NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|257096014|ref|NP_001158034|]
View 

vesicle-trafficking protein SEC22c [Mus musculus]

Protein Classification

Longin domain-containing protein (domain architecture ID 13000475)

Longin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Longin cd14824
longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including ...
5-123 2.48e-18

longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including VAMP7, Ykt6, and Sec22. Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex. Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterized by a conserved N-terminal domain with a profilin-like fold called a longin domain.


:

Pssm-ID: 341428  Cd Length: 122  Bit Score: 78.84  E-value: 2.48e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096014   5 LFASIVRVRDGLPLSASTD---FYYAQEFLEcrRQLKTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAA 81
Cdd:cd14824    1 LYALIARGSDGLILAEYTDlssFSSVKENFK--FVAKTILERTPPSGQRQSVEEGDYVFHYLVEDGLCYLCITDKEYPKR 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 257096014  82 MAFCFLEALWWDFIASYDTTcVGLASRPYAFLEFDSVIQKTK 123
Cdd:cd14824   79 VAFAFLEEVLDEFLSKYGSS-AWTAARPYLFSEFDPELKKLM 119
 
Name Accession Description Interval E-value
Longin cd14824
longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including ...
5-123 2.48e-18

longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including VAMP7, Ykt6, and Sec22. Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex. Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterized by a conserved N-terminal domain with a profilin-like fold called a longin domain.


Pssm-ID: 341428  Cd Length: 122  Bit Score: 78.84  E-value: 2.48e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096014   5 LFASIVRVRDGLPLSASTD---FYYAQEFLEcrRQLKTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAA 81
Cdd:cd14824    1 LYALIARGSDGLILAEYTDlssFSSVKENFK--FVAKTILERTPPSGQRQSVEEGDYVFHYLVEDGLCYLCITDKEYPKR 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 257096014  82 MAFCFLEALWWDFIASYDTTcVGLASRPYAFLEFDSVIQKTK 123
Cdd:cd14824   79 VAFAFLEEVLDEFLSKYGSS-AWTAARPYLFSEFDPELKKLM 119
Longin pfam13774
Regulated-SNARE-like domain; Longin is one of the approximately 26 components required for ...
38-114 4.79e-14

Regulated-SNARE-like domain; Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex. Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterized by a conserved N-terminal domain with a profilin-like fold called a longin domain.


Pssm-ID: 338939  Cd Length: 78  Bit Score: 66.05  E-value: 4.79e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 257096014   38 KTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAAMAFCFLEALWWDFIASYD-TTCVGLASRPYAFLE 114
Cdd:pfam13774   1 KTILKKIPPSPQRQTYEEGNYTFHYLIEDGICYLVIADKSYPRRLAFAFLEEIKDEFLSTYGpKAATASVLRPYAFNE 78
 
Name Accession Description Interval E-value
Longin cd14824
longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including ...
5-123 2.48e-18

longin domain; Longin-domain is N-terminal domain of a subgroup of R-SNARE proteins, including VAMP7, Ykt6, and Sec22. Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex. Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterized by a conserved N-terminal domain with a profilin-like fold called a longin domain.


Pssm-ID: 341428  Cd Length: 122  Bit Score: 78.84  E-value: 2.48e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096014   5 LFASIVRVRDGLPLSASTD---FYYAQEFLEcrRQLKTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAA 81
Cdd:cd14824    1 LYALIARGSDGLILAEYTDlssFSSVKENFK--FVAKTILERTPPSGQRQSVEEGDYVFHYLVEDGLCYLCITDKEYPKR 78
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 257096014  82 MAFCFLEALWWDFIASYDTTcVGLASRPYAFLEFDSVIQKTK 123
Cdd:cd14824   79 VAFAFLEEVLDEFLSKYGSS-AWTAARPYLFSEFDPELKKLM 119
Longin pfam13774
Regulated-SNARE-like domain; Longin is one of the approximately 26 components required for ...
38-114 4.79e-14

Regulated-SNARE-like domain; Longin is one of the approximately 26 components required for transporting proteins from the ER to the plasma membrane, via the Golgi apparatus. It is necessary for the steps of the transfer from the ER to the Golgi complex. Longins are the only R-SNAREs that are common to all eukaryotes, and they are characterized by a conserved N-terminal domain with a profilin-like fold called a longin domain.


Pssm-ID: 338939  Cd Length: 78  Bit Score: 66.05  E-value: 4.79e-14
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 257096014   38 KTLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAAMAFCFLEALWWDFIASYD-TTCVGLASRPYAFLE 114
Cdd:pfam13774   1 KTILKKIPPSPQRQTYEEGNYTFHYLIEDGICYLVIADKSYPRRLAFAFLEEIKDEFLSTYGpKAATASVLRPYAFNE 78
longin-like cd14818
Longin-like domains; Longin-like domains are small protein domains present in a variety of ...
5-122 4.42e-03

Longin-like domains; Longin-like domains are small protein domains present in a variety of proteins and members of protein complexes involved in or required for different steps during the transport of proteins from the ribosome to the ER to the plasma membrane, via the Golgi apparatus. Examples are mu and sigma subunits of the heterotetrameric adaptor protein (AP) complex, zeta and delta subunits of the heterotetrameric F-COPI complex, a subgroup of R-SNARE proteins, a subfamily of the transport protein particle (TRAPP), and the signal recognition particle receptor subunit alpha (SR-alpha).


Pssm-ID: 341426  Cd Length: 117  Bit Score: 36.35  E-value: 4.42e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 257096014   5 LFASIVRvRDGLPLSAST--DFYYA-QEFLECRRQLktLAQRLARHPGRGCAESCDFLIYFSSSGDVACMAICSRQCPAA 81
Cdd:cd14818    1 LQLAVFD-PQGQVLAASNwlGKKPSvKFSLIQIKSF--FSKLITSGFDFLTLTIGSYTFHYYLNKGLYFVVITDEQELRQ 77
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 257096014  82 MAFCFLEALWWDFIASYdTTCVGLASRPYAFLEFDSVIQKT 122
Cdd:cd14818   78 ELFQTLNLLLKEFNSLH-GSEVITKNIEDDLEEFESYLDIK 117
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH