NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|454544286|ref|NP_001263625|]
View 

cellular tumor antigen p53 isoform i [Homo sapiens]

Protein Classification

P53 domain-containing protein (domain architecture ID 11109577)

P53 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
P53 pfam00870
P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). ...
56-250 1.22e-135

P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). This sequence is identical to human P53 and would appear to be a a human contaminant within the Zea mays sampling effort.


:

Pssm-ID: 307150  Cd Length: 196  Bit Score: 381.90  E-value: 1.22e-135
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286   56 SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR 135
Cdd:pfam00870   1 PTVPSTTDYPGSYGFELRFQQSGTAKSVTCTYSPDLNKLFCQLAKTCPIQVRVSTPPPPGTIVRATAVYKKSEHVAEVVR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286  136 RCPHHERCSD-SDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT 214
Cdd:pfam00870  81 RCPHHERSRDfNDGLAPASHLIRVEGNQLAQYVEDPVTGRHSVVVPYEPPQVGSEFTTILYNYMCNSSCMGGMNRRPILT 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 454544286  215 IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL 250
Cdd:pfam00870 161 IITLETREGQLLGRRSFEVRVCACPGRDRKTEEENY 196
 
Name Accession Description Interval E-value
P53 pfam00870
P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). ...
56-250 1.22e-135

P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). This sequence is identical to human P53 and would appear to be a a human contaminant within the Zea mays sampling effort.


Pssm-ID: 307150  Cd Length: 196  Bit Score: 381.90  E-value: 1.22e-135
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286   56 SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR 135
Cdd:pfam00870   1 PTVPSTTDYPGSYGFELRFQQSGTAKSVTCTYSPDLNKLFCQLAKTCPIQVRVSTPPPPGTIVRATAVYKKSEHVAEVVR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286  136 RCPHHERCSD-SDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT 214
Cdd:pfam00870  81 RCPHHERSRDfNDGLAPASHLIRVEGNQLAQYVEDPVTGRHSVVVPYEPPQVGSEFTTILYNYMCNSSCMGGMNRRPILT 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 454544286  215 IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL 250
Cdd:pfam00870 161 IITLETREGQLLGRRSFEVRVCACPGRDRKTEEENY 196
P53 cd08367
P53 DNA-binding domain; P53 is a tumor suppressor gene product; mutations in p53 or lack of ...
70-249 1.99e-96

P53 DNA-binding domain; P53 is a tumor suppressor gene product; mutations in p53 or lack of expression are found associated with a large fraction of all human cancers. P53 is activated by DNA damage and acts as a regulator of gene expression that ultimatively blocks progression through the cell cycle. P53 binds to DNA as a tetrameric transcription factor. In its inactive form, p53 is bound to the ring finger protein Mdm2, which promotes its ubiquitinylation and subsequent proteosomal degradation. Phosphorylation of p53 disrupts the Mdm2-p53 complex, while the stable and active p53 binds to regulatory regions of its target genes, such as the cyclin-kinase inhibitor p21, which complexes and inactivates cdk2 and other cyclin complexes.


Pssm-ID: 176262  Cd Length: 179  Bit Score: 281.85  E-value: 1.99e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286  70 FRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCsDSDGL 149
Cdd:cd08367    1 FEVTLDESGVAKSSTWTYSPKLNKLFVKMAKTCPIQFKVNPSPPPGLYVRAMLVYKDPEHVKEPVERCPNHRQG-DDGHT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286 150 APPQHLIRVEgNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRN 229
Cdd:cd08367   80 APNSHVIRCE-NPQAEYVGDAFTGRLSVVVPLEPPQVGSEYVTVLLQFMCQNSCPGGINRRPIQLVFTLEDENGNVLGRR 158
                        170       180
                 ....*....|....*....|
gi 454544286 230 SFEVRVCACPGRDRRTEEEN 249
Cdd:cd08367  159 VIEVRVCACPGRDRKNEEKA 178
 
Name Accession Description Interval E-value
P53 pfam00870
P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). ...
56-250 1.22e-135

P53 DNA-binding domain; This family contains one anomalous member, viz: Zea mays (Q6JAD8). This sequence is identical to human P53 and would appear to be a a human contaminant within the Zea mays sampling effort.


Pssm-ID: 307150  Cd Length: 196  Bit Score: 381.90  E-value: 1.22e-135
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286   56 SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR 135
Cdd:pfam00870   1 PTVPSTTDYPGSYGFELRFQQSGTAKSVTCTYSPDLNKLFCQLAKTCPIQVRVSTPPPPGTIVRATAVYKKSEHVAEVVR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286  136 RCPHHERCSD-SDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT 214
Cdd:pfam00870  81 RCPHHERSRDfNDGLAPASHLIRVEGNQLAQYVEDPVTGRHSVVVPYEPPQVGSEFTTILYNYMCNSSCMGGMNRRPILT 160
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 454544286  215 IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL 250
Cdd:pfam00870 161 IITLETREGQLLGRRSFEVRVCACPGRDRKTEEENY 196
P53 cd08367
P53 DNA-binding domain; P53 is a tumor suppressor gene product; mutations in p53 or lack of ...
70-249 1.99e-96

P53 DNA-binding domain; P53 is a tumor suppressor gene product; mutations in p53 or lack of expression are found associated with a large fraction of all human cancers. P53 is activated by DNA damage and acts as a regulator of gene expression that ultimatively blocks progression through the cell cycle. P53 binds to DNA as a tetrameric transcription factor. In its inactive form, p53 is bound to the ring finger protein Mdm2, which promotes its ubiquitinylation and subsequent proteosomal degradation. Phosphorylation of p53 disrupts the Mdm2-p53 complex, while the stable and active p53 binds to regulatory regions of its target genes, such as the cyclin-kinase inhibitor p21, which complexes and inactivates cdk2 and other cyclin complexes.


Pssm-ID: 176262  Cd Length: 179  Bit Score: 281.85  E-value: 1.99e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286  70 FRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCsDSDGL 149
Cdd:cd08367    1 FEVTLDESGVAKSSTWTYSPKLNKLFVKMAKTCPIQFKVNPSPPPGLYVRAMLVYKDPEHVKEPVERCPNHRQG-DDGHT 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 454544286 150 APPQHLIRVEgNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRN 229
Cdd:cd08367   80 APNSHVIRCE-NPQAEYVGDAFTGRLSVVVPLEPPQVGSEYVTVLLQFMCQNSCPGGINRRPIQLVFTLEDENGNVLGRR 158
                        170       180
                 ....*....|....*....|
gi 454544286 230 SFEVRVCACPGRDRRTEEEN 249
Cdd:cd08367  159 VIEVRVCACPGRDRKNEEKA 178
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH