NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|312836765|ref|NP_001186109|]
View 

calcium-transporting ATPase type 2C member 1 isoform 2a [Homo sapiens]

Protein Classification

ATPase-IIA2_Ca family protein (domain architecture ID 11492722)

ATPase-IIA2_Ca family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
57-937 0e+00

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


:

Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 1592.56  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   57 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNEFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 134
Cdd:TIGR01522   1 SKQYCELSVEETCSKLQTDLQNGLNsSQEASHRRAFHGWNEFDVEEDESLWKKFLSQFvKNPLILLLIASAVISVFMGNI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  135 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 214
Cdd:TIGR01522  81 DDAVSITLAILIVVTVGFVQEYRSEKSLEALNKLVPPECHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  215 LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQK 294
Cdd:TIGR01522 161 LSIDESNLTGETTPVSKVTAPIPAATNGDLAERSNIAFMGTLVRCGHGKGIVVGTGSNTEFGAVFKMMQAIEKPKTPLQK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  295 SMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 374
Cdd:TIGR01522 241 SMDLLGKQLSLVSFGVIGVICLVGWFQGKDWLEMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVET 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  375 LGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNN- 453
Cdd:TIGR01522 321 LGSVNVICSDKTGTLTKNHMTVTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLCNNAKFRNEa 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  454 -TLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRtqQDRPEICFMKGAYEQVIKYCTTYQSK-G 531
Cdd:TIGR01522 401 dTLLGNPTDVALIELLMKFGLDDLRETYIRVAEVPFSSERKWMAVKCVHR--QDRSEMCFMKGAYEQVLKYCTYYQKKdG 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  532 QTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 611
Cdd:TIGR01522 479 KTLTLTQQQRDVIQEEAAEMASAGLRVIAFASGPEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETA 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  612 VAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 691
Cdd:TIGR01522 559 VSIARRLGMPSKTSQSVSGEKLDAMDDQQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADI 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  692 GVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWI 771
Cdd:TIGR01522 639 GVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKGIFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWI 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  772 NIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVF 851
Cdd:TIGR01522 719 NILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKDLIKKILVSAIIIVVGTLFVFVREMQDGVITARDTTMTFTCFVF 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  852 FDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKK 931
Cdd:TIGR01522 799 FDMFNALACRSQTKSVFEIGFFSNRMFNYAVGGSIIGQLLVIYFPPLQSVFQTEALSIKDLLFLLLITSSVCIVDEIRKK 878

                  ....*.
gi 312836765  932 VERSRE 937
Cdd:TIGR01522 879 VERSRE 884
 
Name Accession Description Interval E-value
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
57-937 0e+00

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 1592.56  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   57 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNEFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 134
Cdd:TIGR01522   1 SKQYCELSVEETCSKLQTDLQNGLNsSQEASHRRAFHGWNEFDVEEDESLWKKFLSQFvKNPLILLLIASAVISVFMGNI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  135 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 214
Cdd:TIGR01522  81 DDAVSITLAILIVVTVGFVQEYRSEKSLEALNKLVPPECHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  215 LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQK 294
Cdd:TIGR01522 161 LSIDESNLTGETTPVSKVTAPIPAATNGDLAERSNIAFMGTLVRCGHGKGIVVGTGSNTEFGAVFKMMQAIEKPKTPLQK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  295 SMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 374
Cdd:TIGR01522 241 SMDLLGKQLSLVSFGVIGVICLVGWFQGKDWLEMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVET 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  375 LGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNN- 453
Cdd:TIGR01522 321 LGSVNVICSDKTGTLTKNHMTVTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLCNNAKFRNEa 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  454 -TLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRtqQDRPEICFMKGAYEQVIKYCTTYQSK-G 531
Cdd:TIGR01522 401 dTLLGNPTDVALIELLMKFGLDDLRETYIRVAEVPFSSERKWMAVKCVHR--QDRSEMCFMKGAYEQVLKYCTYYQKKdG 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  532 QTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 611
Cdd:TIGR01522 479 KTLTLTQQQRDVIQEEAAEMASAGLRVIAFASGPEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETA 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  612 VAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 691
Cdd:TIGR01522 559 VSIARRLGMPSKTSQSVSGEKLDAMDDQQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADI 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  692 GVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWI 771
Cdd:TIGR01522 639 GVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKGIFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWI 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  772 NIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVF 851
Cdd:TIGR01522 719 NILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKDLIKKILVSAIIIVVGTLFVFVREMQDGVITARDTTMTFTCFVF 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  852 FDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKK 931
Cdd:TIGR01522 799 FDMFNALACRSQTKSVFEIGFFSNRMFNYAVGGSIIGQLLVIYFPPLQSVFQTEALSIKDLLFLLLITSSVCIVDEIRKK 878

                  ....*.
gi 312836765  932 VERSRE 937
Cdd:TIGR01522 879 VERSRE 884
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
88-930 0e+00

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 1592.04  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  88 RRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSK 167
Cdd:cd02085    1 RRKLHGPNEFKVEDEEPLWKKYLEQFKNPLILLLLGSAVVSVVMKQYDDAVSITVAILIVVTVAFVQEYRSEKSLEALNK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 168 LVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASR 247
Cdd:cd02085   81 LVPPECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSKTTEVIPKASNGDLTTR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 248 SNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILE 327
Cdd:cd02085  161 SNIAFMGTLVRCGHGKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDKLGKQLSLYSFIIIGVIMLIGWLQGKNLLE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 328 MFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglha 407
Cdd:cd02085  241 MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT------ 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 408 evtgvgynqfgevivdgdvvhgfynpavsriveaGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYP 487
Cdd:cd02085  315 ----------------------------------GCVCNNAVIRNNTLMGQPTEGALIALAMKMGLSDIRETYIRKQEIP 360
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 488 FSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQT-LTLTQQQRDVYQQEKARMGSAGLRVLALASGPE 566
Cdd:cd02085  361 FSSEQKWMAVKCIPKYNSDNEEIYFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEINEEEKEMGSKGLRVLALASGPE 440
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 567 LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVP 646
Cdd:cd02085  441 LGDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITGDAQETAIAIGSSLGLYSPSLQALSGEEVDQMSDSQLASVVR 520
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 647 KVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEG 726
Cdd:cd02085  521 KVTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEG 600
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 727 KGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILT 806
Cdd:cd02085  601 KGIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILT 680
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 807 KNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSI 886
Cdd:cd02085  681 RSLILNVLLSAAIIVSGTLWVFWKEMSDDNVTPRDTTMTFTCFVFFDMFNALSCRSQTKSIFEIGFFSNRMFLYAVGGSL 760
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....
gi 312836765 887 MGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 930
Cdd:cd02085  761 IGQLLVIYFPPLQRVFQTEALGLLDLLFLLGLTSSVFIVSELRK 804
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
48-904 0e+00

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 812.34  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  48 NETMIPVLTSKKASELPVS--EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASA 125
Cdd:COG0474   11 NKSSSTPVTSETWHPLSVErnELLLELFTSPTTGLSEEEVKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 126 VISVLMHQF----DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGD 201
Cdd:COG0474   91 LLSAFVGDWvdagVDAIVILLVVVINALLGFVQEYRAEKALEALKKMSSPKAKVLRDGKFVEIPASELVPGDIVLLEAGD 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 202 RVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKM 281
Cdd:COG0474  171 VVPADLRLLESSDLEVDESALTGESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRAKGIVVATGFETEFGKIARL 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 282 MQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV 360
Cdd:COG0474  251 LPTKKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGLFRGGnGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMA 330
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 361 KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHaevtgvgynqfgevivDGDVVHGFYNPAVSRIVE 440
Cdd:COG0474  331 KDNAIVRSLNAIETLGSVDVICSDKTGTLTQNKMTVKKIYINGGGK----------------DIDDKDLKDSPALLRFLL 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 441 AGCVCNDAVI--RNNTLMGKPTEGALIALAMKMG----LDGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPeICFMK 514
Cdd:COG0474  395 AAALCNSVTPekNGWYQAGDPTEGALVEFAEKLGfsldLSGLEVEYPILAEIPFDSERKRMSV--IVKTDEGKY-ILFVK 471
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 515 GAYEQVIKYCTTYqskGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQ-LTFLGLVGIIDPP 582
Cdd:COG0474  472 GAPEVILERCKSI---GELEPLTEEGLRTLEEAVKELASEGLRVLAVAYKKldraekddevdEIESdLVFLGLTGIEDPP 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 583 RTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQS--VSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM 660
Cdd:COG0474  549 REDVKEAIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESAlvIDGAELDALSDEELAELVEELSVFARVSPEQKA 628
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 661 KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQ 740
Cdd:COG0474  629 RIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYL 708
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 741 LSTSIAALTLISLATLMNFPN-PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILK-ILVSSI 818
Cdd:COG0474  709 LSKNVGEVLTLLIYSLFNLFFlPLTPLQLLWINLLTDSLPALALGVEDPESDVMKRPPRGPEEGLFNRKIFWRfILIIGL 788
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 819 IIVCGTLFVF--------WRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQL 890
Cdd:COG0474  789 LSAILFILTFllyllgfiANTLGLDLFQALLQTTAFTVLVLIQLLLTLAVRSRGRPFLSSLLFSNKYLWLALLVIIILQL 868
                        890
                 ....*....|....*
gi 312836765 891 LVIYFPPLQ-KVFQT 904
Cdd:COG0474  869 LIIFLPPLNlKIFQP 883
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
52-828 5.45e-104

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 345.13  E-value: 5.45e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  52 IPVLTSKKASELPVSEVASILQA--DLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV 129
Cdd:PRK10517  38 VPPSLSARCLKAAVMPEEELWKTfdTHPEGLNEAEVESAREQHGENELPAQKPLPWWVHLWVCYRNPFNILLTILGAISY 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 130 LMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR--EGKLEHTLA----RDLVPGDTVCLSVGDRV 203
Cdd:PRK10517 118 ATEDLFAAGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRviNDKGENGWLeipiDQLVPGDIIKLAAGDMI 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 204 PADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ 283
Cdd:PRK10517 198 PADLRILQARDLFVAQASLTGESLPVEKFATTRQPEHSNPL-ECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLAGRVS 276
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 284 AEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV-GWLLGkDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 362
Cdd:PRK10517 277 EQDSEPNAFQQGISRVSWLLIRFMLVMAPVVLLInGYTKG-DWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQ 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 363 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEmtvthIFTSDglHAEVtgvgynqFGEviVDGDVVH-----GFYNPAVSR 437
Cdd:PRK10517 356 KVIVKRLDAIQNFGAMDILCTDKTGTLTQDK-----IVLEN--HTDI-------SGK--TSERVLHsawlnSHYQTGLKN 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 438 IVEAgcvcndAVIrnntlmgkptEGALIALAMKMGldglqQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPE-ICfmKGA 516
Cdd:PRK10517 420 LLDT------AVL----------EGVDEESARSLA-----SRWQKIDEIPFDFERRRMSV--VVAENTEHHQlIC--KGA 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 517 YEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQLTFLGLVGIIDPPRTG 585
Cdd:PRK10517 475 LEEILNVCSQVRHNGEIVPLDDIMLRRIKRVTDTLNRQGLRVVAVATKYlparegdyqraDESDLILEGYIAFLDPPKET 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 586 VKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKS 665
Cdd:PRK10517 555 TAPALKALKASGVTVKILTGDSELVAAKVCHEVGL--DAGEVLIGSDIETLSDDELANLAERTTLFARLTPMHKERIVTL 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 666 LQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSI 745
Cdd:PRK10517 633 LKREGHVVGFMGDGINDAPALRAADIGISV-DGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNF 711
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 746 AAL--TLISLATLmnfPN-PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKPPRnWKDSILTKNLILKILVSSII-I 820
Cdd:PRK10517 712 GNVfsVLVASAFL---PFlPMLPLHLLIQNLLYD--VSQvAIPFDNVDDEQIQKPQR-WNPADLGRFMVFFGPISSIFdI 785
                        810
                 ....*....|
gi 312836765 821 VCGTL--FVF 828
Cdd:PRK10517 786 LTFCLmwWVF 795
E1-E2_ATPase pfam00122
E1-E2 ATPase;
170-362 3.77e-49

E1-E2 ATPase;


Pssm-ID: 333857 [Multi-domain]  Cd Length: 178  Bit Score: 171.59  E-value: 3.77e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  170 PPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSN 249
Cdd:pfam00122   1 PPTATVLRDGTEEEIPADELVPGDIVLLKPGERVPADGRIVEGSA-SVDESALTGESLPVEK--------------EKGD 65
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  250 IAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMF 329
Cdd:pfam00122  66 MVFSGTVVVSGSAKAVVTATGEDTELGKIARLVEEAKSKKTPLQRLLDKLAKYFTPVVLLLALAVFLLWLFVGGPPLEAL 145
                         170       180       190
                  ....*....|....*....|....*....|...
gi 312836765  330 TISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 362
Cdd:pfam00122 146 LRALALLVAACPCALPLATPLALALGARRLAKK 178
Cation_ATPase_N smart00831
Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region ...
63-131 2.35e-17

Cation transporter/ATPase, N-terminus; This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases.


Pssm-ID: 214842 [Multi-domain]  Cd Length: 75  Bit Score: 77.24  E-value: 2.35e-17
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 312836765    63 LPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLM 131
Cdd:smart00831   7 LSLEEVLERLQTDLEKGLSSEEAARRLERYGPNELPPPKKTSPLLRFLRQFHNPLIYILLAAAVLSALL 75
 
Name Accession Description Interval E-value
ATPase-IIA2_Ca TIGR01522
golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
57-937 0e+00

golgi membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.


Pssm-ID: 130585 [Multi-domain]  Cd Length: 884  Bit Score: 1592.56  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   57 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNEFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 134
Cdd:TIGR01522   1 SKQYCELSVEETCSKLQTDLQNGLNsSQEASHRRAFHGWNEFDVEEDESLWKKFLSQFvKNPLILLLIASAVISVFMGNI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  135 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 214
Cdd:TIGR01522  81 DDAVSITLAILIVVTVGFVQEYRSEKSLEALNKLVPPECHLIREGKLEHVLASTLVPGDLVCLSVGDRVPADLRIVEAVD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  215 LSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQK 294
Cdd:TIGR01522 161 LSIDESNLTGETTPVSKVTAPIPAATNGDLAERSNIAFMGTLVRCGHGKGIVVGTGSNTEFGAVFKMMQAIEKPKTPLQK 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  295 SMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 374
Cdd:TIGR01522 241 SMDLLGKQLSLVSFGVIGVICLVGWFQGKDWLEMFTISVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIVRKLPSVET 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  375 LGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNN- 453
Cdd:TIGR01522 321 LGSVNVICSDKTGTLTKNHMTVTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLCNNAKFRNEa 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  454 -TLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRtqQDRPEICFMKGAYEQVIKYCTTYQSK-G 531
Cdd:TIGR01522 401 dTLLGNPTDVALIELLMKFGLDDLRETYIRVAEVPFSSERKWMAVKCVHR--QDRSEMCFMKGAYEQVLKYCTYYQKKdG 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  532 QTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 611
Cdd:TIGR01522 479 KTLTLTQQQRDVIQEEAAEMASAGLRVIAFASGPEKGQLTFLGLVGINDPPRPGVKEAVTTLITGGVRIIMITGDSQETA 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  612 VAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 691
Cdd:TIGR01522 559 VSIARRLGMPSKTSQSVSGEKLDAMDDQQLSQIVPKVAVFARASPEHKMKIVKALQKRGDVVAMTGDGVNDAPALKLADI 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  692 GVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWI 771
Cdd:TIGR01522 639 GVAMGQTGTDVAKEAADMILTDDDFATILSAIEEGKGIFNNIKNFITFQLSTSVAALSLIALATLMGFPNPLNAMQILWI 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  772 NIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVF 851
Cdd:TIGR01522 719 NILMDGPPAQSLGVEPVDKDVMRKPPRPRNDKILTKDLIKKILVSAIIIVVGTLFVFVREMQDGVITARDTTMTFTCFVF 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  852 FDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKK 931
Cdd:TIGR01522 799 FDMFNALACRSQTKSVFEIGFFSNRMFNYAVGGSIIGQLLVIYFPPLQSVFQTEALSIKDLLFLLLITSSVCIVDEIRKK 878

                  ....*.
gi 312836765  932 VERSRE 937
Cdd:TIGR01522 879 VERSRE 884
P-type_ATPase_SPCA cd02085
golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory ...
88-930 0e+00

golgi-associated secretory pathway Ca(2+) transport ATPases, similar to human ATPase secretory pathway Ca(2+) transporting 1/hSPCA1 and Saccharomyces cerevisiae Ca(2+)/Mn(2+)-transporting P-type ATPase, Pmr1p; SPCAs are Ca(2+) pumps important for the golgi-associated secretion pathway, in addition some function as Mn(2+) pumps in Mn(2+) detoxification. Saccharomyces cerevisiae Pmr1p is a high affinity Ca(2+)/Mn(2+) ATPase which transports Ca(2+) and Mn(2+) from the cytoplasm into the Golgi. Pmr1p also contributes to Cd(2+) detoxification. This subfamily includes human SPCA1 and SPCA2, encoded by the ATP2C1 and ATP2C2 genes; autosomal dominant Hailey-Hailey disease is caused by mutations in the human ATP2C1 gene. It also includes Strongylocentrotus purpuratus testis secretory pathway calcium transporting ATPase SPCA which plays an important role in fertilization. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319779 [Multi-domain]  Cd Length: 804  Bit Score: 1592.04  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  88 RRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSK 167
Cdd:cd02085    1 RRKLHGPNEFKVEDEEPLWKKYLEQFKNPLILLLLGSAVVSVVMKQYDDAVSITVAILIVVTVAFVQEYRSEKSLEALNK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 168 LVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASR 247
Cdd:cd02085   81 LVPPECHCLRDGKLEHFLARELVPGDLVCLSIGDRIPADLRLFEATDLSIDESSLTGETEPCSKTTEVIPKASNGDLTTR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 248 SNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILE 327
Cdd:cd02085  161 SNIAFMGTLVRCGHGKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDKLGKQLSLYSFIIIGVIMLIGWLQGKNLLE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 328 MFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglha 407
Cdd:cd02085  241 MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRRAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTKIVT------ 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 408 evtgvgynqfgevivdgdvvhgfynpavsriveaGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYP 487
Cdd:cd02085  315 ----------------------------------GCVCNNAVIRNNTLMGQPTEGALIALAMKMGLSDIRETYIRKQEIP 360
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 488 FSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQT-LTLTQQQRDVYQQEKARMGSAGLRVLALASGPE 566
Cdd:cd02085  361 FSSEQKWMAVKCIPKYNSDNEEIYFMKGALEQVLDYCTTYNSSDGSaLPLTQQQRSEINEEEKEMGSKGLRVLALASGPE 440
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 567 LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVP 646
Cdd:cd02085  441 LGDLTFLGLVGINDPPRPGVREAIQILLESGVRVKMITGDAQETAIAIGSSLGLYSPSLQALSGEEVDQMSDSQLASVVR 520
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 647 KVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEG 726
Cdd:cd02085  521 KVTVFYRASPRHKLKIVKALQKSGAVVAMTGDGVNDAVALKSADIGIAMGRTGTDVCKEAADMILVDDDFSTILAAIEEG 600
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 727 KGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILT 806
Cdd:cd02085  601 KGIFYNIKNFVRFQLSTSIAALSLIALSTLFNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDPILT 680
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 807 KNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSI 886
Cdd:cd02085  681 RSLILNVLLSAAIIVSGTLWVFWKEMSDDNVTPRDTTMTFTCFVFFDMFNALSCRSQTKSIFEIGFFSNRMFLYAVGGSL 760
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....
gi 312836765 887 MGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 930
Cdd:cd02085  761 IGQLLVIYFPPLQRVFQTEALGLLDLLFLLGLTSSVFIVSELRK 804
MgtA COG0474
Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];
48-904 0e+00

Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism];


Pssm-ID: 223550 [Multi-domain]  Cd Length: 917  Bit Score: 812.34  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  48 NETMIPVLTSKKASELPVS--EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASA 125
Cdd:COG0474   11 NKSSSTPVTSETWHPLSVErnELLLELFTSPTTGLSEEEVKRRLKKYGPNELPEEKKRSLLKKFLRQFKDPFIILLLVAA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 126 VISVLMHQF----DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGD 201
Cdd:COG0474   91 LLSAFVGDWvdagVDAIVILLVVVINALLGFVQEYRAEKALEALKKMSSPKAKVLRDGKFVEIPASELVPGDIVLLEAGD 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 202 RVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKM 281
Cdd:COG0474  171 VVPADLRLLESSDLEVDESALTGESLPVEKQALPLTKSDAPLGLDRDNMLFSGTTVVSGRAKGIVVATGFETEFGKIARL 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 282 MQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV 360
Cdd:COG0474  251 LPTKKEVKTPLQRKLNKLGKFLLVLALVLGALVFVVGLFRGGnGLLESFLTALALAVAAVPEGLPAVVTIALALGAQRMA 330
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 361 KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHaevtgvgynqfgevivDGDVVHGFYNPAVSRIVE 440
Cdd:COG0474  331 KDNAIVRSLNAIETLGSVDVICSDKTGTLTQNKMTVKKIYINGGGK----------------DIDDKDLKDSPALLRFLL 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 441 AGCVCNDAVI--RNNTLMGKPTEGALIALAMKMG----LDGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPeICFMK 514
Cdd:COG0474  395 AAALCNSVTPekNGWYQAGDPTEGALVEFAEKLGfsldLSGLEVEYPILAEIPFDSERKRMSV--IVKTDEGKY-ILFVK 471
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 515 GAYEQVIKYCTTYqskGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQ-LTFLGLVGIIDPP 582
Cdd:COG0474  472 GAPEVILERCKSI---GELEPLTEEGLRTLEEAVKELASEGLRVLAVAYKKldraekddevdEIESdLVFLGLTGIEDPP 548
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 583 RTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQS--VSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM 660
Cdd:COG0474  549 REDVKEAIEELREAGIKVWMITGDHVETAIAIAKECGIEAEAESAlvIDGAELDALSDEELAELVEELSVFARVSPEQKA 628
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 661 KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQ 740
Cdd:COG0474  629 RIVEALQKSGHVVAMTGDGVNDAPALKAADVGIAMGGEGTDAAKEAADIVLLDDNFATIVLAVVEGRRVYVNIKKFILYL 708
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 741 LSTSIAALTLISLATLMNFPN-PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILK-ILVSSI 818
Cdd:COG0474  709 LSKNVGEVLTLLIYSLFNLFFlPLTPLQLLWINLLTDSLPALALGVEDPESDVMKRPPRGPEEGLFNRKIFWRfILIIGL 788
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 819 IIVCGTLFVF--------WRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQL 890
Cdd:COG0474  789 LSAILFILTFllyllgfiANTLGLDLFQALLQTTAFTVLVLIQLLLTLAVRSRGRPFLSSLLFSNKYLWLALLVIIILQL 868
                        890
                 ....*....|....*
gi 312836765 891 LVIYFPPLQ-KVFQT 904
Cdd:COG0474  869 LIIFLPPLNlKIFQP 883
P-type_ATPase_cation cd02080
P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, ...
79-930 0e+00

P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase; This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319775 [Multi-domain]  Cd Length: 819  Bit Score: 775.28  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 158
Cdd:cd02080    1 GLTSEEAAERLERYGPNRLPEKKTKSPLLRFLRQFNNPLIYILLAAAVVTAFLGHWVDAIVIFGVVLINAIIGYIQEGKA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 159 EKSLEELSKLVPPECHCVREGKlEHTL-ARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQP 237
Cdd:cd02080   81 EKALAAIKNMLSPEATVLRDGK-KLTIdAEELVPGDIVLLEAGDKVPADLRLIEARNLQIDESALTGESVPVEKQEGPLE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 238 AATNgdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV 317
Cdd:cd02080  160 EDTP--LGDRKNMAYSGTLVTAGSATGVVVATGADTEIGRINQLLAEVEQLATPLTRQIAKFSKALLIVILVLAALTFVF 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 318 GWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTV 396
Cdd:cd02080  238 GLLRGDySLVELFMAVVALAVAAIPEGLPAVITITLAIGVQRMAKRNAIIRRLPAVETLGSVTVICSDKTGTLTRNEMTV 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 397 THIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcVCNDAVIRNN----TLMGKPTEGALIALAMKMG 472
Cdd:cd02080  318 QAIVT------------------------------------------LCNDAQLHQEdghwKITGDPTEGALLVLAAKAG 355
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 473 LD--GLQQDYIRKAEYPFSSEQKWMAVkcvhRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLtqqQRDVYQQEKAR 550
Cdd:cd02080  356 LDpdRLASSYPRVDKIPFDSAYRYMAT----LHRDDGQRVIYVKGAPERLLDMCDQELLDGGVSPL---DRAYWEAEAED 428
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 551 MGSAGLRVLALASGPE------------LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRL 618
Cdd:cd02080  429 LAKQGLRVLAFAYREVdseveeidhadlEGGLTFLGLQGMIDPPRPEAIAAVAECQSAGIRVKMITGDHAETARAIGAQL 508
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 619 GLySKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQT 698
Cdd:cd02080  509 GL-GDGKKVLTGAELDALDDEELAEAVDEVDVFARTSPEHKLRLVRALQARGEVVAMTGDGVNDAPALKQADIGIAMGIK 587
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 699 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGP 778
Cdd:cd02080  588 GTEVAKEAADMVLADDNFATIAAAVEEGRRVYDNLKKFILFTLPTNLGEGLVIIVAILFGVTLPLTPVQILWINMVTAIT 667
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 779 PAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNAL 858
Cdd:cd02080  668 LGLALAFEPAEPGIMKRPPRDPSEPLLSRELIWRILLVSLLMLGGAFGLFLWALDRGYSLETARTMAVNTIVVAQIFYLF 747
                        810       820       830       840       850       860       870
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 312836765 859 SSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIK 930
Cdd:cd02080  748 NCRSLHRSILKLGVFSNKILFLGIGALILLQLAFTYLPFMNSLFGTAPIDLVDWAIILLVGIVVFIVVELEK 819
P-type_ATPase_Ca_prok cd02089
prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL ...
79-798 0e+00

prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL and Listeria monocytogenes LMCA1; Ca(2+) transport ATPase is a plasma membrane protein which pumps Ca(2+) ion out of the cytoplasm. This prokaryotic subfamily includes the Ca(2+)-ATPase Synechococcus elongatus PacL, Listeria monocytogenes Ca(2+)-ATPase 1 (LMCA1) which has a low Ca(2+) affinity and a high pH optimum (pH about 9) and may remove Ca(2+) from the microorganism in environmental conditions when e.g. stressed by high Ca(2+) and alkaline pH, and the Bacillus subtilis putative P-type Ca(2+)-transport ATPase encoded by the yloB gene, which is expressed during sporulation. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319781 [Multi-domain]  Cd Length: 674  Bit Score: 757.92  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSItVAILIVVTV-AFVQEYR 157
Cdd:cd02089    1 GLSEEEAERRLAKYGPNELVEKKKRSPWKKFLEQFKDFMVIVLLAAAVISGVLGEYVDAIVI-IAIVILNAVlGFVQEYK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 158 SEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQP 237
Cdd:cd02089   80 AEKALAALKKMSAPTAKVLRDGKKQEIPARELVPGDIVLLEAGDYVPADGRLIESASLRVEESSLTGESEPVEKDADTLL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 238 AATNGdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV 317
Cdd:cd02089  160 EEDVP-LGDRKNMVFSGTLVTYGRGRAVVTATGMNTEMGKIATLLEETEEEKTPLQKRLDQLGKRLAIAALIICALVFAL 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 318 GWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVT 397
Cdd:cd02089  239 GLLRGEDLLDMLLTAVSLAVAAIPEGLPAIVTIVLALGVQRMAKRNAIIRKLPAVETLGSVSVICSDKTGTLTQNKMTVE 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 398 HIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnntlMGKPTEGALIALAMKMGLD--G 475
Cdd:cd02089  319 KIYT------------------------------------------------------IGDPTETALIRAARKAGLDkeE 344
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 476 LQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRpeICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAG 555
Cdd:cd02089  345 LEKKYPRIAEIPFDSERKLMTT--VHKDAGKY--IVFTKGAPDVLLPRCTYIYINGQVRPLTEEDRAKILAVNEEFSEEA 420
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 556 LRVLALA----------SGPEL-GQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKT 624
Cdd:cd02089  421 LRVLAVAykpldedpteSSEDLeNDLIFLGLVGMIDPPRPEVKDAVAECKKAGIKTVMITGDHKLTARAIAKELGILEDG 500
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 625 SQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCK 704
Cdd:cd02089  501 DKALTGEELDKMSDEELEKKVEQISVYARVSPEHKLRIVKALQRKGKIVAMTGDGVNDAPALKAADIGVAMGITGTDVAK 580
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 705 EAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLG 784
Cdd:cd02089  581 EAADMILTDDNFATIVAAVEEGRTIYDNIRKFIRYLLSGNVGEILTMLLAPLLGWPVPLLPIQLLWINLLTDGLPALALG 660
                        730
                 ....*....|....
gi 312836765 785 VEPVDKDVIRKPPR 798
Cdd:cd02089  661 VEPAEPDIMDRKPR 674
P-type_ATPase_SERCA cd02083
sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; ...
63-904 0e+00

sarco/endoplasmic reticulum Ca(2+)-ATPase (SERCA), similar to mammalian ATP2A1-3/SERCA1-3; SERCA is a transmembrane (Ca2+)-ATPase and a major regulator of Ca(2+) homeostasis and contractility in cardiac and skeletal muscle. It re-sequesters cytoplasmic Ca(2+) to the sarco/endoplasmic reticulum store, thereby also terminating Ca(2+)-induced signaling such as in muscle contraction. Three genes (ATP2A1-3/SERCA1-3) encode SERCA pumps in mammals, further isoforms exist due to alternative splicing of transcripts. The activity of SERCA is regulated by two small membrane proteins called phospholamban and sarcolipin. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319778 [Multi-domain]  Cd Length: 979  Bit Score: 680.55  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  63 LPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSIT- 141
Cdd:cd02083    3 KTVEEVLAYFGVDPTRGLSDEQVKRRREKYGPNELPAEEGKSLWELVLEQFDDLLVRILLLAAIISFVLALFEEGEEGVt 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 142 ------VAILIVV---TVAFVQEYRSEKSLEELSKLVPPECHCVREGK-LEHTLARDLVPGDTVCLSVGDRVPADLRL-- 209
Cdd:cd02083   83 afvepfVILLILIanaVVGVWQERNAEKAIEALKEYEPEMAKVLRNGKgVQRIRARELVPGDIVEVAVGDKVPADIRIie 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 210 FEAVDLSIDESSLTGETTPCSKVTA--PQPAATNGDlasRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEA 287
Cdd:cd02083  163 IKSTTLRVDQSILTGESVSVIKHTDvvPDPRAVNQD---KKNMLFSGTNVAAGKARGVVVGTGLNTEIGKIRDEMAETEE 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 288 PKTPLQKSMDLLGKQLSFYSFGIIGIIMLV------------GWLLGKdiLEMFTISVSLAVAAIPEGLPIVVTVTLALG 355
Cdd:cd02083  240 EKTPLQQKLDEFGEQLSKVISVICVAVWAInighfndpahggSWIKGA--IYYFKIAVALAVAAIPEGLPAVITTCLALG 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 356 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHA-------EVTGVGYNQFGEVIVDGDVVH 428
Cdd:cd02083  318 TRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFILDKVEDdsslnefEVTGSTYAPEGEVFKNGKKVK 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 429 GFYNPAVSRIVEAGCVCNDAVIRNN------TLMGKPTEGALIALAMKMGLDG------------------LQQDYIRKA 484
Cdd:cd02083  398 AGQYDGLVELATICALCNDSSLDYNeskgvyEKVGEATETALTVLVEKMNVFNtdksglskreranacndvIEQLWKKEF 477
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 485 EYPFSSEQKWMAVKCVHRTQQDRPEIcFMKGAYEQVIKYCTTYQSKGQTLT-LTQQQRDVYQQEKARMGSAGLRVLALAS 563
Cdd:cd02083  478 TLEFSRDRKSMSVYCSPTKASGGNKL-FVKGAPEGVLERCTHVRVGGGKVVpLTAAIKILILKKVWGYGTDTLRCLALAT 556
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 564 GPELGQ------------------LTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTS 625
Cdd:cd02083  557 KDTPPKpedmdledstkfykyetdLTFVGVVGMLDPPRPEVRDSIEKCRDAGIRVIVITGDNKGTAEAICRRIGIFGEDE 636
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 626 Q----SVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTD 701
Cdd:cd02083  637 DttgkSYTGREFDDLSPEEQREACRRARLFSRVEPSHKSKIVELLQSQGEITAMTGDGVNDAPALKKAEIGIAMG-SGTA 715
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 702 VCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQ 781
Cdd:cd02083  716 VAKSASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPAT 795
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 782 SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVF--------------WRELR-------------- 833
Cdd:cd02083  796 ALGFNPPDLDIMKKPPRKPDEPLISGWLFFRYLAIGTYVGLATVGAFawwfmyyeegpqvsFYQLThfmqcsswepnfeg 875
                        890       900       910       920       930       940       950
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 312836765 834 ---DNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQT 904
Cdd:cd02083  876 vdcEIFEDPHPMTMALSVLVVIEMFNALNSLSENQSLLVMPPWSNPWLVGAIALSMALHFVILYVPPLATIFQI 949
ATPase-IIA1_Ca TIGR01116
sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the ...
110-934 0e+00

sarco/endoplasmic reticulum calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the endoplasmic reticulum membrane of eukaryotes, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. These pumps transfer Ca2+ from the cytoplasm to the lumen of the endoplasmic reticulum. In humans and mice, at least, there are multiple isoforms of the SERCA pump with overlapping but not redundant functions. Defects in SERCA isoforms are associated with diseases in humans. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the latter of which is modelled by TIGR01522. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273452 [Multi-domain]  Cd Length: 917  Bit Score: 604.08  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  110 ISQFKNPLIMLLLASAVISVLMHQFDDAVSIT-------VAILIVV---TVAFVQEYRSEKSLEELSKLVPPECHCVREG 179
Cdd:TIGR01116   2 LEQFEDLLVRILLLAACVSFVLAWFEEGEETVtafvepfVILLILVanaIVGVWQERNAEKAIEALKEYESEHAKVLRDG 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  180 KLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAaTNGDLASRSNIAFMGTLVRC 259
Cdd:TIGR01116  82 RWSVIKAKDLVPGDIVELAVGDKVPADIRVLSLKTLRVDQSILTGESVSVNKHTESVPD-ERAVNQDKKNMLFSGTLVVA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  260 GKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSfysfGIIGIIMLVGWLLG--------------KDI 325
Cdd:TIGR01116 161 GKARGVVVRTGMSTEIGKIRDEMRAAEQEDTPLQKKLDEFGELLS----KVIGLICILVWVINighfndpalgggwiQGA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  326 LEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGL 405
Cdd:TIGR01116 237 IYYFKIAVALAVAAIPEGLPAVITTCLALGTRKMAKKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSVCKVVALDPS 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  406 HAE-----VTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTL------MGKPTEGALIALAMKMGLD 474
Cdd:TIGR01116 317 SSSlnefcVTGTTYAPEGGVIKDDGPVAGGQDAGLEELATIAALCNDSSLDFNERkgvyekVGEATEAALKVLVEKMGLP 396
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  475 G------------------LQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDrpeiCFMKGAYEQVIKYCTTYQSK-GQTLT 535
Cdd:TIGR01116 397 AtkngvsskrrpalgcnsvWNDKFKKLATLEFSRDRKSMSVLCKPSTGNK----LFVKGAPEGVLERCTHILNGdGRAVP 472
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  536 LTQQQRDVYQQEKARMGSA-GLRVLALASGPELGQ------------------LTFLGLVGIIDPPRTGVKEAVTTLIAS 596
Cdd:TIGR01116 473 LTDKMKNTILSVIKEMGTTkALRCLALAFKDIPDPreedllsdpanfeaiesdLTFIGVVGMLDPPRPEVADAIEKCRTA 552
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  597 GVSIKMITGDSQETAVAIASRLGLYSK----TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSV 672
Cdd:TIGR01116 553 GIRVIMITGDNKETAEAICRRIGIFSPdedvTFKSFTGREFDEMGPAKQRAACRSAVLFSRVEPSHKSELVELLQEQGEI 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  673 VAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLIS 752
Cdd:TIGR01116 633 VAMTGDGVNDAPALKKADIGIAMG-SGTEVAKEASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYMISSNIGEVVCIF 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  753 LATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSI--IIVCGTLFVFWR 830
Cdd:TIGR01116 712 LTAALGIPEGLIPVQLLWVNLVTDGLPATALGFNPPDKDIMWKPPRRPDEPLITGWLFFRYLVVGVyvGLATVGGFVWWY 791
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  831 EL-------RDNVITPRD---------------TTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMG 888
Cdd:TIGR01116 792 LLthftgcdEDSFTTCPDfedpdcyvfegkqpaRTISLSVLVVIEMFNALNALSEDQSLLRMPPWVNKWLIGAICLSMAL 871
                         890       900       910       920
                  ....*....|....*....|....*....|....*....|....*.
gi 312836765  889 QLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVER 934
Cdd:TIGR01116 872 HFLILYVPFLSRIFGVTPLSLTDWLMVLKLSLPVILVDEVLKFFSR 917
P-type_ATPase_Ca_PMCA-like cd02081
animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related ...
85-807 1.54e-162

animal plasma membrane Ca2(+)-ATPases (PMCA), similar to human ATP2B1-4/PMCA1-4, and related Ca2(+)-ATPases including Saccharomyces cerevisiae vacuolar PMC1; Animal PMCAs function to export Ca(2+) from cells and play a role in regulating Ca(2+) signals following stimulus induction and in preventing calcium toxicity. Many PMCA pump variants exist due to alternative splicing of transcripts. PMCAs are regulated by the binding of calmodulin or by kinase-mediated phosphorylation. Saccharomyces cerevisiae vacuolar transporter Pmc1p facilitates the accumulation of Ca2+ into vacuoles. Pmc1p is not regulated by direct calmodulin binding but responds to the calmodulin/calcineurin-signaling pathway and is controlled by the transcription factor complex Tcn1p/Crz1p. Similarly, the expression of the gene for Dictyostelium discoideum Ca(2+)-ATPase PAT1, patA, is under the control of a calcineurin-dependent transcription factor. Plant vacuolar Ca(2+)-ATPases, are regulated by direct-calmodulin binding. Plant Ca(2+)-ATPases are present at various cellular locations including the plasma membrane, endoplasmic reticulum, chloroplast and vacuole. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319776 [Multi-domain]  Cd Length: 721  Bit Score: 494.03  E-value: 1.54e-162
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  85 VSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV---LMHQFDDA---------VSITVAILIVVTVAF 152
Cdd:cd02081    1 LEHRREVYGKNEIPPKPPKSFLQLVWEALQDPTLIILLIAAIVSLglgFYTPFGEGegktgwiegVAILVAVILVVLVTA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 153 VQEYRSEKSLEEL-SKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSK 231
Cdd:cd02081   81 GNDYQKEKQFRKLnSKKEDQKVTVIRDGEVIQISVFDIVVGDIVQLKYGDLIPADGLLIEGNDLKIDESSLTGESDPIKK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 232 VTapqpaatngDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFG-- 309
Cdd:cd02081  161 TP---------DNQIPDPFLLSGTKVLEGSGKMLVTAVGVNSQTGKIMTLLRAENEEKTPLQEKLTKLAVQIGKVGLIva 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 310 -IIGIIMLVGWLL--------------GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 374
Cdd:cd02081  232 aLTFIVLIIRFIIdgfvndgksfsaedLQEFVNFFIIAVTIIVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACET 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 375 LGCCNVICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnnt 454
Cdd:cd02081  312 MGNATAICSDKTGTLTQNRMTVVQGYI----------------------------------------------------- 338
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 455 lmGKPTEGALIALAMKMGLDglqQDYIRKAE-------YPFSSEQKWMAVkcVHRTQQDRPEIcFMKGAYEQVIKYCTTY 527
Cdd:cd02081  339 --GNKTECALLGFVLELGGD---YRYREKRPeekvlkvYPFNSARKRMST--VVRLKDGGYRL-YVKGASEIVLKKCSYI 410
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 528 QSK-GQTLTLTQQQRDVYQQEKARMGSAGLRVLALASG------------------PELGQLTFLGLVGIIDPPRTGVKE 588
Cdd:cd02081  411 LNSdGEVVFLTSEKKEEIKRVIEPMASDSLRTIGLAYRdfspdeeptaerdwddeeDIESDLTFIGIVGIKDPLRPEVPE 490
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 589 AVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSV----------SGEEIDAMDVQQLSQIVPKVAVFYRASPRH 658
Cdd:cd02081  491 AVAKCQRAGITVRMVTGDNINTARAIARECGILTEGEDGLvlegkefrelIDEEVGEVCQEKFDKIWPKLRVLARSSPED 570
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 659 KMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVR 738
Cdd:cd02081  571 KYTLVKGLKDSGEVVAVTGDGTNDAPALKKADVGFAMGIAGTEVAKEASDIILLDDNFSSIVKAVMWGRNVYDSIRKFLQ 650
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 312836765 739 FQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTK 807
Cdd:cd02081  651 FQLTVNVVAVILAFIGAVVTKDSPLTAVQMLWVNLIMDTLAALALATEPPTEDLLKRKPYGRDKPLISR 719
P-type_ATPase_Na_ENA cd02086
fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces ...
79-902 7.78e-162

fungal-type Na(+)-ATPase, similar to the plasma membrane sodium transporters Saccharomyces cerevisiae Ena1p, Ena2p and Ustilago maydis Ena1, and the endoplasmic reticulum sodium transporter Ustilago maydis Ena2; Fungal-type Na(+)-ATPase (also called ENA ATPases). This subfamily includes the Saccharomyces cerevisiae plasma membrane transporters: Na(+)/Li(+)-exporting ATPase Ena1p which may also extrudes K(+), and Na(+)-exporting P-type ATPase Ena2p. It also includes Ustilago maydis plasma membrane Ena1, an K(+)/Na(+)-ATPase whose chief role is to pump Na(+) and K(+) out of the cytoplasm, especially at high pH values, and endoplasmic reticulum Ena2 ATPase which mediates Na(+) or K(+) fluxes in the ER or in other endomembranes. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319780 [Multi-domain]  Cd Length: 920  Bit Score: 498.90  E-value: 7.78e-162
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 158
Cdd:cd02086    1 GLTNDEAERRLKEYGENELEGDTGVSAWKILLRQVANAMTLVLIIAMALSFAVKDWIEGGVIAAVIALNVIVGFIQEYKA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 159 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKvTAPQPA 238
Cdd:cd02086   81 EKTMDSLRNLSSPNAHVIRSGKTETISSKDVVPGDIVLLKVGDTVPADLRLIETKNFETDEALLTGESLPVIK-DAELVF 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 239 ATNGDL--ASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ----AEEAPK----------------------- 289
Cdd:cd02086  160 GKEEDVsvGDRLNLAYSSSTVTKGRAKGIVVATGMNTEIGKIAKALRgkggLISRDRvkswlygtlivtwdavgrflgtn 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 290 --TPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVK 367
Cdd:cd02086  240 vgTPLQRKLSKLAYLLFFIAVILAIIVFAVNKFDVDN--EVIIYAIALAISMIPESLVAVLTITMAVGAKRMVKRNVIVR 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 368 KLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvCND 447
Cdd:cd02086  318 KLDALEALGAVTDICSDKTGTLTQGKMVVRQVWIPAAL---------------------------------------CNI 358
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 448 AVIRNN------TLMGKPTEGALIALAMKMGL------DGLQQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPEICFMKG 515
Cdd:cd02086  359 ATVFKDeetdcwKAHGDPTEIALQVFATKFDMgknaltKGGSAQFQHVAEFPFDSTVKRMSV--VYYNNQAGDYYAYMKG 436
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 516 AYEQVIKYCTTYQSKGQTLTLTQQQRD--VYQQEKarMGSAGLRVLALAS--------------GPELGQ------LTFL 573
Cdd:cd02086  437 AVERVLECCSSMYGKDGIIPLDDEFRKtiIKNVES--LASQGLRVLAFASrsftkaqfnddqlkNITLSRadaesdLTFL 514
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 574 GLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGL-------YSKT---------SQ--SVSGEEIDA 635
Cdd:cd02086  515 GLVGIYDPPRNESAGAVEKCHQAGITVHMLTGDHPGTAKAIAREVGIlppnsyhYSQEimdsmvmtaSQfdGLSDEEVDA 594
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 636 MDVQQLsqivpkvaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDD 715
Cdd:cd02086  595 LPVLPL--------VIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMADVGIAMGLNGSDVAKDASDIVLTDDN 666
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 716 FQTIMSAIEEGKGIYNNIKNFVRFQLSTSIA--ALTLISLA-----TLMNFpnPLNAMQILWINIIMDGPPAQSLGVEPV 788
Cdd:cd02086  667 FASIVNAIEEGRRMFDNIQKFVLHLLAENVAqvILLLIGLAfkdedGLSVF--PLSPVEILWINMVTSSFPAMGLGLEKA 744
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 789 DKDVIRKPPRNWKDSILTKNLILKILVSSII--IVCGTLFVF-----------------WRELRDNVITPRDTtmTFTCF 849
Cdd:cd02086  745 SPDVMQRPPHDLKVGIFTRELIIDTFVYGTFmgVLCLASFTLviygigngdlgsdcnesYNSSCEDVFRARAA--VFATL 822
                        890       900       910       920       930       940
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 312836765 850 VFFDMFNALSSRSQTKSVFEIG-------------LCSNRMFCYAVLGSIMGQLLVIYFPPL-QKVF 902
Cdd:cd02086  823 TWCALILAWEVVDMRRSFFNMHpdtdspvksffktLWKNKFLFWSVVLGFVSVFPTLYIPVInDDVF 889
ATPase-IIB_Ca TIGR01517
plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase ...
65-906 7.73e-143

plasma-membrane calcium-translocating P-type ATPase; This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes, out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are represented by two corresponding models (TIGR01116 and TIGR01522). This model is well separated from those.


Pssm-ID: 273668 [Multi-domain]  Cd Length: 956  Bit Score: 450.00  E-value: 7.73e-143
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   65 VSEVASILQADLQNGL--NKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFD------- 135
Cdd:TIGR01517  45 AEGIATKLKTDLNEGVrlSSSTLERREKVYGKNELPEKPPKSFLQIVWAALSDQTLILLSVAAVVSLVLGLYVpsvgedk 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  136 --------DAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPP-ECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPAD 206
Cdd:TIGR01517 125 adtetgwiEGVAILVSVILVVLVTAVNDYKKELQFRQLNREKSAqKIAVIRGGQEQQISIHDIVVGDIVSLSTGDVVPAD 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  207 LRLFEAVDLSIDESSLTGETTPcSKVTAPQPaatngdlasrsNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEE 286
Cdd:TIGR01517 205 GVFISGLSLEIDESSITGESDP-IKKGPVQD-----------PFLLSGTVVNEGSGRMLVTAVGVNSFGGKLMMELRQAG 272
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  287 APKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLL------------------GKDILEMFTISVSLAVAAIPEGLPIVV 348
Cdd:TIGR01517 273 EEETPLQEKLSELAGLIGKFGMGSAVLLFLVLSLRyvfriirgdgrfedteedAQTFLDHFIIAVTIVVVAVPEGLPLAV 352
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  349 TVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSdGLHAEVTGVGYNQFGEVIVDGDVVH 428
Cdd:TIGR01517 353 TIALAYSMKKMMKDNNLVRHLAACETMGSATAICSDKTGTLTQNVMSVVQGYIG-EQRFNVRDEIVLRNLPAAVRNILVE 431
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  429 GFY-NPAVSRIVEAGcvcndaviRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAE-----YPFSSEQKWMAVKCVHR 502
Cdd:TIGR01517 432 GISlNSSSEEVVDRG--------GKRAFIGSKTECALLDFGLLLLLQSRDVQEVRAEEkvvkiYPFNSERKFMSVVVKHS 503
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  503 TQQDRpeiCFMKGAYEQVIKYCTTYQSKGQTLT-LTQQQRDVYQQEKARMGSAGLRVLALA-----------SGPELGQL 570
Cdd:TIGR01517 504 GGKYR---EFRKGASEIVLKPCRKRLDSNGEATpISEDDKDRCADVIEPLASDALRTICLAyrdfapeefprKDYPNKGL 580
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  571 TFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAV 650
Cdd:TIGR01517 581 TLIGVVGIKDPLRPGVREAVQECQRAGITVRMVTGDNIDTAKAIARNCGILTFGGLAMEGKEFRSLVYEEMDPILPKLRV 660
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  651 FYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIY 730
Cdd:TIGR01517 661 LARSSPLDKQLLVLMLKDMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAKEASDIILLDDNFASIVRAVKWGRNVY 740
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  731 NNIKNFVRFQLSTSIAALTLISLATLM--NFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKN 808
Cdd:TIGR01517 741 DNIRKFLQFQLTVNVVAVILTFVGSCIssSHTSPLTAVQLLWVNLIMDTLAALALATEPPTEALLDRKPIGRNAPLISRS 820
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  809 LILKILVSSI--IIVCGTLFVFWRELRD----NVITPRDT----TMTFTCFVFFDMFNALSSRS--QTKSVFEiGLCSNR 876
Cdd:TIGR01517 821 MWKNILGQAGyqLVVTFILLFAGGSIFDvsgpDEITSHQQgelnTIVFNTFVLLQLFNEINARKlyEGMNVFE-GLFKNR 899
                         890       900       910
                  ....*....|....*....|....*....|
gi 312836765  877 MFCYAVLGSIMGQLLVIYFppLQKVFQTES 906
Cdd:TIGR01517 900 IFVTIMGFTFGFQVIIVEF--GGSFFSTVS 927
P-type_ATPase cd07539
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
112-786 8.46e-143

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319840 [Multi-domain]  Cd Length: 634  Bit Score: 439.93  E-value: 8.46e-143
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 112 QFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVRE--GKLEHTLARDL 189
Cdd:cd07539   35 QLELPPVALLGLAAGASASTGGGVDAVLIVGVLTVNAVIGGVQRLRAERALAALLAQQQQPARVVRApaGRTQTVPAESL 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 190 VPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAAtngDLASRSNIAFMGTLVRCGKAKGVVIGT 269
Cdd:cd07539  115 VPGDVIELRAGEVVPADARLLEADDLEVDESALTGESLPVDKQVAPTPGA---PLADRACMLYEGTTVVSGQGRAVVVAT 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 270 GENSEFGEVFKMMQAEEApKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVT 349
Cdd:cd07539  192 GPHTEAGRAQSLVAPVET-ATGVQAQLRELTSQLLPLSLGGGAAVTGLGLLRGAPLRQAVADGVSLAVAAVPEGLPLVAT 270
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 350 VTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhg 429
Cdd:cd07539  271 LAQLAAARRLSRRGVLVRSPRTVEALGRVDTICFDKTGTLTENRLRVVQVRP---------------------------- 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 430 fynpavsriveagcvcndavirnntlmgkPTegalialamkmgldglqqdyirkAEYPFSSEQKWMAVkcVHRTQQDRPE 509
Cdd:cd07539  323 -----------------------------PL-----------------------AELPFESSRGYAAA--IGRTGGGIPL 348
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 510 ICfMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALA-----SGPEL------GQLTFLGLVGI 578
Cdd:cd07539  349 LA-VKGAPEVVLPRCDRRMTGGQVVPLTEADRQAIEEVNELLAGQGLRVLAVAyrtldAGTTHaveavvDDLELLGLLGL 427
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 579 IDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLySKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRH 658
Cdd:cd07539  428 ADTARPGAAALIAALHDAGIDVVMITGDHPITARAIAKELGL-PRDAEVVTGAELDALDEEALTGLVADIDVFARVSPEQ 506
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 659 KMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVR 738
Cdd:cd07539  507 KLQIVQALQAAGRVVAMTGDGANDAAAIRAADVGIGVGARGSDAAREAADLVLTDDDLETLLDAVVEGRTMWQNVRDAVH 586
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*...
gi 312836765 739 FQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVE 786
Cdd:cd07539  587 VLLGGNLGEVMFTLIGTAIGGGAPLNTRQLLLVNLLTDMFPALALAVE 634
P-type_ATPase cd07538
uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase ...
79-812 8.34e-139

uncharacterized subfamily of P-type ATPase transporters; This subfamily contains P-type ATPase transporters of unknown function. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd2+, and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319839 [Multi-domain]  Cd Length: 653  Bit Score: 429.94  E-value: 8.34e-139
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 158
Cdd:cd07538    1 GLTEAEARRRLESGGKNELPQPKKRTLLASILDVLREPMFLLLLAAALIYFVLGDPREGLILLIFVVVIIAIEVVQEWRT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 159 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPA 238
Cdd:cd07538   81 ERALEALKNLSSPRATVIRDGRERRIPSRELVPGDLLILGEGERIPADGRLLENDDLGVDESTLTGESVPVWKRIDGKAM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 239 ATNGdlASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 318
Cdd:cd07538  161 SAPG--GWDKNFCYAGTLVVRGRGVAKVEATGSRTELGKIGKSLAEMDDEPTPLQKQTGRLVKLCALAALVFCALIVAVY 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 319 WLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTH 398
Cdd:cd07538  239 GVTRGDWIQAILAGITLAMAMIPEEFPVILTVFMAMGAWRLAKKNVLVRRAAAVETLGSITVLCVDKTGTLTKNQMEVVE 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 399 IFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndaVIRnntlmgkptegalialamkmgldglqq 478
Cdd:cd07538  319 LTS-----------------------------------------------LVR--------------------------- 324
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 479 dyirkaEYPFSSEQKWMAvkcvHRTQQDRPEICFMKGAYEQVIKYCTtyqskgqtltLTQQQRDVYQQEKARMGSAGLRV 558
Cdd:cd07538  325 ------EYPLRPELRMMG----QVWKRPEGAFAAAKGSPEAIIRLCR----------LNPDEKAAIEDAVSEMAGEGLRV 384
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 559 LALASG--------PELGQLTF--LGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLySKTSQSV 628
Cdd:cd07538  385 LAVAACridesflpDDLEDAVFifVGLIGLADPLREDVPEAVRICCEAGIRVVMITGDNPATAKAIAKQIGL-DNTDNVI 463
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 629 SGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAAD 708
Cdd:cd07538  464 TGQELDAMSDEELAEKVRDVNIFARVVPEQKLRIVQAFKANGEIVAMTGDGVNDAPALKAAHIGIAMGKRGTDVAREASD 543
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 709 MILVDDDFQTIMSAIEEGKGIYNNIKN---FVrFQLSTSIAALTLisLATLMNFPNPLNAMQILWINIIMDGPPAQSLGV 785
Cdd:cd07538  544 IVLLDDNFSSIVSTIRLGRRIYDNLKKaitYV-FAIHVPIAGLAL--LPPLLGLPPLLFPVHVVLLELIIDPTCSIVFEA 620
                        730       740
                 ....*....|....*....|....*..
gi 312836765 786 EPVDKDVIRKPPRNWKDSILTKNLILK 812
Cdd:cd07538  621 EPAERDIMRRPPRPPDEPLFGPRLVIK 647
ATPase-IID_K-Na TIGR01523
potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium ...
67-828 1.31e-130

potassium and/or sodium efflux P-type ATPase, fungal-type; Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.


Pssm-ID: 130586 [Multi-domain]  Cd Length: 1053  Bit Score: 420.19  E-value: 1.31e-130
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765    67 EVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILI 146
Cdd:TIGR01523   14 EAAEFIGTSIPEGLTHDEAQHRLKEVGENRLEADSGIDAKAMLLHQVCNAMCMVLIIAAAISFAMHDWIEGGVISAIIAL 93
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   147 VVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGET 226
Cdd:TIGR01523   94 NILIGFIQEYKAEKTMDSLKNLASPMAHVIRNGKSDAIDSHDLVPGDICLLKTGDTIPADLRLIETKNFDTDEALLTGES 173
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   227 TPCSK----VTAPQPAATNGDlasRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAE---------EAPK---- 289
Cdd:TIGR01523  174 LPVIKdahaTFGKEEDTPIGD---RINLAFSSSAVTKGRAKGICIATALNSEIGAIAAGLQGDgglfqrpekDDPNkrrk 250
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   290 ----------------------TPLQKSMDLLGKQLsFYSFGIIGIIMLVGWLLGKDiLEMFTISVSLAVAAIPEGLPIV 347
Cdd:TIGR01523  251 lnkwilkvtkkvtgaflglnvgTPLHRKLSKLAVIL-FCIAIIFAIIVMAAHKFDVD-KEVAIYAICLAISIIPESLIAV 328
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   348 VTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIF----------TSD-------------- 403
Cdd:TIGR01523  329 LSITMAMGAANMSKRNVIVRKLDALEALGAVNDICSDKTGTITQGKMIARQIWiprfgtisidNSDdafnpnegnvsgip 408
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   404 ------GLHAEVTGVGYNQ-FGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNT------LMGKPTEGALIALAMK 470
Cdd:TIGR01523  409 rfspyeYSHNEAADQDILKeFKDELKEIDLPEDIDMDLFIKLLETAALANIATVFKDDatdcwkAHGDPTEIAIHVFAKK 488
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   471 MGL-----------------------------DGLQQDYIRkaEYPFSSEQKWMAVkcVHRTQQDRPEICFMKGAYEQVI 521
Cdd:TIGR01523  489 FDLphnaltgeedllksnendqsslsqhnekpGSAQFEFIA--EFPFDSEIKRMAS--IYEDNHGETYNIYAKGAFERII 564
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   522 KYCTTYQSKG--QTLTLTQQQRDVYQQEKARMGSAGLRVLALAS---------GPELGQLT-----------FLGLVGII 579
Cdd:TIGR01523  565 ECCSSSNGKDgvKISPLEDCDRELIIANMESLAAEGLRVLAFASksfdkadnnDDQLKNETlnrataesdleFLGLIGIY 644
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   580 DPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLG-----LYSKTSQSVS-----GEEIDAMDVQQLSQIVPKVA 649
Cdd:TIGR01523  645 DPPRNESAGAVEKCHQAGINVHMLTGDFPETAKAIAQEVGiippnFIHDRDEIMDsmvmtGSQFDALSDEEVDDLKALCL 724
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   650 VFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGI 729
Cdd:TIGR01523  725 VIARCAPQTKVKMIEALHRRKAFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRM 804
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   730 YNNIKNFVRFQLSTSIAALTLISLATLMNFPN-----PLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSI 804
Cdd:TIGR01523  805 FDNIMKFVLHLLAENVAEAILLIIGLAFRDENgksvfPLSPVEILWCIMITSCFPAMGLGLEKAAPDLMDRLPHDNEVGI 884
                          890       900
                   ....*....|....*....|....
gi 312836765   805 LTKNLILKILVSSIIIVCGTLFVF 828
Cdd:TIGR01523  885 FQKELIIDMFAYGFFLGGSCLASF 908
P-type_ATPase_Mg cd02077
magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella ...
79-828 3.56e-130

magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA; MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319772 [Multi-domain]  Cd Length: 768  Bit Score: 411.26  E-value: 3.56e-130
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVIS----VLMHQ----FDDAVSITVAILIVVTV 150
Cdd:cd02077    1 GLTNEEAEERLEKYGPNEISHEKFPSWFKLLLKAFINPFNIVLLVLALVSfftdVLLAPgefdLVGALIILLMVLISGLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 151 AFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARD-LVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPC 229
Cdd:cd02077   81 DFIQEIRSLKAAEKLKKMVKNTATVIRDGSKYMEIPIDeLVPGDIVYLSAGDMIPADVRIIQSKDLFVSQSSLTGESEPV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 230 SKVTAPQpAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQaEEAPKTPLQKSMDLLGKQLSFYSFG 309
Cdd:cd02077  161 EKHATAK-KTKDESILELENICFMGTNVVSGSALAVVIATGNDTYFGSIAKSIT-EKRPETSFDKGINKVSKLLIRFMLV 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 310 IIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTL 389
Cdd:cd02077  239 MVPVVFLINGLTKGDWLEALLFALAVAVGLTPEMLPMIVTSNLAKGAVRMSKRKVIVKNLNAIQNFGAMDILCTDKTGTL 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 390 TKNEMTVTHIFTSDGlhaevtgvgynQFGEVIVDgdvvHGFYNPavsrIVEAGcvcndavIRNntLMGKptegALIALAM 469
Cdd:cd02077  319 TQDKIVLERHLDVNG-----------KESERVLR----LAYLNS----YFQTG-------LKN--LLDK----AIIDHAE 366
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 470 KMGLDGLQQDYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKA 549
Cdd:cd02077  367 EANANGLIQDYTKIDEIPFDFERRRMSV-VVKDNDGKHLLIT--KGAVEEILNVCTHVEVNGEVVPLTDTLREKILAQVE 443
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 550 RMGSAGLRVLALA----SGPELG-------QLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRL 618
Cdd:cd02077  444 ELNREGLRVLAIAykklPAPEGEysvkdekELILIGFLAFLDPPKESAAQAIKALKKNGVNVKILTGDNEIVTKAICKQV 523
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 619 GLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQT 698
Cdd:cd02077  524 GL--DINRVLTGSEIEALSDEELAKIVEETNIFAKLSPLQKARIIQALKKNGHVVGFMGDGINDAPALRQADVGISV-DS 600
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 699 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLAT-LMNFpNPLNAMQILWINIIMDg 777
Cdd:cd02077  601 AVDIAKEAADIILLEKDLMVLEEGVIEGRKTFGNILKYIKMTASSNFGNVFSVLVASaFLPF-LPMLPIQLLLQNLLYD- 678
                        730       740       750       760       770
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 312836765 778 pPAQ-SLGVEPVDKDVIRKpPRNWKDSILTKNLILKILVSSI---IIVCGTLFVF 828
Cdd:cd02077  679 -FSQlAIPFDNVDEEFLKK-PQKWDIKNIGRFMIWIGPISSIfdiLTFLVMWFVF 731
P-type_ATPase_Na-K_like cd02608
alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+) ...
79-810 6.29e-128

alpha-subunit of Na(+)/K(+)-ATPases and of gastric H(+)/K(+)-ATPase, similar to the human Na(+)/K(+)-ATPase alpha subunits 1-4; This subfamily includes the alpha subunit of Na(+)/K(+)-ATPase a heteromeric transmembrane protein composed of an alpha- and beta-subunit and an optional third subunit belonging to the FXYD proteins which are more tissue specific regulatory subunits of the enzyme. The alpha-subunit is the catalytic subunit responsible for transport activities of the enzyme. This subfamily includes all four isotopes of the human alpha subunit: (alpha1-alpha4, encoded by the ATP1A1- ATP1A4 genes). Na(+)/K(+)-ATPase functions chiefly as an ion pump, hydrolyzing one molecule of ATP to pump three Na(+) out of the cell in exchange for two K(+)entering the cell per pump cycle. In addition Na(+)/K(+)-ATPase acts as a signal transducer. This subfamily also includes Oreochromis mossambicus (tilapia) Na(+)/K(+)-ATPase alpha 1 and alpha 3 subunits, and gastric H(+)/K(+)-ATPase which exchanges hydronium ion with potassium and is responsible for gastric acid secretion. Gastric H(+)/K(+)-ATPase is an alpha,beta-heterodimeric enzyme. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319794 [Multi-domain]  Cd Length: 905  Bit Score: 409.43  E-value: 6.29e-128
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMH----QFDDAVS-------ITVAILIV 147
Cdd:cd02608    1 GLTSARAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSMLLWIGAILCFLAYgiqaATEEEPSndnlylgIVLAAVVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 148 VT--VAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGE 225
Cdd:cd02608   81 VTgcFSYYQEAKSSKIMDSFKNMVPQQALVIRDGEKMQINAEELVVGDLVEVKGGDRIPADIRIISAHGCKVDNSSLTGE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 226 TTPCSKvtapQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMD-------- 297
Cdd:cd02608  161 SEPQTR----SPEFTHENPLETKNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGKTPIAREIEhfihiitg 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 298 ---LLGkqlsfYSFGIIGIIMLVGWLlgkdilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVET 374
Cdd:cd02608  237 vavFLG-----VSFFILSLILGYTWL------EAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVET 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 375 LGCCNVICSDKTGTLTKNEMTVTHIFtsdglhaevtgvgynqFGEVIVDGDVVHGFYN----------PAVSRIVeagCV 444
Cdd:cd02608  306 LGSTSTICSDKTGTLTQNRMTVAHMW----------------FDNQIHEADTTEDQSGasfdkssatwLALSRIA---GL 366
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 445 CNDAVIRNN---------TLMGKPTEGALIALA-MKMG-LDGLQQDYIRKAEYPFSSEQKWMAvkCVHRTQQDRPE--IC 511
Cdd:cd02608  367 CNRAEFKAGqenvpilkrDVNGDASESALLKCIeLSCGsVMEMRERNPKVAEIPFNSTNKYQL--SIHENEDPGDPryLL 444
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 512 FMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALA-------SGPE------------LGQLTF 572
Cdd:cd02608  445 VMKGAPERILDRCSTILINGKEQPLDEEMKEAFQNAYLELGGLGERVLGFChlylpddKFPEgfkfdtdevnfpTENLCF 524
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 573 LGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGlysktsqsvsgeeidamdvqqlsqivpkVAVFY 652
Cdd:cd02608  525 VGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVG----------------------------IIVFA 576
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 653 RASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNN 732
Cdd:cd02608  577 RTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN 656
                        730       740       750       760       770       780       790
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 312836765 733 IKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRN-WKDSILTKNLI 810
Cdd:cd02608  657 LKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMVPAISLAYEKAESDIMKRQPRNpKTDKLVNERLI 735
ATPase-IIC_X-K TIGR01106
sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This ...
62-810 3.61e-127

sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit; This model describes the P-type ATPases responsible for the exchange of either protons or sodium ions for potassium ions across the plasma membranes of eukaryotes. Unlike most other P-type ATPases, members of this subfamily require a beta subunit for activity. This model encompasses eukaryotes and consists of two functional types, a Na/K antiporter found widely distributed in eukaryotes and a H/K antiporter found only in vertebrates. The Na+ or H+/K+ antiporter P-type ATPases have been characterized as Type IIC based on a published phylogenetic analysis. Sequences from Blastocladiella emersonii (GP|6636502, GP|6636502 and PIR|T43025), C. elegans (GP|2315419, GP|6671808 and PIR|T31763) and Drosophila melanogaster (GP|7291424) score below trusted cutoff, apparently due to long branch length (excessive divergence from the last common ancestor) as evidenced by a phylogenetic tree. Experimental evidence is needed to determine whether these sequences represent ATPases with conserved function. Aside from fragments, other sequences between trusted and noise appear to be bacterial ATPases of unclear lineage, but most likely calcium pumps. [Energy metabolism, ATP-proton motive force interconversion]


Pssm-ID: 273445 [Multi-domain]  Cd Length: 997  Bit Score: 409.57  E-value: 3.61e-127
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   62 ELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQF------- 134
Cdd:TIGR01106  19 KLSLDELERKYGTDLSKGLSAARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIqasteee 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  135 --DDAVSITVAILIVVTV----AFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLR 208
Cdd:TIGR01106  99 pqNDNLYLGVVLSAVVIItgcfSYYQEAKSSKIMESFKNMVPQQALVIRDGEKMSINAEQVVVGDLVEVKGGDRIPADLR 178
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  209 LFEAVDLSIDESSLTGETTPCSKvtapQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAP 288
Cdd:TIGR01106 179 IISAQGCKVDNSSLTGESEPQTR----SPEFTHENPLETRNIAFFSTNCVEGTARGIVVNTGDRTVMGRIASLASGLENG 254
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  289 KTPLQKSMD-----LLGKQLSF-YSFGIIGIIMLVGWLlgkdilEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 362
Cdd:TIGR01106 255 KTPIAIEIEhfihiITGVAVFLgVSFFILSLILGYTWL------EAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARK 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  363 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLH-AEVT----GVGYNQFGEVIVdgdvvhgfynpAVSR 437
Cdd:TIGR01106 329 NCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHeADTTedqsGVSFDKSSATWL-----------ALSR 397
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  438 IVEagcVCNDAVIRNN---------TLMGKPTEGALIA-LAMKMG-LDGLQQDYIRKAEYPFSSEQKWMAvkCVHRTQ-- 504
Cdd:TIGR01106 398 IAG---LCNRAVFKAGqenvpilkrAVAGDASESALLKcIELCLGsVMEMRERNPKVVEIPFNSTNKYQL--SIHENEdp 472
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  505 QDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVL-----ALASG--PE----------- 566
Cdd:TIGR01106 473 RDPRHLLVMKGAPERILERCSSILIHGKEQPLDEELKEAFQNAYLELGGLGERVLgfchlYLPDEqfPEgfqfdtddvnf 552
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  567 -LGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVS---------------- 629
Cdd:TIGR01106 553 pTDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEdiaarlnipvsqvnpr 632
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  630 --------GEEIDAMDVQQLSQIV---PKVaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQT 698
Cdd:TIGR01106 633 dakacvvhGSDLKDMTSEQLDEILkyhTEI-VFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIA 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  699 GTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGP 778
Cdd:TIGR01106 712 GSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTITILCIDLGTDMV 791
                         810       820       830
                  ....*....|....*....|....*....|...
gi 312836765  779 PAQSLGVEPVDKDVIRKPPRN-WKDSILTKNLI 810
Cdd:TIGR01106 792 PAISLAYEKAESDIMKRQPRNpKTDKLVNERLI 824
ATPase_P-type TIGR01494
ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large ...
139-769 4.61e-121

ATPase, P-type (transporting), HAD superfamily, subfamily IC; The P-type ATPases are a large family of trans-membrane transporters acting on charged substances. The distinguishing feature of the family is the formation of a phosphorylated intermediate (aspartyl-phosphate) during the course of the reaction. Another common name for these enzymes is the E1-E2 ATPases based on the two isolable conformations: E1 (unphosphorylated) and E2 (phosphorylated). Generally, P-type ATPases consist of only a single subunit encompassing the ATPase and ion translocation pathway, however, in the case of the potassium (TIGR01497) and sodium/potassium (TIGR01106) varieties, these functions are split between two subunits. Additional small regulatory or stabilizing subunits may also exist in some forms. P-type ATPases are nearly ubiquitous in life and are found in numerous copies in higher organisms (at least 45 in Arabidopsis thaliana, for instance). Phylogenetic analyses have revealed that the P-type ATPase subfamily is divided up into groups based on substrate specificities and this is represented in the various subfamily and equivalog models that have been made: IA (K+) TIGR01497, IB (heavy metals) TIGR01525, IIA1 (SERCA-type Ca++) TIGR01116, IIA2 (PMR1-type Ca++) TIGR01522, IIB (PMCA-type Ca++) TIGR01517, IIC (Na+/K+, H+/K+ antiporters) TIGR01106, IID (fungal-type Na+ and K+) TIGR01523, IIIA (H+) TIGR01647, IIIB (Mg++) TIGR01524, IV (phospholipid, flippase) TIGR01652 and V (unknown specificity) TIGR01657. The crystal structure of one calcium-pumping ATPase and an analysis of the fold of the catalytic domain of the P-type ATPases have been published. These reveal that the catalytic core of these enzymes is a haloacid dehalogenase(HAD)-type aspartate-nucleophile hydrolase. The location of the ATP-binding loop in between the first and second HAD conserved catalytic motifs defines these enzymes as members of subfamily I of the HAD superfamily (see also TIGR01493, TIGR01509, TIGR01549, TIGR01544 and TIGR01545). Based on these classifications, the P-type ATPase _superfamily_ corresponds to the IC subfamily of the HAD superfamily.


Pssm-ID: 273656 [Multi-domain]  Cd Length: 545  Bit Score: 379.74  E-value: 4.61e-121
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  139 SITVAILIVVTVAFVQEYRSEKSLEELSKLV--PPECHCVREGKLEHTlARDLVPGDTVCLSVGDRVPADLRLFEAvDLS 216
Cdd:TIGR01494   1 FILFLVLLFVLLEVKQKLKAEDALRSLKDSLvnTATVLVLRNGWKEIS-SKDLVPGDVVLVKSGDTVPADGVLLSG-SAF 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  217 IDESSLTGETTPCSKVTAPQPAATNGdlasrsniafmGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSM 296
Cdd:TIGR01494  79 VDESSLTGESLPVLKTALPDGDAVFA-----------GTINFGGTLIVKVTATGILTTVGKIAVVVYTGFSTKTPLQSKA 147
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  297 DLLGKQLSFYSFGIIGIIMLVGWLL----GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIV 372
Cdd:TIGR01494 148 DKFENFIFILFLLLLALAVFLLLPIggwdGNSIYKAILRALAVLVIAIPCALPLAVSVALAVGDARMAKKGILVKNLNAL 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  373 ETLGCCNVICSDKTGTLTKNEMTVTHIFTsDGLHAEVTGVGYNQFGEvivdgdvvhgfynpavsriveagcvcndavirN 452
Cdd:TIGR01494 228 EELGKVDVICFDKTGTLTTNKMTLQKVII-IGGVEEASLALALLAAS--------------------------------L 274
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  453 NTLMGKPTEGALIALAMKMG-LDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRpeiCFMKGAYEQVIKYCTtyqskg 531
Cdd:TIGR01494 275 EYLSGHPLERAIVKSAEGVIkSDEINVEYKILDVFPFSSVLKRMGVIVEGANGSDL---LFVKGAPEFVLERCN------ 345
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  532 qtltltqqQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETA 611
Cdd:TIGR01494 346 --------NENDYDEKVDEYARQGLRVLAFASKKLPDDLEFLGLLTFEDPLRPDAKETIEALRKAGIKVVMLTGDNVLTA 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  612 VAIASRLGLysktsqsvsgeeidamdvqqlsqivpkvAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADI 691
Cdd:TIGR01494 418 KAIAKELGI----------------------------DVFARVKPEEKAAIVEALQEKGRTVAMTGDGVNDAPALKKADV 469
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 312836765  692 GVAMGQtgTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQIL 769
Cdd:TIGR01494 470 GIAMGS--GDVAKAAADIVLLDDDLSTIVEAVKEGRKTFSNIKKNIFWAIAYNLILIPLALLLIVIILLPPLLAALAL 545
P-type_ATPase_H cd02076
plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+) ...
79-894 2.59e-120

plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+)-ATPases; This subfamily includes eukaryotic plasma membrane H(+)-ATPase which transports H(+) from the cytosol to the extracellular space, thus energizing the plasma membrane for the uptake of ions and nutrients, and is expressed in plants and fungi. This H(+)-ATPase consists of four domains: a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. This subfamily also includes the putative P-type H(+)-ATPase, MJ1226p of the anaerobic hyperthermophilic archaea Methanococcus jannaschii. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319771 [Multi-domain]  Cd Length: 781  Bit Score: 385.43  E-value: 2.59e-120
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  79 GLNKCEVSHRRAFHGWNEFDiSEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 158
Cdd:cd02076    1 GLTSEEAAKRLKEYGPNELP-EKKENPILKFLSFFWGPIPWMLEAAAILAAALGDWVDFAIILLLLLINAGIGFIEERQA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 159 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKvtapqpa 238
Cdd:cd02076   80 GNAVAALKKSLAPKARVLRDGQWQEIDAKELVPGDIVSLKIGDIVPADARLLTGDALQVDQSALTGESLPVTK------- 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 239 aTNGDlasrsnIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEaPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 318
Cdd:cd02076  153 -HPGD------EAYSGSIVKQGEMLAVVTATGSNTFFGKTAALVASAE-EQGHLQKVLNKIGNFLILLALILVLIIVIVA 224
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 319 WLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTH 398
Cdd:cd02076  225 LYRHDPFLEILQFVLVLLIASIPVAMPAVLTVTMAVGALELAKKKAIVSRLSAIEELAGVDILCSDKTGTLTLNKLSLDE 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 399 IFTSDGLHAEvtgvgynqfgEVIVdgdvvhgfynpavsriveAGCVCNDAviRNNTLMGKPTEGALIALamKMGLDGLQQ 478
Cdd:cd02076  305 PYSLEGDGKD----------ELLL------------------LAALASDT--ENPDAIDTAILNALDDY--KPDLAGYKQ 352
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 479 -DYirkaeYPFSSEqkwmaVKCVHRTQQDRPEICF--MKGAYEQVIKYCttyqskgqtlTLTQQQRDVYQQEKARMGSAG 555
Cdd:cd02076  353 lKF-----TPFDPV-----DKRTEATVEDPDGERFkvTKGAPQVILELV----------GNDEAIRQAVEEKIDELASRG 412
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 556 LRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK---TSQSVSGEE 632
Cdd:cd02076  413 YRSLGVARKEDGGRWELLGLLPLFDPPRPDSKATIARAKELGVRVKMITGDQLAIAKETARQLGMGTNilsAERLKLGGG 492
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 633 IDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILV 712
Cdd:cd02076  493 GGGMPGSELIEFIEDADGFAEVFPEHKYRIVEALQQRGHLVGMTGDGVNDAPALKKADVGIAV-SGATDAARAAADIVLT 571
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 713 DDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGpPAQSLGvepVDKDV 792
Cdd:cd02076  572 APGLSVIIDAIKTSRQIFQRMKSYVIYRIAETLRILVFFTLGILILNFYPLPLIMIVLIAILNDG-ATLTIA---YDNVP 647
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 793 IRKPPRNWKdsiLTKNLILKIL------VSSIIIVC---GTLFVFWRELRDNVItprdTTMTFTCFVFFDMFNALSSRsq 863
Cdd:cd02076  648 PSPRPVRWN---MPELLGIATVlgvvltISSFLLLWlldDQGWFEDIVLSAGEL----QTILYLQLSISGHLTIFVTR-- 718
                        810       820       830
                 ....*....|....*....|....*....|.
gi 312836765 864 TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIY 894
Cdd:cd02076  719 TRGPFWRPRPSPLLFIAVVLTQILATLLAVY 749
ATPase-IIIA_H TIGR01647
plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton ...
79-778 6.23e-113

plasma-membrane proton-efflux P-type ATPase; This model describes the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea. The best studied representative is from yeast.


Pssm-ID: 273731 [Multi-domain]  Cd Length: 754  Bit Score: 365.11  E-value: 6.23e-113
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   79 GLNKCEVSHRRAFHGWNEFdISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRS 158
Cdd:TIGR01647   1 GLTSAEAKKRLAKYGPNEL-PEKKVSPLLKFLGFFWNPLSWVMEAAAIIAIALENWVDFVIILGLLLLNATIGFIEENKA 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  159 EKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTapqpa 238
Cdd:TIGR01647  80 GNAVEALKQSLAPKARVLRDGKWQEIPASELVPGDVVRLKIGDIVPADCRLFEGDYIQVDQAALTGESLPVTKKT----- 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  239 atnGDlasrsnIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVG 318
Cdd:TIGR01647 155 ---GD------IAYSGSTVKQGEAEAVVTATGMNTFFGKAAALVQSTETGSGHLQKILSKIGLFLIVLIGVLVLIELVVL 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  319 WLL-GKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVT 397
Cdd:TIGR01647 226 FFGrGESFREGLQFALVLLVGGIPIAMPAVLSVTMAVGAAELAKKKAIVTRLTAIEELAGMDILCSDKTGTLTLNKLSID 305
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  398 HIFTsdglhaevtgvgynQFGEVIVDGDVVHGFYnpaVSRivEAGcvcNDAVirNNTLMGKptegaLIALAMKMgldglq 477
Cdd:TIGR01647 306 EILP--------------FFNGFDKDDVLLYAAL---ASR--EED---QDAI--DTAVLGS-----AKDLKEAR------ 350
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  478 qDYIRKAEY-PFSSEQKwmAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYqskgqtltltQQQRDVYQQEKARMGSAGL 556
Cdd:TIGR01647 351 -DGYKVLEFvPFDPVDK--RTEATVEDPETGKRFKVTKGAPQVILDLCDNK----------KEIEEKVEEKVDELASRGY 417
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  557 RVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK--TSQSVSGEEID 634
Cdd:TIGR01647 418 RALGVARTDEEGRWHFLGLLPLFDPPRHDTKETIERARHLGVEVKMVTGDHLAIAKETARRLGLGTNiyTADVLLKGDNR 497
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  635 AMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDD 714
Cdd:TIGR01647 498 DDLPSGLGEMVEDADGFAEVFPEHKYEIVEILQKRGHLVGMTGDGVNDAPALKKADVGIAV-AGATDAARSAADIVLTEP 576
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 312836765  715 DFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATL-MNFpnPLNAMQILWINIIMDGP 778
Cdd:TIGR01647 577 GLSVIVDAILESRKIFQRMKSYVIYRIAETIRIVFFFGLLILiLNF--YFPPIMVVIIAILNDGT 639
P-type_ATPases cd01431
ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, ...
380-783 1.96e-108

ATP-dependent membrane-bound cation and aminophospholipid transporters; The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319764 [Multi-domain]  Cd Length: 319  Bit Score: 338.27  E-value: 1.96e-108
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 380 VICSDKTGTLTKNEMTVTHIFTsdglhaevtgvgynqfgevivdgdvvhgfynpavsriveagcvcndavirnntlmgkp 459
Cdd:cd01431    1 VICSDKTGTLTKNGMTVTKLFI---------------------------------------------------------- 22
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 460 tegalialamkmgldglqqdyirkAEYPFSSEQKWMAVKCVHrtqqDRPEICFMKGAYEQVIKYCTTyqskgqtlTLTQQ 539
Cdd:cd01431   23 ------------------------EEIPFNSTRKRMSVVVRL----PGRYRAIVKGAPETILSRCSH--------ALTEE 66
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 540 QRDVYQQEKARMGSAGLRVLALASGP---------ELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQET 610
Cdd:cd01431   67 DRNKIEKAQEESAREGLRVLALAYREfdpetskeaVELNLVFLGLIGLQDPPRPEVKEAIAKCRTAGIKVVMITGDNPLT 146
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 611 AVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAAD 690
Cdd:cd01431  147 AIAIAREIGIDTKASGVILGEEADEMSEEELLDLIAKVAVFARVTPEQKLRIVKALQARGEVVAMTGDGVNDAPALKQAD 226
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 691 IGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILW 770
Cdd:cd01431  227 VGIAMGSTGTDVAKEAADIVLLDDNFATIVEAVEEGRAIYDNIKKNITYLLANNVAEVFAIALALFLGGPLPLLAFQILW 306
                        410
                 ....*....|...
gi 312836765 771 INIIMDGPPAQSL 783
Cdd:cd01431  307 INLVTDLIPALAL 319
PRK10517 PRK10517
magnesium-transporting ATPase MgtA; Provisional
52-828 5.45e-104

magnesium-transporting ATPase MgtA; Provisional


Pssm-ID: 236705 [Multi-domain]  Cd Length: 902  Bit Score: 345.13  E-value: 5.45e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  52 IPVLTSKKASELPVSEVASILQA--DLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISV 129
Cdd:PRK10517  38 VPPSLSARCLKAAVMPEEELWKTfdTHPEGLNEAEVESAREQHGENELPAQKPLPWWVHLWVCYRNPFNILLTILGAISY 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 130 LMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR--EGKLEHTLA----RDLVPGDTVCLSVGDRV 203
Cdd:PRK10517 118 ATEDLFAAGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRviNDKGENGWLeipiDQLVPGDIIKLAAGDMI 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 204 PADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQ 283
Cdd:PRK10517 198 PADLRILQARDLFVAQASLTGESLPVEKFATTRQPEHSNPL-ECDTLCFMGTNVVSGTAQAVVIATGANTWFGQLAGRVS 276
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 284 AEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLV-GWLLGkDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 362
Cdd:PRK10517 277 EQDSEPNAFQQGISRVSWLLIRFMLVMAPVVLLInGYTKG-DWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQ 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 363 RAIVKKLPIVETLGCCNVICSDKTGTLTKNEmtvthIFTSDglHAEVtgvgynqFGEviVDGDVVH-----GFYNPAVSR 437
Cdd:PRK10517 356 KVIVKRLDAIQNFGAMDILCTDKTGTLTQDK-----IVLEN--HTDI-------SGK--TSERVLHsawlnSHYQTGLKN 419
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 438 IVEAgcvcndAVIrnntlmgkptEGALIALAMKMGldglqQDYIRKAEYPFSSEQKWMAVkcVHRTQQDRPE-ICfmKGA 516
Cdd:PRK10517 420 LLDT------AVL----------EGVDEESARSLA-----SRWQKIDEIPFDFERRRMSV--VVAENTEHHQlIC--KGA 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 517 YEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGP-----------ELGQLTFLGLVGIIDPPRTG 585
Cdd:PRK10517 475 LEEILNVCSQVRHNGEIVPLDDIMLRRIKRVTDTLNRQGLRVVAVATKYlparegdyqraDESDLILEGYIAFLDPPKET 554
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 586 VKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKS 665
Cdd:PRK10517 555 TAPALKALKASGVTVKILTGDSELVAAKVCHEVGL--DAGEVLIGSDIETLSDDELANLAERTTLFARLTPMHKERIVTL 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 666 LQKNGSVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSI 745
Cdd:PRK10517 633 LKREGHVVGFMGDGINDAPALRAADIGISV-DGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNF 711
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 746 AAL--TLISLATLmnfPN-PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKPPRnWKDSILTKNLILKILVSSII-I 820
Cdd:PRK10517 712 GNVfsVLVASAFL---PFlPMLPLHLLIQNLLYD--VSQvAIPFDNVDDEQIQKPQR-WNPADLGRFMVFFGPISSIFdI 785
                        810
                 ....*....|
gi 312836765 821 VCGTL--FVF 828
Cdd:PRK10517 786 LTFCLmwWVF 795
ATPase-IIIB_Mg TIGR01524
magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ...
59-829 3.45e-103

magnesium-translocating P-type ATPase; This model describes the magnesium translocating P-type ATPase found in a limited number of bacterial species and best described in Salmonella typhimurium, which contains two isoforms. These transporters are active in low external Mg2+ concentrations and pump the ion into the cytoplasm. The magnesium ATPases have been classified as type IIIB by a phylogenetic analysis. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 130587 [Multi-domain]  Cd Length: 867  Bit Score: 342.23  E-value: 3.45e-103
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   59 KASELPVSEVASILQAdLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAV 138
Cdd:TIGR01524  14 KESQMGKETLLRKLGV-HETGLTNVEVTERLAEFGPNQTVEEKKVPNLRLLIRAFNNPFIYILAMLMGVSYLTDDLEATV 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  139 SITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR------EGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEA 212
Cdd:TIGR01524  93 IIALMVLASGLLGFIQESRAERAAYALKNMVKNTATVLRvinengNGSMDEVPIDALVPGDLIELAAGDIIPADARVISA 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  213 VDLSIDESSLTGETTPCSKVTAPQPAATNgDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMqAEEAPKTPL 292
Cdd:TIGR01524 173 RDLFINQSALTGESLPVEKFVEDKRARDP-EILERENLCFMGTNVLSGHAQAVVLATGSSTWFGSLAIAA-TERRGQTAF 250
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  293 QKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIV 372
Cdd:TIGR01524 251 DKGVKSVSKLLIRFMLVMVPVVLMINGLMKGDWLEAFLFALAVAVGLTPEMLPMIVSSNLAKGAINMSKKKVIVKELSAI 330
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  373 ETLGCCNVICSDKTGTLTKNEMTVTHiftsdglHAEVTGVGYNQfgevivdgdVVHGFYNPAVSRiVEAGCVCNDAVIRn 452
Cdd:TIGR01524 331 QNFGAMDILCTDKTGTLTQDKIELEK-------HIDSSGETSER---------VLKMAWLNSYFQ-TGWKNVLDHAVLA- 392
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  453 ntlmgKPTEGALIALAMKmgldglqqdYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYCTTYQSKGQ 532
Cdd:TIGR01524 393 -----KLDESAARQTASR---------WKKVDEIPFDFDRRRLSV-VVENRAEVTRLIC--KGAVEEMLTVCTHKRFGGA 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  533 TLTLTQQQRDVYQQEKARMGSAGLRVLALAS--GPELG---------QLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIK 601
Cdd:TIGR01524 456 VVTLSESEKSELQDMTAEMNRQGIRVIAVATktLKVGEadftktdeeQLIIEGFLGFLDPPKESTKEAIAALFKNGINVK 535
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  602 MITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVN 681
Cdd:TIGR01524 536 VLTGDNEIVTARICQEVGI--DANDFLLGADIEELSDEELARELRKYHIFARLTPMQKSRIIGLLKKAGHTVGFLGDGIN 613
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  682 DAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPN 761
Cdd:TIGR01524 614 DAPALRKADVGISV-DTAADIAKEASDIILLEKSLMVLEEGVIEGRNTFGNILKYLKMTASSNFGNVFSVLVASAFIPFL 692
                         730       740       750       760       770       780
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 312836765  762 PLNAMQILWINIIMDGPPAqSLGVEPVDKDVIRKpPRNWKDSILTKNLILKILVSSIIIVCGTLFVFW 829
Cdd:TIGR01524 693 PMLSLHLLIQNLLYDFSQL-TLPWDKMDREFLKK-PHQWEQKGMGRFMLCIGPVSSIFDIATFLLMWF 758
PRK15122 PRK15122
magnesium-transporting ATPase; Provisional
77-800 9.37e-91

magnesium-transporting ATPase; Provisional


Pssm-ID: 237914 [Multi-domain]  Cd Length: 903  Bit Score: 308.88  E-value: 9.37e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  77 QNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLM------HQFDDAVSITVAILIV-VT 149
Cdd:PRK15122  43 RQGLTEEDAAERLQRYGPNEVAHEKPPHALVQLLQAFNNPFIYVLMVLAAISFFTdywlplRRGEETDLTGVIIILTmVL 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 150 VA----FVQEYRSEKSLEELSKLVPPECHCVR------EGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDE 219
Cdd:PRK15122 123 LSgllrFWQEFRSNKAAEALKAMVRTTATVLRrghagaEPVRREIPMRELVPGDIVHLSAGDMIPADVRLIESRDLFISQ 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 220 SSLTGETTPCSKV---------TAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEaPKT 290
Cdd:PRK15122 203 AVLTGEALPVEKYdtlgavagkSADALADDEGSLLDLPNICFMGTNVVSGTATAVVVATGSRTYFGSLAKSIVGTR-AQT 281
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 291 PLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLP 370
Cdd:PRK15122 282 AFDRGVNSVSWLLIRFMLVMVPVVLLINGFTKGDWLEALLFALAVAVGLTPEMLPMIVSSNLAKGAIAMARRKVVVKRLN 361
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 371 IVETLGCCNVICSDKTGTLTKNEMTVTHiftsdglHaevtgvgynqfgeviVDgdvVHGFYNPAVSRIV------EAGcv 444
Cdd:PRK15122 362 AIQNFGAMDVLCTDKTGTLTQDRIILEH-------H---------------LD---VSGRKDERVLQLAwlnsfhQSG-- 414
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 445 cndavIRNntLMGKptegALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVkCVHRTQQDRPEICfmKGAYEQVIKYC 524
Cdd:PRK15122 415 -----MKN--LMDQ----AVVAFAEGNPEIVKPAGYRKVDELPFDFVRRRLSV-VVEDAQGQHLLIC--KGAVEEMLAVA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 525 TTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASgPELGQ--------------LTFLGLVGIIDPPRTGVKEAV 590
Cdd:PRK15122 481 THVRDGDTVRPLDEARRERLLALAEAYNADGFRVLLVAT-REIPGgesraqystaderdLVIRGFLTFLDPPKESAAPAI 559
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 591 TTLIASGVSIKMITGDSQETAVAIASRLGLysKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNG 670
Cdd:PRK15122 560 AALRENGVAVKVLTGDNPIVTAKICREVGL--EPGEPLLGTEIEAMDDAALAREVEERTVFAKLTPLQKSRVLKALQANG 637
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 671 SVVAMTGDGVNDAVALKAADIGVAMgQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTsiaaltl 750
Cdd:PRK15122 638 HTVGFLGDGINDAPALRDADVGISV-DSGADIAKESADIILLEKSLMVLEEGVIKGRETFGNIIKYLNMTASS------- 709
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 312836765 751 islatlmNFPN--------------PLNAMQILWINIIMDgpPAQ-SLGVEPVDKDVIRKpPRNW 800
Cdd:PRK15122 710 -------NFGNvfsvlvasafipflPMLAIHLLLQNLMYD--ISQlSLPWDKMDKEFLRK-PRKW 764
P-type_ATPase cd02609
uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized ...
120-800 7.39e-83

uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7; This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.


Pssm-ID: 319795 [Multi-domain]  Cd Length: 661  Bit Score: 281.48  E-value: 7.39e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 120 LLLASAVISVLMHQFDDAVSITVAILIVVtVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSV 199
Cdd:cd02609   42 INFVIAVLLILVGSYSNLAFLGVIIVNTV-IGIVQEIRAKRQLDKLSILNAPKVTVIRDGQEVKIPPEELVLDDILILKP 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 200 GDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTapqpaatnGDLAsrsniaFMGTLVRCGKAKGVVIGTGENSefgevF 279
Cdd:cd02609  121 GEQIPADGEVVEGGGLEVDESLLTGESDLIPKKA--------GDKL------LSGSFVVSGAAYARVTAVGAES-----Y 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 280 KMMQAEEAPK-----TPLQKSMDLLGKqlsFYSFGII--GIIMLVG--WLLGKDILEMFTISVSLAVAAIPEGLPIVVTV 350
Cdd:cd02609  182 AAKLTLEAKKhklinSELLNSINKILK---FTSFIIIplGLLLFVEalFRRGGGWRQAVVSTVAALLGMIPEGLVLLTSV 258
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 351 TLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLhaevtgvgynqfgevivdgdvvhgf 430
Cdd:cd02609  259 ALAVGAIRLAKKKVLVQELYSIETLARVDVLCLDKTGTITEGKMKVERVEPLDEA------------------------- 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 431 YNPAVSRIVEAGCvcnDAVIRNNtlmgkPTEGALialamkmgLDGLQQD--YIRKAEYPFSSEQKWMAVkcvhrTQQDR- 507
Cdd:cd02609  314 NEAEAAAALAAFV---AASEDNN-----ATMQAI--------RAAFFGNnrFEVTSIIPFSSARKWSAV-----EFRDGg 372
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 508 ------PEIcFMKGAYEQVikycttyqskgqtltltQQQRDVYQQEkarmgsaGLRVLALASGPE-------LGQLTFLG 574
Cdd:cd02609  373 twvlgaPEV-LLGDLPSEV-----------------LSRVNELAAQ-------GYRVLLLARSAGaltheqlPVGLEPLA 427
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 575 LVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysktsqsvSGEEIDA-----MDVQQLSQIVPKVA 649
Cdd:cd02609  428 LILLTDPIRPEAKETLAYFAEQGVAVKVISGDNPVTVSAIAKRAGL--------EGAESYIdastlTTDEELAEAVENYT 499
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 650 VFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGI 729
Cdd:cd02609  500 VFGRVTPEQKRQLVQALQALGHTVAMTGDGVNDVLALKEADCSIAMA-SGSDATRQVAQVVLLDSDFSALPDVVFEGRRV 578
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 730 YNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRK----------PPRN 799
Cdd:cd02609  579 VNNIERVASLFLVKTIYSVLLALICVITALPFPFLPIQITLISLFTIGIPSFFLALEPNKRRIEGGflrrvltkalPPLN 658

                 .
gi 312836765 800 W 800
Cdd:cd02609  659 R 659
ATPase-IB_hvy TIGR01525
heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the ...
118-765 8.13e-59

heavy metal translocating P-type ATPase; This model encompasses two equivalog models for the copper and cadmium-type heavy metal transporting P-type ATPases (TIGR01511 and TIGR01512) as well as those species which score ambiguously between both models. For more comments and references, see the files on TIGR01511 and 01512.


Pssm-ID: 273669 [Multi-domain]  Cd Length: 558  Bit Score: 211.72  E-value: 8.13e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  118 IMLLLASAVI-SVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVR-EGKLEHTLARDLVPGDTV 195
Cdd:TIGR01525   1 MDTLMALAAIaAYAMGLVLEGALLLFLFLLGETLEERAKSRASDALSALLALAPSTARVLQgDGSEEEVPVEELQVGDIV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  196 CLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSNIAFMGTLVRCGKAKGVVIGTGENSEF 275
Cdd:TIGR01525  81 IVRPGERIPVDGVVISGES-EVDESALTGESMPVEK--------------KEGDEVFAGTINGDGSLTIRVTKLGEDSTL 145
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  276 GEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALG 355
Cdd:TIGR01525 146 AQIVELVEEAQSSKAPIQRLADRIASYYVPAVLAIALLTFVVWLALGALWREALYRALTVLVVACPCALGLATPVAILVA 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  356 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHI-FTSDGLHAEVTGVgynqfgevivdgdvvhgfynpa 434
Cdd:TIGR01525 226 IGAAARRGILIKGGDALEKLAKVKTVVFDKTGTLTTGKPTVVDIePLDDASEEELLAL---------------------- 283
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  435 vsriveAGCvcndavirnntlMGKPTEGAlIALAMkmgldglqQDYIRKAEYPFSSEQkwmavkcvhrtQQDRPEiCFMK 514
Cdd:TIGR01525 284 ------AAA------------LEQSSSHP-LARAI--------VRYAKERGLELPPED-----------VEEVPG-KGVE 324
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  515 GAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELgqltfLGLVGIIDPPRTGVKEAVTTLI 594
Cdd:TIGR01525 325 ATVDGGREVRIGNPRFLGNRELAIEPISASPDLLNEGESQGKTVVFVAVDGEL-----LGVIALRDQLRPEAKEAIAALK 399
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  595 ASGV-SIKMITGDSQETAVAIASRLGLYSKtsqsvsgeeidamdvqqlsqivpkvaVFYRASPRHKMKIIKSLQKNGSVV 673
Cdd:TIGR01525 400 RAGGiKLVMLTGDNRSAAEAVAAELGIDDE--------------------------VHAELLPEDKLAIVKKLQEEGGPV 453
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  674 AMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NFVrfqlstsiAALTLIS 752
Cdd:TIGR01525 454 AMVGDGINDAPALAAADVGIAMG-SGSDVAIEAADIVLLNDDLRSLPTAIDLSRKTRRIIKqNLA--------WALGYNL 524
                         650
                  ....*....|....*.
gi 312836765  753 LA---TLMNFPNPLNA 765
Cdd:TIGR01525 525 VAiplAAGGLLPLWLA 540
ZntA COG2217
Cation transport ATPase [Inorganic ion transport and metabolism];
118-766 1.29e-56

Cation transport ATPase [Inorganic ion transport and metabolism];


Pssm-ID: 225127 [Multi-domain]  Cd Length: 713  Bit Score: 208.61  E-value: 1.29e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 118 IMLLLASAVISVLMHQFDDAVSITVAILIVvtvAFVQEY---RSEKSLEELSKLVPPECHCVREGKLEHTL-ARDLVPGD 193
Cdd:COG2217  158 IGAYAYSLYATLFPVYFEEAAMLIFLFLLG---RYLEARakgRARRAIRALLDLAPKTATVVRGDGEEEEVpVEEVQVGD 234
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 194 TVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaaTNGDlasrsnIAFMGTLVRCGKAKGVVIGTGENS 273
Cdd:COG2217  235 IVLVRPGERIPVDGVVVSGSS-SVDESMLTGESLPVEK--------KPGD------EVFAGTVNLDGSLTIRVTRVGADT 299
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 274 EFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGK-DILEMFTISVSLAVAAIPEGLPIVVTVTL 352
Cdd:COG2217  300 TLARIIRLVEEAQSSKAPIQRLADRVASYFVPVVLVIAALTFALWPLFGGgDWETALYRALAVLVIACPCALGLATPTAI 379
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 353 ALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTgvgynqfgevivdgdvvhgfyn 432
Cdd:COG2217  380 LVGIGRAARRGILIKGGEALERLAKVDTVVFDKTGTLTEGKPEVTDVVALDGDEDELL---------------------- 437
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 433 pAVSRIVEAGCvcN----DAVIRNNTLMGKPTEGALIALAmkmGLdGLqqdyirKAEYpfsSEQKWMAvkcvhrtqqdrp 508
Cdd:COG2217  438 -ALAAALEQHS--EhplaKAIVKAAAERGLPDVEDFEEIP---GR-GV------EAEV---DGERVLV------------ 489
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 509 eicfmkGAYEQVikycttyQSKGQTLTLTQQQRDVYQQEkarmgsaGLRVLALASGPELgqltfLGLVGIIDPPRTGVKE 588
Cdd:COG2217  490 ------GNARLL-------GEEGIDLPLLSERIEALESE-------GKTVVFVAVDGKL-----VGVIALADELRPDAKE 544
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 589 AVTTLIASGVSIKMITGDSQETAVAIASRLGlysktsqsvsgeeIDAmdvqqlsqivpkvaVFYRASPRHKMKIIKSLQK 668
Cdd:COG2217  545 AIAALKALGIKVVMLTGDNRRTAEAIAKELG-------------IDE--------------VRAELLPEDKAEIVRELQA 597
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 669 NGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NFVrFQLSTSIAA 747
Cdd:COG2217  598 EGRKVAMVGDGINDAPALAAADVGIAMG-SGTDVAIEAADVVLMRDDLSAVPEAIDLSRATRRIIKqNLF-WAFGYNAIA 675
                        650
                 ....*....|....*....
gi 312836765 748 LTLislaTLMNFPNPLNAM 766
Cdd:COG2217  676 IPL----AAGGLLTPWIAA 690
P-type_ATPase_HM cd02079
P-type heavy metal-transporting ATPase; Heavy metal-transporting ATPases (Type IB ATPases) ...
116-766 2.69e-54

P-type heavy metal-transporting ATPase; Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319774 [Multi-domain]  Cd Length: 617  Bit Score: 199.75  E-value: 2.69e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 116 PLIMLLLASAVI-----SVLMHQ------FDDAVSITVAILIVvtvAFVQEY---RSEKSLEELSKLVPPECHCVREGKL 181
Cdd:cd02079   59 LNMDVLVSLAAIgafvaSLLTPLlggigyFEEAAMLLFLFLLG---RYLEERarsRARSALKALLSLAPETATVLEDGST 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 182 EHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKVTapqpaatnGDLAsrsniaFMGTLVRCGK 261
Cdd:cd02079  136 EEVPVDDLKVGDVVLVKPGERIPVDGVVVSGES-SVDESSLTGESLPVEKGA--------GDTV------FAGTINLNGP 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 262 AKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIP 341
Cdd:cd02079  201 LTIEVTKTGEDTTLAKIIRLVEEAQSSKPPLQRLADRFARYFTPAVLVLAALVFLFWPLVGGPPSLALYRALAVLVVACP 280
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 342 EGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEvtgvgynqfgEVI 421
Cdd:cd02079  281 CALGLATPTAIVAGIGRAARKGILIKGGDVLETLAKVDTVAFDKTGTLTEGKPEVTEIEPLEGFSED----------ELL 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 422 vdgdvvhgfynpAVSRIVEAGCvcndavirnntlmGKPtegalIALAMkmgldglqQDYIRKAEypfsseqkwmAVKCVH 501
Cdd:cd02079  351 ------------ALAAALEQHS-------------EHP-----LARAI--------VEAAEEKG----------LPPLEV 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 502 RTQQDRPEicfmKGAYEQVIkycttyqskGQTLTLTQQ---QRDVYQQEKARMGSAG-LRVLALASGPELgqltfLGLVG 577
Cdd:cd02079  383 EDVEEIPG----KGISGEVD---------GREVLIGSLsfaEEEGLVEAADALSDAGkTSAVYVGRDGKL-----VGLFA 444
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 578 IIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSktsqsvsgeeidamdvqqlsqivpkvaVFYRASPR 657
Cdd:cd02079  445 LEDQLRPEAKEVIAELKSGGIKVVMLTGDNEAAAQAVAKELGIDE---------------------------VHAGLLPE 497
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 658 HKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQtGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIK-NF 736
Cdd:cd02079  498 DKLAIVKALQAEGGPVAMVGDGINDAPALAQADVGIAMGS-GTDVAIETADIVLLSNDLSKLPDAIRLARRTRRIIKqNL 576
                        650       660       670
                 ....*....|....*....|....*....|
gi 312836765 737 VrFQLSTSIAALTLislaTLMNFPNPLNAM 766
Cdd:cd02079  577 A-WALGYNAIALPL----AALGLLTPWIAA 601
ATPase-IB2_Cd TIGR01512
heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ...
120-765 5.18e-51

heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; This model describes the P-type ATPase primarily responsible for translocating cadmium ions (and other closely-related divalent heavy metals such as cobalt, mercury, lead and zinc) across biological membranes. These transporters are found in prokaryotes and plants. Experimentally characterized members of the seed alignment include: SP|P37617 from E. coli, SP|Q10866 from Mycobacterium tuberculosis and SP|Q59998 from Synechocystis PCC6803. The cadmium P-type ATPases have been characterized as Type IB based on a phylogenetic analysis which combines the copper-translocating ATPases with the cadmium-translocating species. This model and that describing the copper-ATPases (TIGR01511) are well separated, and thus we further type the copper-ATPases as IB1 and the cadmium-ATPases as IB2. Several sequences which have not been characterized experimentally fall just below trusted cutoff for both of these models (SP|Q9CCL1 from Mycobacterium leprae, GP|13816263 from Sulfolobus solfataricus, OMNI|NTL01CJ01098 from Campylobacter jejuni, OMNI|NTL01HS01687 from Halobacterium sp., GP|6899169 from Ureaplasma urealyticum and OMNI|HP1503 from Helicobacter pylori). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273665 [Multi-domain]  Cd Length: 550  Bit Score: 188.69  E-value: 5.18e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  120 LLLASAVISVLMHQFDDAVSItvaILIVVTVAFVQEY---RSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVC 196
Cdd:TIGR01512   4 LMALAALGAVAIGEYLEGALL---LLLFSIGETLEEYasgRARRALKALMELAPDTARRLQGDSLEEVAVEELKVGDVVV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  197 LSVGDRVPADLRLfEAVDLSIDESSLTGETTPCSKvtapqpaatngdlaSRSNIAFMGTLVRCGKAKGVVIGTGENSEFG 276
Cdd:TIGR01512  81 VKPGERVPVDGEV-LSGTSSVDESALTGESVPVEK--------------APGDEVFAGAINLDGVLTIEVTKLPADSTIA 145
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  277 EVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKD-ILEMFTISVSLAVAAIPEGLPIVVTVTLALG 355
Cdd:TIGR01512 146 KIVNLVEEAQSRKAPTQRFIDRFARYYTPAVLAIALAAALVPPLLGAGpFLEWIYRALVLLVVASPCALVISAPAAYLSA 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  356 VMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEvtgvgynqfgevivdgdvvhGFYNPAV 435
Cdd:TIGR01512 226 ISAAARHGILIKGGAALEALAKIKTVAFDKTGTLTTGKPKVTDVHPADGHSES--------------------EVLRLAA 285
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  436 SriVEAGCVcndavirnntlmgKPtegalIALAMkmgldglqQDYIRKAEYPFSSEQkwmavkcvhrtQQDRPEicfmKG 515
Cdd:TIGR01512 286 A--AEQGST-------------HP-----LARAI--------VDYARARELAPPVED-----------VEEVPG----EG 322
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  516 AYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQekarmgSAGLRVLALASGpelgqlTFLGLVGIIDPPRTGVKEAVTTLIA 595
Cdd:TIGR01512 323 VRAVVDGGEVRIGNPRSLSEAVGASIAVPES------AGKTIVLVARDG------TLLGYIALSDELRPDAAEAIAELKA 390
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  596 SGVS-IKMITGDSQETAVAIASRLGlysktsqsvsgeeIDamdvqqlsqivpkvAVFYRASPRHKMKIIKSLQKNGSVVA 674
Cdd:TIGR01512 391 LGIKrLVMLTGDRRAVAEAVARELG-------------ID--------------EVHAELLPEDKLEIVKELREKAGPVA 443
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  675 MTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFqlstSIAALTLISLA 754
Cdd:TIGR01512 444 MVGDGINDAPALAAADVGIAMGASGSDVALETADVVLLNDDLSRLPQAIRLARRTRRIIKQNVVI----ALGIILVLILL 519
                         650
                  ....*....|.
gi 312836765  755 TLMNFPNPLNA 765
Cdd:TIGR01512 520 ALFGVLPLWLA 530
P-type_ATPase_Cu-like cd07552
P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+) ...
162-767 2.04e-49

P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+)-ATPase; Archaeoglobus fulgidus CopB transports Cu(2+) from the cytoplasm to the exterior of the cell using ATP as energy source, it transports preferentially Cu(2+) over Cu(+), it is activated by Cu(2+) with high affinity and partially by Cu(+) and Ag(+). This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.


Pssm-ID: 319850 [Multi-domain]  Cd Length: 632  Bit Score: 185.97  E-value: 2.04e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 162 LEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAvDLSIDESSLTGETTPCSKVTAPQ--PAA 239
Cdd:cd07552  122 LKKLAELLPKTAHLVTDGSIEDVPVSELKVGDVVLVRAGEKIPADGTILEG-ESSVNESMVTGESKPVEKKPGDEviGGS 200
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 240 TNGDlasrsniafmGTL-VRcgkakgvVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLsFYSFGIIGIIMLVG 318
Cdd:cd07552  201 VNGN----------GTLeVK-------VTKTGEDSYLSQVMELVAQAQASKSRAENLADKVAGWL-FYIALGVGIIAFII 262
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 319 WLLGKDILEMFTISVSLAVAAIPEGL----PIVVTVTLALGVMR--MVKKRaivKKLPIVETLgccNVICSDKTGTLTKN 392
Cdd:cd07552  263 WLILGDLAFALERAVTVLVIACPHALglaiPLVVARSTSIAAKNglLIRNR---EALERARDI---DVVLFDKTGTLTEG 336
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 393 EMTVTHIFTSDGLHAEvtgvgynqfgEVI-----VDGDVVHgfynPAVSRIVEAgcvcndavirnntlmgkptegalial 467
Cdd:cd07552  337 KFGVTDVITFDEYDED----------EILslaaaLEAGSEH----PLAQAIVSA-------------------------- 376
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 468 amkmgldgLQQdyiRKAEYPFSSEQKWMAVKCVHRTQQDRpeicfmkgayeqvikyctTYQSKGQTLtLTQQQRDVYQQE 547
Cdd:cd07552  377 --------AKE---KGIRPVEVENFENIPGVGVEGTVNGK------------------RYQVVSPKY-LKELGLKYDEEL 426
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 548 KARMGSAGLRVLALASGPELgqltfLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLysktsqs 627
Cdd:cd07552  427 VKRLAQQGNTVSFLIQDGEV-----IGAIALGDEIKPESKEAIRALKAQGITPVMLTGDNEEVAQAVAEELGI------- 494
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765 628 vsgEEidamdvqqlsqivpkvaVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGqTGTDVCKEAA 707
Cdd:cd07552  495 ---DE-----------------YFAEVLPEDKAKKVKELQAEGKKVAMVGDGVNDAPALAQADVGIAIG-AGTDVAIESA 553
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 312836765 708 DMILVDDDFQTIMSAIEEGKGIYNNIK---------NFVRFQLSTSIAALTLISL-----ATLMNFPN---PLNAMQ 767
Cdd:cd07552  554 DVVLVKSDPRDIVDFLELAKATYRKMKqnlwwgagyNVIAIPLAAGVLAPIGIILspavgAVLMSLSTvivAINAMT 630
E1-E2_ATPase pfam00122
E1-E2 ATPase;
170-362 3.77e-49

E1-E2 ATPase;


Pssm-ID: 333857 [Multi-domain]  Cd Length: 178  Bit Score: 171.59  E-value: 3.77e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  170 PPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDlSIDESSLTGETTPCSKvtapqpaatngdlaSRSN 249
Cdd:pfam00122   1 PPTATVLRDGTEEEIPADELVPGDIVLLKPGERVPADGRIVEGSA-SVDESALTGESLPVEK--------------EKGD 65
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765  250 IAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMF 329
Cdd:pfam00122  66 MVFSGTVVVSGSAKAVVTATGEDTELGKIARLVEEAKSKKTPLQRLLDKLAKYFTPVVLLLALAVFLLWLFVGGPPLEAL 145
                         170       180       190
                  ....*....|....*....|....*....|...
gi 312836765  330 TISVSLAVAAIPEGLPIVVTVTLALGVMRMVKK 362
Cdd:pfam00122 146 LRALALLVAACPCALPLATPLALALGARRLAKK 178
P-ATPase-V TIGR01657
P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade ...
77-903 2.22e-48

P-type ATPase of unknown pump specificity (type V); These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in.


Pssm-ID: 273738 [Multi-domain]  Cd Length: 1054  Bit Score: 186.80  E-value: 2.22e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765    77 QNGLNKCEVSHRRAFHGWNEFDI---SEDEPLWKkyisQFKNPLIMLLLASaVISVLMHQFDDAVSITVAILIVVTVAFV 153
Cdd:TIGR01657  137 SNGLTTGDIAQRKAKYGKNEIEIpvpSFLELLKE----EVLHPFYVFQVFS-VILWLLDEYYYYSLCIVFMSSTSISLSV 211
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   154 QEYRseKSLEELSKLV-PPECHCV-REGKLEHTLARDLVPGDtvCLSVGDR----VPADLRLFEAvDLSIDESSLTGETT 227
Cdd:TIGR01657  212 YQIR--KQMQRLRDMVhKPQSVIViRNGKWVTIASDELVPGD--IVSIPRPeektMPCDSVLLSG-SCIVNESMLTGESV 286
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   228 PCSKVTAPQPAATNGDLA----SRSNIAFMGTLV-------RCGKAKGVVIGTGENSEFGE-VFKMMQAEEAPKTPLQKS 295
Cdd:TIGR01657  287 PVLKFPIPDNGDDDEDLFlyetSKKHVLFGGTKIlqirpypGDTGCLAIVVRTGFSTSKGQlVRSILYPKPRVFKFYKDS 366
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   296 MDLLGKQLSFYSFGIIGIImLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMvKKRAIVKKLPI-VET 374
Cdd:TIGR01657  367 FKFILFLAVLALIGFIYTI-IELIKDGRPLGKIILRSLDIITIVVPPALPAELSIGINNSLARL-KKKGIFCTSPFrINF 444
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   375 LGCCNVICSDKTGTLTknemtvthiftSDGLHAE-VTGVGYNQFGEVIVDGDVvhgfyNPAVSRIVEAGCVCNDAVIRNN 453
Cdd:TIGR01657  445 AGKIDVCCFDKTGTLT-----------EDGLDLRgVQGLSGNQEFLKIVTEDS-----SLKPSITHKALATCHSLTKLEG 508
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   454 TLMGKPTEGAL-------------------IALAMKMGLDGLQQDYIRKaeYPFSSEQKWMAVKCvhRTQQDRPEICFMK 514
Cdd:TIGR01657  509 KLVGDPLDKKMfeatgwtleeddesaeptsILAVVRTDDPPQELSIIRR--FQFSSALQRMSVIV--STNDERSPDAFVK 584
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 312836765   515 GAYEQVIKYCttyqsKGQTLtltqqQRDvYQQEKARMGSAGLRVLALASGPeLGQ-----------------LTFLGLVG 577
Cdd:TIGR01657  585 GAPETIQSLC-----SPETV-----PSD-YQEVLKSYTREGYRVLALA