NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|353411950|ref|NP_001238781|]
View 

phosphoinositide 3-kinase regulatory subunit 5 isoform 2 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PI3K_1B_p101 super family cl11126
Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific ...
1-494 0e+00

Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.


The actual alignment was detected with superfamily member pfam10486:

Pssm-ID: 313668  Cd Length: 859  Bit Score: 797.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950    1 MDSGYVEDSEESSSEWPwRRGSQERRGHRRPGQKF-IRIYKLFKSTSQLVLRRdsrslegssdtalplrrAGSLCSPLDE 79
Cdd:pfam10486 381 VDSDYCEDSDESSSSSP-RKEKKEKKSKSKSRSRLgQRIYRLFKPKSPLVLRR-----------------AKSLGNPEAK 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950   80 PVsPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQ----RRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRL 155
Cdd:pfam10486 443 DL-IPVRSKRSNSLPQQVLLLSPETPPLPPLQTLRhvcvRRRPILSCDEDTKATTLRVVVFGADRIAGKVARAYSNLRRK 521
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  156 ENNRPLLTRFFKLQFFYVPVKRSHGTSP-GACPPPRSQTPSPPTDSprhaSPGELGTTPWEESTNDISHYLGMLDPWYER 234
Cdd:pfam10486 522 ESTCPRLTRAFKLQFYFVPVKRDSSGPSpGAGHPPLSQSPSPLGSS----SSQDLNLPGVEDSTNDIAHYLGMLDPWYER 597
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  235 NVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS 314
Cdd:pfam10486 598 NVLSLLNLPSEVLCQQTSKPESESLESSEERLPILADLVLYYCRHAARPVLLQLYQAELTLAGGEKRTEVFIHSLELGHT 677
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  315 AATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV 394
Cdd:pfam10486 678 AGTRAIKAMGAASKRFGIDGDREAVPLTLEIVYNKVAISGRSQWSNEEKVCTSVNLIKACKNPEELDSKMECLQLTMTEV 757
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  395 VKRQNSKSKKGFNQ-ISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQ 473
Cdd:pfam10486 758 LKRQNSKSKKGFNQqISTSEVKVDKVQVIGAGNTTFAVCLDQDEKKILQSVTRCEVSVCYKPDSSTDWRLRKPLPSGQIQ 837
                         490       500
                  ....*....|....*....|..
gi 353411950  474 A-APDLCSLLCLPIMTFSGALP 494
Cdd:pfam10486 838 PlQPTFCSLLCLPITTFSGALP 859
 
Name Accession Description Interval E-value
PI3K_1B_p101 pfam10486
Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific ...
1-494 0e+00

Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.


Pssm-ID: 313668  Cd Length: 859  Bit Score: 797.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950    1 MDSGYVEDSEESSSEWPwRRGSQERRGHRRPGQKF-IRIYKLFKSTSQLVLRRdsrslegssdtalplrrAGSLCSPLDE 79
Cdd:pfam10486 381 VDSDYCEDSDESSSSSP-RKEKKEKKSKSKSRSRLgQRIYRLFKPKSPLVLRR-----------------AKSLGNPEAK 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950   80 PVsPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQ----RRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRL 155
Cdd:pfam10486 443 DL-IPVRSKRSNSLPQQVLLLSPETPPLPPLQTLRhvcvRRRPILSCDEDTKATTLRVVVFGADRIAGKVARAYSNLRRK 521
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  156 ENNRPLLTRFFKLQFFYVPVKRSHGTSP-GACPPPRSQTPSPPTDSprhaSPGELGTTPWEESTNDISHYLGMLDPWYER 234
Cdd:pfam10486 522 ESTCPRLTRAFKLQFYFVPVKRDSSGPSpGAGHPPLSQSPSPLGSS----SSQDLNLPGVEDSTNDIAHYLGMLDPWYER 597
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  235 NVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS 314
Cdd:pfam10486 598 NVLSLLNLPSEVLCQQTSKPESESLESSEERLPILADLVLYYCRHAARPVLLQLYQAELTLAGGEKRTEVFIHSLELGHT 677
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  315 AATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV 394
Cdd:pfam10486 678 AGTRAIKAMGAASKRFGIDGDREAVPLTLEIVYNKVAISGRSQWSNEEKVCTSVNLIKACKNPEELDSKMECLQLTMTEV 757
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  395 VKRQNSKSKKGFNQ-ISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQ 473
Cdd:pfam10486 758 LKRQNSKSKKGFNQqISTSEVKVDKVQVIGAGNTTFAVCLDQDEKKILQSVTRCEVSVCYKPDSSTDWRLRKPLPSGQIQ 837
                         490       500
                  ....*....|....*....|..
gi 353411950  474 A-APDLCSLLCLPIMTFSGALP 494
Cdd:pfam10486 838 PlQPTFCSLLCLPITTFSGALP 859
 
Name Accession Description Interval E-value
PI3K_1B_p101 pfam10486
Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific ...
1-494 0e+00

Phosphoinositide 3-kinase gamma adapter protein p101 subunit; Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.


Pssm-ID: 313668  Cd Length: 859  Bit Score: 797.38  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950    1 MDSGYVEDSEESSSEWPwRRGSQERRGHRRPGQKF-IRIYKLFKSTSQLVLRRdsrslegssdtalplrrAGSLCSPLDE 79
Cdd:pfam10486 381 VDSDYCEDSDESSSSSP-RKEKKEKKSKSKSRSRLgQRIYRLFKPKSPLVLRR-----------------AKSLGNPEAK 442
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950   80 PVsPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQ----RRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRL 155
Cdd:pfam10486 443 DL-IPVRSKRSNSLPQQVLLLSPETPPLPPLQTLRhvcvRRRPILSCDEDTKATTLRVVVFGADRIAGKVARAYSNLRRK 521
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  156 ENNRPLLTRFFKLQFFYVPVKRSHGTSP-GACPPPRSQTPSPPTDSprhaSPGELGTTPWEESTNDISHYLGMLDPWYER 234
Cdd:pfam10486 522 ESTCPRLTRAFKLQFYFVPVKRDSSGPSpGAGHPPLSQSPSPLGSS----SSQDLNLPGVEDSTNDIAHYLGMLDPWYER 597
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  235 NVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS 314
Cdd:pfam10486 598 NVLSLLNLPSEVLCQQTSKPESESLESSEERLPILADLVLYYCRHAARPVLLQLYQAELTLAGGEKRTEVFIHSLELGHT 677
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  315 AATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV 394
Cdd:pfam10486 678 AGTRAIKAMGAASKRFGIDGDREAVPLTLEIVYNKVAISGRSQWSNEEKVCTSVNLIKACKNPEELDSKMECLQLTMTEV 757
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 353411950  395 VKRQNSKSKKGFNQ-ISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQ 473
Cdd:pfam10486 758 LKRQNSKSKKGFNQqISTSEVKVDKVQVIGAGNTTFAVCLDQDEKKILQSVTRCEVSVCYKPDSSTDWRLRKPLPSGQIQ 837
                         490       500
                  ....*....|....*....|..
gi 353411950  474 A-APDLCSLLCLPIMTFSGALP 494
Cdd:pfam10486 838 PlQPTFCSLLCLPITTFSGALP 859
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH