NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|371873523|ref|NP_001243098|]
View 

apolipoprotein M isoform 2 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Lipocalin super family cl21528
Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small ...
1-115 1.42e-73

Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The family also encompasses the enzyme prostaglandin D synthase (EC:5.3.99.2). Alignment subsumes both the lipocalin and fatty acid binding protein signatures from PROSITE. This is supported on structural and functional grounds. The structure is an eight-stranded beta barrel.


The actual alignment was detected with superfamily member pfam11032:

Pssm-ID: 354854  Cd Length: 188  Bit Score: 216.40  E-value: 1.42e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 371873523    1 MAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPH 80
Cdd:pfam11032  74 MAACREEMKLDFRAAIRTKDGLCVPRKWIYLLPEGNTDLRTEGHPDMKTKLFPFRCPGCIILKETDNGYARFLLYNRLPH 153
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 371873523   81 PPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSN 115
Cdd:pfam11032 154 LEEECMEEFKNKSNCEDFKAFLKIPQNQDACEIED 188
 
Name Accession Description Interval E-value
ApoM pfam11032
ApoM domain; ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs). ...
1-115 1.42e-73

ApoM domain; ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs). ApoM is important in the formation of pre-ss-HDL and also in increasing cholesterol efflux from macrophage foam cells. Lipoproteins consist of lipids solubilized by apolipoproteins. ApoM lacks an external amphipathic motif and is uniquely secreted to plasma without cleavage of its terminal signal peptide.


Pssm-ID: 314072  Cd Length: 188  Bit Score: 216.40  E-value: 1.42e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 371873523    1 MAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPH 80
Cdd:pfam11032  74 MAACREEMKLDFRAAIRTKDGLCVPRKWIYLLPEGNTDLRTEGHPDMKTKLFPFRCPGCIILKETDNGYARFLLYNRLPH 153
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 371873523   81 PPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSN 115
Cdd:pfam11032 154 LEEECMEEFKNKSNCEDFKAFLKIPQNQDACEIED 188
 
Name Accession Description Interval E-value
ApoM pfam11032
ApoM domain; ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs). ...
1-115 1.42e-73

ApoM domain; ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs). ApoM is important in the formation of pre-ss-HDL and also in increasing cholesterol efflux from macrophage foam cells. Lipoproteins consist of lipids solubilized by apolipoproteins. ApoM lacks an external amphipathic motif and is uniquely secreted to plasma without cleavage of its terminal signal peptide.


Pssm-ID: 314072  Cd Length: 188  Bit Score: 216.40  E-value: 1.42e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 371873523    1 MAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPH 80
Cdd:pfam11032  74 MAACREEMKLDFRAAIRTKDGLCVPRKWIYLLPEGNTDLRTEGHPDMKTKLFPFRCPGCIILKETDNGYARFLLYNRLPH 153
                          90       100       110
                  ....*....|....*....|....*....|....*
gi 371873523   81 PPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSN 115
Cdd:pfam11032 154 LEEECMEEFKNKSNCEDFKAFLKIPQNQDACEIED 188
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH