NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|554790362|ref|NP_001273035|]
View 

autophagy protein 5 isoform a [Homo sapiens]

Protein Classification

APG5 domain-containing protein (domain architecture ID 10513754)

APG5 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
APG5 pfam04106
Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the ...
79-270 1.34e-96

Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway.


:

Pssm-ID: 309292  Cd Length: 191  Bit Score: 281.36  E-value: 1.34e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362   79 WHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCP-SKDAIEAHFMSCMKEADALKHKS-QVINEMQKKDHKQLWMG 156
Cdd:pfam04106   1 WHYPIGVLYDLLTGDPSLPWRLTLHFSDYPPDELLPLDaGEEAVKDYFMNQLKEADFLRNGSaKRIMSLSKEDSNQLWES 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362  157 LQNDRFDQFWAINRKLMEYPaeENGFRYIPFRIYQTTTeRPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKN 236
Cdd:pfam04106  81 VLNHDFDQFWSINNKLLPPP--GKPFRHIPVRIYLPDS-GPVIQPLVPPLNEDGQPQTLGDALSSLLPELFPSSRTPVLA 157
                         170       180       190
                  ....*....|....*....|....*....|....
gi 554790362  237 QVMIHGIEPMLETPLQWLSEHLSYPDNFLHISII 270
Cdd:pfam04106 158 RVVIHGIEIPLDTPLLWLYENLSYPDGFLHIVVV 191
 
Name Accession Description Interval E-value
APG5 pfam04106
Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the ...
79-270 1.34e-96

Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway.


Pssm-ID: 309292  Cd Length: 191  Bit Score: 281.36  E-value: 1.34e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362   79 WHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCP-SKDAIEAHFMSCMKEADALKHKS-QVINEMQKKDHKQLWMG 156
Cdd:pfam04106   1 WHYPIGVLYDLLTGDPSLPWRLTLHFSDYPPDELLPLDaGEEAVKDYFMNQLKEADFLRNGSaKRIMSLSKEDSNQLWES 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362  157 LQNDRFDQFWAINRKLMEYPaeENGFRYIPFRIYQTTTeRPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKN 236
Cdd:pfam04106  81 VLNHDFDQFWSINNKLLPPP--GKPFRHIPVRIYLPDS-GPVIQPLVPPLNEDGQPQTLGDALSSLLPELFPSSRTPVLA 157
                         170       180       190
                  ....*....|....*....|....*....|....
gi 554790362  237 QVMIHGIEPMLETPLQWLSEHLSYPDNFLHISII 270
Cdd:pfam04106 158 RVVIHGIEIPLDTPLLWLYENLSYPDGFLHIVVV 191
 
Name Accession Description Interval E-value
APG5 pfam04106
Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the ...
79-270 1.34e-96

Autophagy protein Apg5; Apg5 is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway.


Pssm-ID: 309292  Cd Length: 191  Bit Score: 281.36  E-value: 1.34e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362   79 WHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCP-SKDAIEAHFMSCMKEADALKHKS-QVINEMQKKDHKQLWMG 156
Cdd:pfam04106   1 WHYPIGVLYDLLTGDPSLPWRLTLHFSDYPPDELLPLDaGEEAVKDYFMNQLKEADFLRNGSaKRIMSLSKEDSNQLWES 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 554790362  157 LQNDRFDQFWAINRKLMEYPaeENGFRYIPFRIYQTTTeRPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKN 236
Cdd:pfam04106  81 VLNHDFDQFWSINNKLLPPP--GKPFRHIPVRIYLPDS-GPVIQPLVPPLNEDGQPQTLGDALSSLLPELFPSSRTPVLA 157
                         170       180       190
                  ....*....|....*....|....*....|....
gi 554790362  237 QVMIHGIEPMLETPLQWLSEHLSYPDNFLHISII 270
Cdd:pfam04106 158 RVVIHGIEIPLDTPLLWLYENLSYPDGFLHIVVV 191
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH