NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|663071018|ref|NP_001284578|]
View 

CD81 antigen isoform 2 [Homo sapiens]

Protein Classification

CD81 antigen (domain architecture ID 10123558)

CD81 antigen is a transmembrane (TM) protein with four TM segments that may act as a molecular facilitator in diverse processes such as adhesion, morphology, migration, and differentiation.

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CD81_like_LEL cd03151
Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. ...
42-131 1.25e-33

Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD81, also referred to as Target for anti-proliferative antigen-1, TAPA-1, is found in virtually all tissues, may be involved in regulation of cell growth and has been described as a member of the CD19/CD21/Leu-13 signal transduction complex identified on B cells (the B-Cell co-receptor).


:

Pssm-ID: 239404  Cd Length: 84  Bit Score: 113.67  E-value: 1.25e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018  42 FVNKDQIAKDVKQFYDQALQQAVvDDDANNAKAVVKTFHETLDCCGSSTLTALtTSVLKNNLCPSGsniiSNLFKEDCHQ 121
Cdd:cd03151    1 FINKDQIIKEVQNFYDSAYQDAV-TDTRSKGTAVLKTFHSTLDCCGKGNLTAL-LSLLSTDLCPKK----LLLDTKDCHQ 74
                         90
                 ....*....|
gi 663071018 122 KIDDLFSGKL 131
Cdd:cd03151   75 EIDDLFSEKL 84
 
Name Accession Description Interval E-value
CD81_like_LEL cd03151
Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. ...
42-131 1.25e-33

Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD81, also referred to as Target for anti-proliferative antigen-1, TAPA-1, is found in virtually all tissues, may be involved in regulation of cell growth and has been described as a member of the CD19/CD21/Leu-13 signal transduction complex identified on B cells (the B-Cell co-receptor).


Pssm-ID: 239404  Cd Length: 84  Bit Score: 113.67  E-value: 1.25e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018  42 FVNKDQIAKDVKQFYDQALQQAVvDDDANNAKAVVKTFHETLDCCGSSTLTALtTSVLKNNLCPSGsniiSNLFKEDCHQ 121
Cdd:cd03151    1 FINKDQIIKEVQNFYDSAYQDAV-TDTRSKGTAVLKTFHSTLDCCGKGNLTAL-LSLLSTDLCPKK----LLLDTKDCHQ 74
                         90
                 ....*....|
gi 663071018 122 KIDDLFSGKL 131
Cdd:cd03151   75 EIDDLFSEKL 84
Tetraspannin pfam00335
Tetraspanin family;
1-155 3.16e-28

Tetraspanin family;


Pssm-ID: 334016  Cd Length: 179  Bit Score: 102.77  E-value: 3.16e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018    1 MMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFH 80
Cdd:pfam00335  55 IFLVGFLGCCGAIKENRCLLLTYFVLLLILFLLELAAGILAFVYRDKLSGLLSNWLKKSLEDGYEDWLDLYVTSALDSLQ 134
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 663071018   81 ETLDCCGSstltalttsvlknnlcpsgsniisnlfkedCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVL 155
Cdd:pfam00335 135 EEFGCCGG------------------------------CKEKLLEWLRSNLKIIGAGVIAIGIIQLLGIILACCL 179
 
Name Accession Description Interval E-value
CD81_like_LEL cd03151
Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. ...
42-131 1.25e-33

Tetraspanin, extracellular domain or large extracellular loop (LEL), CD81_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD81, also referred to as Target for anti-proliferative antigen-1, TAPA-1, is found in virtually all tissues, may be involved in regulation of cell growth and has been described as a member of the CD19/CD21/Leu-13 signal transduction complex identified on B cells (the B-Cell co-receptor).


Pssm-ID: 239404  Cd Length: 84  Bit Score: 113.67  E-value: 1.25e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018  42 FVNKDQIAKDVKQFYDQALQQAVvDDDANNAKAVVKTFHETLDCCGSSTLTALtTSVLKNNLCPSGsniiSNLFKEDCHQ 121
Cdd:cd03151    1 FINKDQIIKEVQNFYDSAYQDAV-TDTRSKGTAVLKTFHSTLDCCGKGNLTAL-LSLLSTDLCPKK----LLLDTKDCHQ 74
                         90
                 ....*....|
gi 663071018 122 KIDDLFSGKL 131
Cdd:cd03151   75 EIDDLFSEKL 84
Tetraspannin pfam00335
Tetraspanin family;
1-155 3.16e-28

Tetraspanin family;


Pssm-ID: 334016  Cd Length: 179  Bit Score: 102.77  E-value: 3.16e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018    1 MMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFH 80
Cdd:pfam00335  55 IFLVGFLGCCGAIKENRCLLLTYFVLLLILFLLELAAGILAFVYRDKLSGLLSNWLKKSLEDGYEDWLDLYVTSALDSLQ 134
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 663071018   81 ETLDCCGSstltalttsvlknnlcpsgsniisnlfkedCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVL 155
Cdd:pfam00335 135 EEFGCCGG------------------------------CKEKLLEWLRSNLKIIGAGVIAIGIIQLLGIILACCL 179
CD9_LEL cd03152
Tetraspanin, extracellular domain or large extracellular loop (LEL), CD9 family. Tetraspanins ...
42-131 1.43e-09

Tetraspanin, extracellular domain or large extracellular loop (LEL), CD9 family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD9 is found in virtually all tissues and is potentially involved in developmental processes. It associates with the tetraspanins CD81 and CD63, as well as with some integrin, and has been shown to be involved in a variety of activation, adhesion, and cell motility functions, as well as cell-cell interactions - such as during fertilization.


Pssm-ID: 239405  Cd Length: 84  Bit Score: 52.01  E-value: 1.43e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018  42 FVNKDQIAKDVKQFYDQALQQAVVDDDaNNAKAVVKTFHETLDCCGSSTLTALTTSVlknnLCPSGsNIISNLFKEDCHQ 121
Cdd:cd03152    1 FSNKDKVVKEVQTFYRQTYAKYKQSRD-PPLKETLKAIHFALDCCGPTGGLEQFVTD----TCPKK-EGLENLITKSCPD 74
                         90
                 ....*....|
gi 663071018 122 KIDDLFSGKL 131
Cdd:cd03152   75 AIDDVFNSKL 84
tetraspanin_LEL cd03127
Tetraspanin, extracellular domain or large extracellular loop (LEL). Tetraspanins are ...
42-131 1.56e-08

Tetraspanin, extracellular domain or large extracellular loop (LEL). Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. The tetraspanin family contains CD9, CD63, CD37, CD53, CD82, CD151, and CD81, amongst others. Tetraspanins are involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, cancer, and others. Their various functions may relate to their ability to act as molecular facilitators, grouping specific cell-surface proteins and affecting formation and stability of signaling complexes. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web", which may also include integrins.


Pssm-ID: 239401 [Multi-domain]  Cd Length: 90  Bit Score: 49.43  E-value: 1.56e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 663071018  42 FVNKDQIAKDVKQFYDQALQQAVVDDDANNAkavVKTFHETLDCCGSSTLTALTTSVLK-NNLCPSGSNII--SNLFKED 118
Cdd:cd03127    1 FVYRDQLESLVSDTLNDAWDEYYVDDDFQEA---MDALQSTFECCGVNGPTDYLDLRLLvPSSCCKGTDGNcgLNLYTEG 77
                         90
                 ....*....|...
gi 663071018 119 CHQKIDDLFSGKL 131
Cdd:cd03127   78 CLEKLVDFLRSNL 90
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH