NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|325995161|ref|NP_001191840.1|]
View 

U6 snRNA phosphodiesterase isoform 3 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HVSL super family cl28765
Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues ...
44-151 3.88e-38

Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues conserved from plants to humans. It contains two conserved motifs, HxSL and FHVSL. The function is unknown.


The actual alignment was detected with superfamily member pfam09749:

Pssm-ID: 313045  Cd Length: 227  Bit Score: 133.11  E-value: 3.88e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325995161   44 PVPDSVLNMFPGTEE-GPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYV----------PR 112
Cdd:pfam09749   2 PLPSSFLDLYASTVRtSTEDDPSLHGGRKRSFPHVEGNWPTHVYIEWHPSESERELLSELLSQLQESGsqvkihslltSD 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 325995161  113 LVRMKVFHLSLSQSVVLRHHWILPFVQALKARM-TSFHSP 151
Cdd:pfam09749  82 LGVPLPLHISLSRTVVLRTHQIDSFLDSLKQALrSSGIRP 121
 
Name Accession Description Interval E-value
HVSL pfam09749
Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues ...
44-151 3.88e-38

Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues conserved from plants to humans. It contains two conserved motifs, HxSL and FHVSL. The function is unknown.


Pssm-ID: 313045  Cd Length: 227  Bit Score: 133.11  E-value: 3.88e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325995161   44 PVPDSVLNMFPGTEE-GPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYV----------PR 112
Cdd:pfam09749   2 PLPSSFLDLYASTVRtSTEDDPSLHGGRKRSFPHVEGNWPTHVYIEWHPSESERELLSELLSQLQESGsqvkihslltSD 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 325995161  113 LVRMKVFHLSLSQSVVLRHHWILPFVQALKARM-TSFHSP 151
Cdd:pfam09749  82 LGVPLPLHISLSRTVVLRTHQIDSFLDSLKQALrSSGIRP 121
 
Name Accession Description Interval E-value
HVSL pfam09749
Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues ...
44-151 3.88e-38

Uncharacterized conserved protein; This entry is of proteins of approximately 300 residues conserved from plants to humans. It contains two conserved motifs, HxSL and FHVSL. The function is unknown.


Pssm-ID: 313045  Cd Length: 227  Bit Score: 133.11  E-value: 3.88e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 325995161   44 PVPDSVLNMFPGTEE-GPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYV----------PR 112
Cdd:pfam09749   2 PLPSSFLDLYASTVRtSTEDDPSLHGGRKRSFPHVEGNWPTHVYIEWHPSESERELLSELLSQLQESGsqvkihslltSD 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 325995161  113 LVRMKVFHLSLSQSVVLRHHWILPFVQALKARM-TSFHSP 151
Cdd:pfam09749  82 LGVPLPLHISLSRTVVLRTHQIDSFLDSLKQALrSSGIRP 121
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH