NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|315113903|ref|NP_001186699|]
View 

homeobox protein OTX1 [Homo sapiens]

Protein Classification

homeodomain and TF_Otx domain-containing protein (domain architecture ID 11079031)

homeodomain and TF_Otx domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
42-95 1.41e-26

Homeobox domain;


:

Pssm-ID: 333795  Cd Length: 55  Bit Score: 99.87  E-value: 1.41e-26
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 315113903   42 RTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 95
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWKR 55
TF_Otx pfam03529
Otx1 transcription factor;
178-274 4.93e-21

Otx1 transcription factor;


:

Pssm-ID: 308893  Cd Length: 92  Bit Score: 86.06  E-value: 4.93e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113903  178 SPASISPgsapasvsVPEPLAaPSNTSCMQRSVAAGAATaaaSYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHS 257
Cdd:pfam03529   1 SPASISP--------LPDPLS-PSSASCMQRSVSSTASS---SYPMSYNQASAYSQGYPAGSSSYFGGVDCSSYLSPMHS 68
                          90
                  ....*....|....*....
gi 315113903  258 H--HHPHQLSPMAPSSMAG 274
Cdd:pfam03529  69 QlhHPGHQLSPMTASSMSG 87
 
Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
42-95 1.41e-26

Homeobox domain;


Pssm-ID: 333795  Cd Length: 55  Bit Score: 99.87  E-value: 1.41e-26
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 315113903   42 RTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 95
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWKR 55
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
39-97 3.90e-24

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 93.46  E-value: 3.90e-24
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 315113903  39 RRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQ 97
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
38-94 1.37e-23

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 91.93  E-value: 1.37e-23
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 315113903    38 QRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
TF_Otx pfam03529
Otx1 transcription factor;
178-274 4.93e-21

Otx1 transcription factor;


Pssm-ID: 308893  Cd Length: 92  Bit Score: 86.06  E-value: 4.93e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113903  178 SPASISPgsapasvsVPEPLAaPSNTSCMQRSVAAGAATaaaSYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHS 257
Cdd:pfam03529   1 SPASISP--------LPDPLS-PSSASCMQRSVSSTASS---SYPMSYNQASAYSQGYPAGSSSYFGGVDCSSYLSPMHS 68
                          90
                  ....*....|....*....
gi 315113903  258 H--HHPHQLSPMAPSSMAG 274
Cdd:pfam03529  69 QlhHPGHQLSPMTASSMSG 87
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
36-116 9.08e-16

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863 [Multi-domain]  Cd Length: 156  Bit Score: 73.62  E-value: 9.08e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113903  36 RKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG----SGTKSRPAKKK 111
Cdd:COG5576   49 SPPKSKRRRTTDEQLMVLEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKRSGKveqrPGEEEADLAKI 128

                 ....*
gi 315113903 112 SSPVR 116
Cdd:COG5576  129 GSLST 133
 
Name Accession Description Interval E-value
Homeobox pfam00046
Homeobox domain;
42-95 1.41e-26

Homeobox domain;


Pssm-ID: 333795  Cd Length: 55  Bit Score: 99.87  E-value: 1.41e-26
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 315113903   42 RTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQ 95
Cdd:pfam00046   2 RTTFTPEQLEELEKEFQKNPYPSREEREELAAKLGLTERQVKVWFQNRRAKWKR 55
homeodomain cd00086
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
39-97 3.90e-24

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


Pssm-ID: 238039  Cd Length: 59  Bit Score: 93.46  E-value: 3.90e-24
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 315113903  39 RRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQ 97
Cdd:cd00086    1 RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRSE 59
HOX smart00389
Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key ...
38-94 1.37e-23

Homeodomain; DNA-binding factors that are involved in the transcriptional regulation of key developmental processes


Pssm-ID: 197696  Cd Length: 57  Bit Score: 91.93  E-value: 1.37e-23
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 315113903    38 QRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94
Cdd:smart00389   1 KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKWK 57
TF_Otx pfam03529
Otx1 transcription factor;
178-274 4.93e-21

Otx1 transcription factor;


Pssm-ID: 308893  Cd Length: 92  Bit Score: 86.06  E-value: 4.93e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113903  178 SPASISPgsapasvsVPEPLAaPSNTSCMQRSVAAGAATaaaSYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHS 257
Cdd:pfam03529   1 SPASISP--------LPDPLS-PSSASCMQRSVSSTASS---SYPMSYNQASAYSQGYPAGSSSYFGGVDCSSYLSPMHS 68
                          90
                  ....*....|....*....
gi 315113903  258 H--HHPHQLSPMAPSSMAG 274
Cdd:pfam03529  69 QlhHPGHQLSPMTASSMSG 87
COG5576 COG5576
Homeodomain-containing transcription factor [Transcription];
36-116 9.08e-16

Homeodomain-containing transcription factor [Transcription];


Pssm-ID: 227863 [Multi-domain]  Cd Length: 156  Bit Score: 73.62  E-value: 9.08e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113903  36 RKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG----SGTKSRPAKKK 111
Cdd:COG5576   49 SPPKSKRRRTTDEQLMVLEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKKRSGKveqrPGEEEADLAKI 128

                 ....*
gi 315113903 112 SSPVR 116
Cdd:COG5576  129 GSLST 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH