NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1209185288|ref|NP_001339705|]
View 

junction plakoglobin [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
341-381 1.50e-07

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


:

Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 47.81  E-value: 1.50e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 1209185288  341 CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSD 381
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
PLN03200 super family cl33659
cellulose synthase-interactive protein; Provisional
328-658 1.25e-05

cellulose synthase-interactive protein; Provisional


The actual alignment was detected with superfamily member PLN03200:

Pssm-ID: 215629 [Multi-domain]  Cd Length: 2102  Bit Score: 48.95  E-value: 1.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  328 LWttsrVLKVL-SVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNC------------LWTLRNLSDVaTKQEGLESVLK 394
Cdd:PLN03200   978 LW----LLSVIaSHDAKSKLAIMEAGGIEVLTEKLASYTSNRQAEFedsesiwisallLAILFQDRDV-VRAPATMRAIP 1052
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  395 ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSG-VEALIHAILRAgdKDDItePAVCALRHLTS--RHPEAEM 471
Cdd:PLN03200  1053 SLANLLKSEETIDRYFAAQALASLVCNGSRGTLLAVANSGaVGGLISLLGCA--ESDI--SNLVALSEEFSlvRNPDQVA 1128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  472 AQNSVRLN---YG------IPAIVKLL----NQPNQWPLvkaTIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQD 537
Cdd:PLN03200  1129 LERLFRVEdirVGatarkaIPLLVDLLkpipDRPGAPPL---ALGLLTQLAEgSDVNKLAMAEAGALDALTKYLSLGPQD 1205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  538 AQrhvaagtqqpytdgvrmEEIVegcTGALHILARDPmnrmEIFR----LNTIPLFVQLLYSSVENIQRVAAGVLCELAQ 613
Cdd:PLN03200  1206 ST-----------------EEAA---SELLRILFSSP----ELRRhesaFGAVNQLVAVLRLGSRSARYSAARALQELFS 1261
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....*
gi 1209185288  614 DKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNP 658
Cdd:PLN03200  1262 AEHIRDSELARQAVQPLVEMLNTGSESEQHAAIGALIKLSSGNPS 1306
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
221-253 5.30e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


:

Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 40.88  E-value: 5.30e-05
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1209185288  221 AIFKSGGIPALVRMLSSPVESVLFYAITTLHNL 253
Cdd:smart00185   7 AVVDAGGLPALVELLKSEDEEVVKEAAWALSNL 39
 
Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
341-381 1.50e-07

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 47.81  E-value: 1.50e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 1209185288  341 CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSD 381
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
341-381 7.63e-07

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 45.90  E-value: 7.63e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1209185288 341 CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSD 381
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLAA 41
PLN03200 PLN03200
cellulose synthase-interactive protein; Provisional
328-658 1.25e-05

cellulose synthase-interactive protein; Provisional


Pssm-ID: 215629 [Multi-domain]  Cd Length: 2102  Bit Score: 48.95  E-value: 1.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  328 LWttsrVLKVL-SVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNC------------LWTLRNLSDVaTKQEGLESVLK 394
Cdd:PLN03200   978 LW----LLSVIaSHDAKSKLAIMEAGGIEVLTEKLASYTSNRQAEFedsesiwisallLAILFQDRDV-VRAPATMRAIP 1052
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  395 ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSG-VEALIHAILRAgdKDDItePAVCALRHLTS--RHPEAEM 471
Cdd:PLN03200  1053 SLANLLKSEETIDRYFAAQALASLVCNGSRGTLLAVANSGaVGGLISLLGCA--ESDI--SNLVALSEEFSlvRNPDQVA 1128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  472 AQNSVRLN---YG------IPAIVKLL----NQPNQWPLvkaTIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQD 537
Cdd:PLN03200  1129 LERLFRVEdirVGatarkaIPLLVDLLkpipDRPGAPPL---ALGLLTQLAEgSDVNKLAMAEAGALDALTKYLSLGPQD 1205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  538 AQrhvaagtqqpytdgvrmEEIVegcTGALHILARDPmnrmEIFR----LNTIPLFVQLLYSSVENIQRVAAGVLCELAQ 613
Cdd:PLN03200  1206 ST-----------------EEAA---SELLRILFSSP----ELRRhesaFGAVNQLVAVLRLGSRSARYSAARALQELFS 1261
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....*
gi 1209185288  614 DKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNP 658
Cdd:PLN03200  1262 AEHIRDSELARQAVQPLVEMLNTGSESEQHAAIGALIKLSSGNPS 1306
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
221-253 5.30e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 40.88  E-value: 5.30e-05
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1209185288  221 AIFKSGGIPALVRMLSSPVESVLFYAITTLHNL 253
Cdd:smart00185   7 AVVDAGGLPALVELLKSEDEEVVKEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
215-253 7.85e-05

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 40.12  E-value: 7.85e-05
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1209185288 215 HREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL 253
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
573-612 8.17e-05

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 40.12  E-value: 8.17e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 1209185288 573 DPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELA 612
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLA 40
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
573-613 4.35e-04

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 38.18  E-value: 4.35e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 1209185288  573 DPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQ 613
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
 
Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
341-381 1.50e-07

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 47.81  E-value: 1.50e-07
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 1209185288  341 CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSD 381
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
341-381 7.63e-07

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 45.90  E-value: 7.63e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1209185288 341 CPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSD 381
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLAA 41
PLN03200 PLN03200
cellulose synthase-interactive protein; Provisional
328-658 1.25e-05

cellulose synthase-interactive protein; Provisional


Pssm-ID: 215629 [Multi-domain]  Cd Length: 2102  Bit Score: 48.95  E-value: 1.25e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  328 LWttsrVLKVL-SVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNC------------LWTLRNLSDVaTKQEGLESVLK 394
Cdd:PLN03200   978 LW----LLSVIaSHDAKSKLAIMEAGGIEVLTEKLASYTSNRQAEFedsesiwisallLAILFQDRDV-VRAPATMRAIP 1052
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  395 ILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSG-VEALIHAILRAgdKDDItePAVCALRHLTS--RHPEAEM 471
Cdd:PLN03200  1053 SLANLLKSEETIDRYFAAQALASLVCNGSRGTLLAVANSGaVGGLISLLGCA--ESDI--SNLVALSEEFSlvRNPDQVA 1128
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  472 AQNSVRLN---YG------IPAIVKLL----NQPNQWPLvkaTIGLIRNLAL-CPANHAPLQEAAVIPRLVQLLVKAHQD 537
Cdd:PLN03200  1129 LERLFRVEdirVGatarkaIPLLVDLLkpipDRPGAPPL---ALGLLTQLAEgSDVNKLAMAEAGALDALTKYLSLGPQD 1205
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288  538 AQrhvaagtqqpytdgvrmEEIVegcTGALHILARDPmnrmEIFR----LNTIPLFVQLLYSSVENIQRVAAGVLCELAQ 613
Cdd:PLN03200  1206 ST-----------------EEAA---SELLRILFSSP----ELRRhesaFGAVNQLVAVLRLGSRSARYSAARALQELFS 1261
                          330       340       350       360
                   ....*....|....*....|....*....|....*....|....*
gi 1209185288  614 DKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNP 658
Cdd:PLN03200  1262 AEHIRDSELARQAVQPLVEMLNTGSESEQHAAIGALIKLSSGNPS 1306
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
221-253 5.30e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 40.88  E-value: 5.30e-05
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1209185288  221 AIFKSGGIPALVRMLSSPVESVLFYAITTLHNL 253
Cdd:smart00185   7 AVVDAGGLPALVELLKSEDEEVVKEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
215-253 7.85e-05

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 40.12  E-value: 7.85e-05
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1209185288 215 HREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNL 253
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
573-612 8.17e-05

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 334121 [Multi-domain]  Cd Length: 41  Bit Score: 40.12  E-value: 8.17e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 1209185288 573 DPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELA 612
Cdd:pfam00514   1 SPEQKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLA 40
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
573-613 4.35e-04

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547 [Multi-domain]  Cd Length: 41  Bit Score: 38.18  E-value: 4.35e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 1209185288  573 DPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQ 613
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Adaptin_N pfam01602
Adaptin N terminal region; This family consists of the N terminal region of various alpha, ...
120-524 3.46e-03

Adaptin N terminal region; This family consists of the N terminal region of various alpha, beta and gamma subunits of the AP-1, AP-2 and AP-3 adaptor protein complexes. The adaptor protein (AP) complexes are involved in the formation of clathrin-coated pits and vesicles. The N-terminal region of the various adaptor proteins (APs) is constant by comparison to the C-terminal which is variable within members of the AP-2 family; and it has been proposed that this constant region interacts with another uniform component of the coated vesicles.


Pssm-ID: 307641 [Multi-domain]  Cd Length: 523  Bit Score: 40.30  E-value: 3.46e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288 120 SQLLKSAIV---HLinYQDDAELATRALPELTKLLNDEDPVVVTKAAMivnqlskkeasrralmgspqLVAAVVRTMQNT 196
Cdd:pfam01602 128 PYVRKKAALailKL--YRKSPDLVRDFVPELKELLSDKDPGVQSAAVA--------------------LLYEICKNDRLY 185
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288 197 SDLdtarcttsiLHNLSHHREGLLAIFKSGGIPALVRMLSS-----PVESVLFyaITTLHNLL-------LYqEGAKMAV 264
Cdd:pfam01602 186 LKL---------LPLLFRRLCNLLGVLNPWLQVKILRLLTRlapldPLLPKEL--LEDLLNLLqnsnnavLY-ETANTIV 253
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288 265 RLADGLQKMVPLLNK---------NNPKFLAITTdcLQLLAYgnQESKLIilanggpQALVQIMRNYSYEKLLWTTSRVL 335
Cdd:pfam01602 254 HLAPAPELIVLAVNAlgrllsspdENLRYVALRN--LNKIVM--KEPKAV-------QHLDLIIFCLKTDDDISIRLRAL 322
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288 336 KVLS--VCPSNKPAIveaggMQALGKHLTSNS-PRLVQNCLWTLRNLSD-VATKQeglESVLKILVNQLSVDDVNVLTCA 411
Cdd:pfam01602 323 DLLYalVNESNVKEI-----VKELKKYVHEIAdPDFKIELVRAIGRLAEkFPTDA---EWYLDVLLDLLSLAGSYVVDEI 394
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1209185288 412 TGTLSNLTCNNSKNKTL-------VTQNSGVEALIHAIL----RAGDKDDITEPAVCALRHLTSRHpeaeMAQNSVRLNY 480
Cdd:pfam01602 395 VEVIRDIIQNVPELREYilehlceLLEDIESPEALAAALwilgEYGELIPNGSSPPDLLRSILEVF----VLESAKVRAA 470
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....
gi 1209185288 481 GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVI 524
Cdd:pfam01602 471 ALTALAKLGLTSPEETTQNLIIQLLLTLATQDSLDLEVRDRAVE 514
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH