis of 2S,3R-capreomycidine from arginine. Capreomycidine is an unusual amino acid used by non-ribosomal peptide synthases (NRPS) to make the tuberactinomycin class of peptide antibiotic. The best characterized member is VioD from the biosynthetic pathway for viomycin. [Cellular processes, Biosynthesis of natural products]


Pssm-ID: 188462  Cd Length: 359  Bit Score: 38.24  E-value: 4.84e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617  26 TPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFvfsSHLyskieliPVHLESQV---PRSNLDSFQLTVDK 102
Cdd:TIGR03947  65 RGGDAHVVMTTHGSSEAIYLVLTALLRPGDEVVVVDPAYHSL---SHL-------AVATGCEVrpwPLLAVRGFRPDLDA 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1387629617 103 LKLALTQAKKkakkvkgLVLIN-PQNPLGDVYTQSSLQEYLVFAKTHKLHVIMDEIYMLSVFEPSVtfhsvlsikdLPDP 181
Cdd:TIGR03947 135 LRALLTPRTR-------AVVVNfPHNPTGASVTPRELDELLERAARSGAVLLWDNAFADLVHDAPP----------LPDP 197
                         170       180
                  ....*....|....*....|....*
gi 1387629617 182 N--MTHMI-WGT-SKDFGMSGIRFG 202
Cdd:TIGR03947 198 SalYDRVIsFGTlSKAFGLPGLRVG 222
endura_MppQ TIGR04461
enduracididine biosynthesis enzyme MppQ; Members of this family are MppQ, one of three enzymes ...
10-65 4.93e-03

enduracididine biosynthesis enzyme MppQ; Members of this family are MppQ, one of three enzymes involved in synthesizing enduracididine, a non-proteinogenic amino acid used in non-ribosomal peptide synthases to make natural products such as enduracidin from Streptomyces fungicidicus ATCC 21013. MppQ is a PLP-dependent enzyme, predicted by homology to be an aminotransferase.


Pssm-ID: 275254  Cd Length: 392  Bit Score: 38.38  E-value: 4.93e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1387629617  10 LREELASFLThyCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYN 65
Cdd:TIGR04461  59 LRAALAARAG--TADGRPCGPEHVLVTAGTSQALHLLATLLARPGDTVLAEPLSYD 112
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH