NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|377520127|ref|NP_001243685.1|]
View 

PEX5-related protein isoform 8 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TPR_11 super family cl26002
TPR repeat;
139-369 2.70e-11

TPR repeat;


The actual alignment was detected with superfamily member TIGR02917:

Pssm-ID: 330823  Cd Length: 899  Bit Score: 65.49  E-value: 2.70e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  139 EEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 218
Cdd:TIGR02917  27 EAAKSYLQKNKYKAAIIQLKNALQKDPNDAEARFLLGKIYLALGDYAAAEKELRKALSLGYPKNQVLPLLARAYLLQGKF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  219 QDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMskspvdssvLEGVKELYLEAAHQNGDmiDPDLQTGLGVLFHLSGEF 298
Cdd:TIGR02917 107 QQVLDELPGKTLLDDEGAAELLALRGLAYLGLGQ---------LELAQKSYEQALAIDPR--SLYAKLGLAQLALAENRF 175
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 377520127  299 NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREA 369
Cdd:TIGR02917 176 DEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEA 246
 
Name Accession Description Interval E-value
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
139-369 2.70e-11

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 65.49  E-value: 2.70e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  139 EEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 218
Cdd:TIGR02917  27 EAAKSYLQKNKYKAAIIQLKNALQKDPNDAEARFLLGKIYLALGDYAAAEKELRKALSLGYPKNQVLPLLARAYLLQGKF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  219 QDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMskspvdssvLEGVKELYLEAAHQNGDmiDPDLQTGLGVLFHLSGEF 298
Cdd:TIGR02917 107 QQVLDELPGKTLLDDEGAAELLALRGLAYLGLGQ---------LELAQKSYEQALAIDPR--SLYAKLGLAQLALAENRF 175
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 377520127  299 NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREA 369
Cdd:TIGR02917 176 DEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEA 246
TadD COG5010
Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, ...
248-382 4.78e-08

Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, and vesicular transport, Extracellular structures];


Pssm-ID: 227343  Cd Length: 257  Bit Score: 53.59  E-value: 4.78e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 248 LTRRMSKSPVDSSVLEGVKELYLEA-AHQ---------NGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYS 317
Cdd:COG5010   56 LGAAVLRNPEDLSIAKLATALYLRGdADSslavlqksaIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWE 135
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 377520127 318 LWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:COG5010  136 AWNLLGAALDQLGRFDEARRAYRQALELAPNEPSIANNLGMSLLLRGDLEDAETLLLPAYLSPAA 200
TPR_12 pfam13424
Tetratricopeptide repeat;
317-382 2.12e-04

Tetratricopeptide repeat;


Pssm-ID: 315987  Cd Length: 77  Bit Score: 40.45  E-value: 2.12e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 377520127  317 SLWNRLGATLANGDRSEEAVEAYTRALEIQ--------PGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:pfam13424   4 TALNNLAAVLRRLGRYDEALELLEKALEIArrllgpdhPLTATTLLNLGRLYLELGRYEEALELLERALALAEK 77
PRK11189 PRK11189
lipoprotein NlpI; Provisional
288-337 1.39e-03

lipoprotein NlpI; Provisional


Pssm-ID: 236875  Cd Length: 296  Bit Score: 40.26  E-value: 1.39e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 377520127 288 LGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRlGATLANGDRSEEAVE 337
Cdd:PRK11189 104 LGIYLTQAGNFDAAYEAFDSVLELDPTyNYAYLNR-GIALYYGGRYELAQD 153
 
Name Accession Description Interval E-value
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
139-369 2.70e-11

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 65.49  E-value: 2.70e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  139 EEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 218
Cdd:TIGR02917  27 EAAKSYLQKNKYKAAIIQLKNALQKDPNDAEARFLLGKIYLALGDYAAAEKELRKALSLGYPKNQVLPLLARAYLLQGKF 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  219 QDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMskspvdssvLEGVKELYLEAAHQNGDmiDPDLQTGLGVLFHLSGEF 298
Cdd:TIGR02917 107 QQVLDELPGKTLLDDEGAAELLALRGLAYLGLGQ---------LELAQKSYEQALAIDPR--SLYAKLGLAQLALAENRF 175
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 377520127  299 NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREA 369
Cdd:TIGR02917 176 DEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEFEEA 246
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
136-356 4.07e-10

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 61.64  E-value: 4.07e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  136 GAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNT 215
Cdd:TIGR02917 263 AHYLKALVDFQKKNYEDARETLQDALKSAPEYLPALLLAGASEYQLGNLEQAYQYLNQILKYAPNSHQARRLLASIQLRL 342
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  216 GHQQDACDALKNWIKQNP-----------KY----------KYLVKSKKGSP---------GLTRRMSKSPVdssvlEGV 265
Cdd:TIGR02917 343 GRVDEAIATLSPALGLDPddpaalsllgeAYlalgdfekaaEYLAKATELDPenaaartqlGISKLSQGDPS-----EAI 417
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  266 KELyLEAAHQNGDMIDPDLqtgLGVLFHL-SGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALE 344
Cdd:TIGR02917 418 ADL-ETAAQLDPELGRADL---LLILSYLrSGQFDKALAAAKKLEKKQPDNASLHNLLGAIYLGKGDLAKAREAFEKALS 493
                         250
                  ....*....|..
gi 377520127  345 IQPGFIRSRYNL 356
Cdd:TIGR02917 494 IEPDFFPAAANL 505
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
145-382 2.19e-09

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 59.33  E-value: 2.19e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  145 LKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAvsytntghqqDACDA 224
Cdd:TIGR02917 578 LGKGQLKKALAILNEAADAAPDSPEAWLMLGRAQLAAGDLNKAVSSFKKLLALQPDSALALLLLA----------DAYAV 647
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  225 LKNWIKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELY--LEAAHQNgdmiDPDLQTGLGVLFHLSGEFNRAI 302
Cdd:TIGR02917 648 MKNYAKAITSLKRALELKPDNTEAQIGLAQLLLAAKRTESAKKIAksLQKQHPK----AALGFELEGDLYLRQKDYPAAI 723
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  303 DAFNAALTVRPEDYSLWNRLGATLANGDRSeEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:TIGR02917 724 QAYRKALKRAPSSQNAIKLHRALLASGNTA-EAVKTLEAWLKTHPNDAVLRTALAELYLAQKDYDKAIKHYQTVVKKAPD 802
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
141-379 1.68e-08

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 56.63  E-value: 1.68e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  141 GLKRLK--EGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQ 218
Cdd:TIGR02917 164 GLAQLAlaENRFDEARALIDEVLTADPGNVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALATILIEAGEF 243
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  219 QDA---CDALKNWIKQNPK---YKYLVKSKKG-----SPGLTRRMSKSP--VDSSVLEGVKELYL---EAAHQNGDMI-- 280
Cdd:TIGR02917 244 EEAekhADALLKKAPNSPLahyLKALVDFQKKnyedaRETLQDALKSAPeyLPALLLAGASEYQLgnlEQAYQYLNQIlk 323
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  281 ----DPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGAT-LANGDrSEEAVEAYTRALEIQPGFIRSRYN 355
Cdd:TIGR02917 324 yapnSHQARRLLASIQLRLGRVDEAIATLSPALGLDPDDPAALSLLGEAyLALGD-FEKAAEYLAKATELDPENAAARTQ 402
                         250       260
                  ....*....|....*....|....
gi 377520127  356 LGISCINLGAYREAVSNFLTALSL 379
Cdd:TIGR02917 403 LGISKLSQGDPSEAIADLETAAQL 426
TadD COG5010
Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, ...
248-382 4.78e-08

Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, and vesicular transport, Extracellular structures];


Pssm-ID: 227343  Cd Length: 257  Bit Score: 53.59  E-value: 4.78e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 248 LTRRMSKSPVDSSVLEGVKELYLEA-AHQ---------NGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYS 317
Cdd:COG5010   56 LGAAVLRNPEDLSIAKLATALYLRGdADSslavlqksaIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWE 135
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 377520127 318 LWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:COG5010  136 AWNLLGAALDQLGRFDEARRAYRQALELAPNEPSIANNLGMSLLLRGDLEDAETLLLPAYLSPAA 200
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
74-347 1.29e-07

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 52.93  E-value: 1.29e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  74 FERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAQNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVT 153
Cdd:COG0457    1 LKDLLLALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAGLLLLLALALLKLGRLEEALE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 154 ILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALA-VSYTNTGHQQDACDALKNWIKQN 232
Cdd:COG0457   81 LLEKALELELLPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLAlGALYELGDYEEALELYEKALELD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 233 PKYKYLVKSKKGSPGLTRRMSKspvdssvLEGVKELYLEAAHQNGDmIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVR 312
Cdd:COG0457  161 PELNELAEALLALGALLEALGR-------YEEALELLEKALKLNPD-DDAEALLNLGLLYLKLGKYEEALEYYEKALELD 232
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 377520127 313 PEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQP 347
Cdd:COG0457  233 PDNAEALYNLALLLLELGRYEEALEALEKALELDP 267
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
163-347 2.60e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 49.70  E-value: 2.60e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  163 QDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYkylVKSK 242
Cdd:TIGR02917 460 KQPDNASLHNLLGAIYLGKGDLAKAREAFEKALSIEPDFFPAAANLARIDIQEGNPDDAIQRFEKVLTIDPKN---LRAI 536
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  243 KGSPGLTRRMSKSpvdssvlEGVKELYLEAAHQNGDMIDPDLQtgLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRL 322
Cdd:TIGR02917 537 LALAGLYLRTGNE-------EEAVAWLEKAAELNPQEIEPALA--LAQYYLGKGQLKKALAILNEAADAAPDSPEAWLML 607
                         170       180
                  ....*....|....*....|....*.
gi 377520127  323 GAT-LANGDrSEEAVEAYTRALEIQP 347
Cdd:TIGR02917 608 GRAqLAAGD-LNKAVSSFKKLLALQP 632
YfgC COG4783
Putative Zn-dependent protease, contains TPR repeats [General function prediction only];
234-370 7.86e-06

Putative Zn-dependent protease, contains TPR repeats [General function prediction only];


Pssm-ID: 227122  Cd Length: 484  Bit Score: 47.78  E-value: 7.86e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 234 KYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGdmidPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRP 313
Cdd:COG4783  262 QSPPYNKLDSPDFQLARARIRAKYEALPNQQAADLLAKRSKRGG----LAAQYGRALQTYLAGQYDEALKLLQPLIAAQP 337
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 377520127 314 EDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAV 370
Cdd:COG4783  338 DNPYYLELAGDILLEANKAKEAIERLKKALALDPNSPLLQLNLAQALLKGGKPQEAI 394
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
116-382 3.46e-05

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 45.22  E-value: 3.46e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 116 ISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCL 195
Cdd:COG0457    7 ALAILLEALAKLLAEALALLEAGLALLELLGELAEALELLEEALELLPNSDLAGLLLLLALALLKLGRLEEALELLEKAL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 196 ELQ--PNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYKYLVKSKKGspGLTRRMSKspvdssvLEGVKELYLEAA 273
Cdd:COG0457   87 ELEllPNLAEALLNLGLLLEALGKYEEALELLEKALALDPDPDLAEALLAL--GALYELGD-------YEEALELYEKAL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 274 HQNGDMID-PDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIR 351
Cdd:COG0457  158 ELDPELNElAEALLALGALLEALGRYEEALELLEKALKLNPDdDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDNAE 237
                        250       260       270
                 ....*....|....*....|....*....|.
gi 377520127 352 SRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:COG0457  238 ALYNLALLLLELGRYEEALEALEKALELDPD 268
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
163-335 5.96e-05

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350  Cd Length: 899  Bit Score: 45.46  E-value: 5.96e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  163 QDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLkALMALAVSYTNTGHQQDACDALKNWIKQNPK-------- 234
Cdd:TIGR02917 698 QHPKAALGFELEGDLYLRQKDYPAAIQAYRKALKRAPSSQ-NAIKLHRALLASGNTAEAVKTLEAWLKTHPNdavlrtal 776
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  235 ---YKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYL-----------EAAHQNGDMIDPDLQTgLGVLFHLSGEFNR 300
Cdd:TIGR02917 777 aelYLAQKDYDKAIKHYQTVVKKAPDNAVVLNNLAWLYLelkdpraleyaERALKLAPNIPAILDT-LGWLLVEKGEADR 855
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 377520127  301 AIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEA 335
Cdd:TIGR02917 856 ALPLLRKAVNIAPEAAAIRYHLALALLATGRKAEA 890
3a0801s09 TIGR00990
mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) ...
288-390 6.27e-05

mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273380  Cd Length: 615  Bit Score: 44.97  E-value: 6.27e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  288 LGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRsEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYR 367
Cdd:TIGR00990 133 KGNKAYRNKDFNKAIKLYSKAIECKPDPVYYSNRAACHNALGDW-EKVVEDTTAALELDPDYSKALNRRANAYDGLGKYA 211
                          90       100
                  ....*....|....*....|...
gi 377520127  368 EAVSNFlTALSLQRKSRNQQQVP 390
Cdd:TIGR00990 212 DALLDL-TASCIIDGFRNEQSAQ 233
TPR_12 pfam13424
Tetratricopeptide repeat;
317-382 2.12e-04

Tetratricopeptide repeat;


Pssm-ID: 315987  Cd Length: 77  Bit Score: 40.45  E-value: 2.12e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 377520127  317 SLWNRLGATLANGDRSEEAVEAYTRALEIQ--------PGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRK 382
Cdd:pfam13424   4 TALNNLAAVLRRLGRYDEALELLEKALEIArrllgpdhPLTATTLLNLGRLYLELGRYEEALELLERALALAEK 77
NrfG COG4235
Cytochrome c-type biogenesis protein CcmH/NrfG [Energy production and conversion, ...
154-233 2.75e-04

Cytochrome c-type biogenesis protein CcmH/NrfG [Energy production and conversion, Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 226687  Cd Length: 287  Bit Score: 42.36  E-value: 2.75e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 154 ILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQD---ACDALKNWIK 230
Cdd:COG4235  142 IARLETHLQQNPGDAEGWDLLGRAYMALGRASDALLAYRNALRLAGDNPEILLGLAEALYYQAGQQMtakARALLRQALA 221

                 ...
gi 377520127 231 QNP 233
Cdd:COG4235  222 LDP 224
TPR COG0457
Tetratricopeptide (TPR) repeat [General function prediction only];
262-383 5.63e-04

Tetratricopeptide (TPR) repeat [General function prediction only];


Pssm-ID: 223533  Cd Length: 291  Bit Score: 41.37  E-value: 5.63e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127 262 LEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLsGEFNRAIDAFNAALTVRPEDYSL---WNRLGATLANGDRSEEAVEA 338
Cdd:COG0457  111 YEEALELLEKALALDPDPDLAEALLALGALYEL-GDYEEALELYEKALELDPELNELaeaLLALGALLEALGRYEEALEL 189
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 377520127 339 YTRALEIQPG-FIRSRYNLGISCINLGAYREAVSNFLTALSLQRKS 383
Cdd:COG0457  190 LEKALKLNPDdDAEALLNLGLLYLKLGKYEEALEYYEKALELDPDN 235
TadD COG5010
Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, ...
157-221 6.46e-04

Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking, secretion, and vesicular transport, Extracellular structures];


Pssm-ID: 227343  Cd Length: 257  Bit Score: 41.27  E-value: 6.46e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 377520127 157 MEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDA 221
Cdd:COG5010   89 LQKSAIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLGRFDEA 153
LcrH_SycD TIGR02552
type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in ...
292-395 1.08e-03

type III secretion low calcium response chaperone LcrH/SycD; Genes in this family are found in type III secretion operons. LcrH, from Yersinia is believed to have a regulatory function in the low-calcium response of the secretion system. The same protein is also known as SycD (SYC = Specific Yop Chaperone) for its chaperone role. In Pseudomonas, where the homolog is known as PcrH, the chaperone role has been demonstrated and the regulatory role appears to be absent. ScyD/LcrH contains three central tetratricopeptide-like repeats that are predicted to fold into an all-alpha-helical array.


Pssm-ID: 274197  Cd Length: 135  Bit Score: 38.81  E-value: 1.08e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  292 FHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVS 371
Cdd:TIGR02552  27 LYQQGRYDEALKLFQLLAAYDPYNSRYWLGLAACCQMLKEYEEAIDAYALAAALDPDDPRPYFHAAECLLALGEPESALK 106
                          90       100
                  ....*....|....*....|....
gi 377520127  372 NFLTALSLQRKSRNQQQVPHPAIS 395
Cdd:TIGR02552 107 ALDLAIEICGENPEYSELKERAEA 130
PRK11189 PRK11189
lipoprotein NlpI; Provisional
288-337 1.39e-03

lipoprotein NlpI; Provisional


Pssm-ID: 236875  Cd Length: 296  Bit Score: 40.26  E-value: 1.39e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 377520127 288 LGVLFHLSGEFNRAIDAFNAALTVRPE-DYSLWNRlGATLANGDRSEEAVE 337
Cdd:PRK11189 104 LGIYLTQAGNFDAAYEAFDSVLELDPTyNYAYLNR-GIALYYGGRYELAQD 153
type_IV_pilW TIGR02521
type IV pilus biogenesis/stability protein PilW; Members of this family are designated PilF ...
284-434 1.97e-03

type IV pilus biogenesis/stability protein PilW; Members of this family are designated PilF and PilW. This outer membrane protein is required both for pilus stability and for pilus function such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain.


Pssm-ID: 131573  Cd Length: 234  Bit Score: 39.63  E-value: 1.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 377520127  284 LQTGLGVLfhLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINL 363
Cdd:TIGR02521  35 VQLALGYL--EQGDLEVAKENLDKALEHDPDDYLAYLALALYYQQLGELEKAEDSFRRALTLNPNNGDVLNNYGTFLCQQ 112
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 377520127  364 GAYREAVSNFLTALSlqrksrnQQQVPHPAISgniwaALRIALSLMDQPELFQAANLgdldvLLRAFNLDP 434
Cdd:TIGR02521 113 GKYEQAMQQFEQAIE-------DPLYPQPARS-----LENAGLCALKAGDFDKAEKY-----LTRALQIDP 166
TPR_1 pfam00515
Tetratricopeptide repeat;
319-349 4.28e-03

Tetratricopeptide repeat;


Pssm-ID: 306905  Cd Length: 34  Bit Score: 36.25  E-value: 4.28e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 377520127  319 WNRLGATLANGDRSEEAVEAYTRALEIQPGF 349
Cdd:pfam00515   4 LYNLGNAYFKLGKYDEALEYYEKALELNPNN 34
TPR_16 pfam13432
Tetratricopeptide repeat; This family is found predominantly at the C-terminus of ...
296-348 5.45e-03

Tetratricopeptide repeat; This family is found predominantly at the C-terminus of transglutaminase enzyme core regions.


Pssm-ID: 315995  Cd Length: 68  Bit Score: 36.18  E-value: 5.45e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 377520127  296 GEFNRAIDAFNAALTVR---PEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPG 348
Cdd:pfam13432  11 GDYDDAAAALEAALARFpesPDAAEALLGLGLAALRQGRLAEAAAALRAALDAAPG 66
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH