NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|256000794|ref|NP_001157727.1|]
View 

tropomyosin alpha-1 chain isoform Tpm1.10br [Mus musculus]

Protein Classification

Tropomyosin domain-containing protein (domain architecture ID 11991670)

Tropomyosin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-280 1.85e-68

Tropomyosin;


:

Pssm-ID: 306717  Cd Length: 235  Bit Score: 215.63  E-value: 1.85e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   48 KKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 256000794  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAE 233
 
Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-280 1.85e-68

Tropomyosin;


Pssm-ID: 306717  Cd Length: 235  Bit Score: 215.63  E-value: 1.85e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   48 KKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 256000794  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAE 233
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
37-280 1.25e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 70.47  E-value: 1.25e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    37 KQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Cdd:TIGR02168  687 EELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEEL 766
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   117 EKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEE 196
Cdd:TIGR02168  767 EERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQ 846
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   197 LKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQ---LYHQLEQNRRLTNE 273
Cdd:TIGR02168  847 IEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKrseLRRELEELREKLAQ 926

                   ....*..
gi 256000794   274 LKLALNE 280
Cdd:TIGR02168  927 LELRLEG 933
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
21-280 3.45e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 69.36  E-value: 3.45e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   21 RAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD 100
Cdd:COG1196   668 ELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELE 747
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  101 RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE 180
Cdd:COG1196   748 ELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLE 827
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  181 ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQL 260
Cdd:COG1196   828 QEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEI 907
                         250       260
                  ....*....|....*....|
gi 256000794  261 YHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   908 EKLRERLEELEAKLERLEVE 927
PRK05771 PRK05771
V-type ATP synthase subunit I; Validated
23-262 1.40e-08

V-type ATP synthase subunit I; Validated


Pssm-ID: 235600  Cd Length: 646  Bit Score: 55.32  E-value: 1.40e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  23 EQAEADKKAAEDRSK--QLEDELVSLQKKLKGTEDELDKYS-----EALKDAQEKLELAEKKATDAEADVASLNRRIQLV 95
Cdd:PRK05771  40 LSNERLRKLRSLLTKlsEALDKLRSYLPKLNPLREEKKKVSvksleELIKDVEEELEKIEKEIKELEEEISELENEIKEL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  96 EEELDRAQerlatALQKLEEAEKAADESERgMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVA---RKLVII 172
Cdd:PRK05771 120 EQEIERLE-----PWGNFDLDLSLLLGFKY-VSVFVGTVPEDKLEELKLESDVENVEYISTDKGYVYVVVVvlkELSDEV 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 173 ESDLERAE-ERAELSEGKC-----AELEEELKTVTNNLKSLEAQAEKYSQkedKYEEEIKVLSDKL----KEAETRAEFA 242
Cdd:PRK05771 194 EEELKKLGfERLELEEEGTpseliREIKEELEEIEKERESLLEELKELAK---KYLEELLALYEYLeielERAEALSKFL 270
                        250       260       270
                 ....*....|....*....|....*....|...
gi 256000794 243 -------------ERSVTKLEKSIDDLEDQLYH 262
Cdd:PRK05771 271 ktdktfaiegwvpEDRVKKLKELIDKATGGSAY 303
 
Name Accession Description Interval E-value
Tropomyosin pfam00261
Tropomyosin;
48-280 1.85e-68

Tropomyosin;


Pssm-ID: 306717  Cd Length: 235  Bit Score: 215.63  E-value: 1.85e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   48 KKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGM 127
Cdd:pfam00261   1 KKMQQIEEELDEAEERLEAAQKKLEEAEKRAEKAEAEVAALNRRIQLLEEELERTEERLATALEKLEEAEKAADESERGR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  128 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 207
Cdd:pfam00261  81 KVLENRALKDEERMEQLEAQLKEAKEIAEEADRKYEEVARKLVVVEGDLERAEERAELAESKIVELEEELKVVGNNLKSL 160
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 256000794  208 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:pfam00261 161 EASEEKASQREDEYEEEIRFLTEKLKEAETRAEFAERSVQKLEKEVDRLEDELYAEKEKYKAISEELDQTLAE 233
Tropomyosin_1 pfam12718
Tropomyosin like; This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and ...
7-152 1.69e-26

Tropomyosin like; This family is a set of eukaryotic tropomyosins. Within the yeast Tmp1 and Tmp2, biochemical and sequence analyses indicate that Tpm2p spans four actin monomers along a filament, whereas Tpmlp spans five. Despite its shorter length, Tpm2p can compete with Tpm1p for binding to F-actin. Over-expression of Tpm2p in vivo alters the axial budding of haploids to a bipolar pattern, and this can be partially suppressed by co-over-expression of Tpm1p. This suggests distinct functions for the two tropomyosins, and indicates that the ratio between them is important for correct morphogenesis. The family also contains higher eukaryote Tmp3 members.


Pssm-ID: 315401  Cd Length: 142  Bit Score: 102.76  E-value: 1.69e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEAdva 86
Cdd:pfam12718   1 KMNSLKLEAENAQERAEEAEEKVKQLEQENLEKEQEIKSLTHKNQQLEEEVEKLEEQLKEAKEKAEESEKLKTNNEA--- 77
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 256000794   87 sLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
Cdd:pfam12718  78 -LNRRIQLLEEELEESDKRLKETTEKLRETDVKAEHSERKVQALEQERDQWEEKYEELEEKYKEAK 142
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
37-280 1.25e-13

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 70.47  E-value: 1.25e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    37 KQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Cdd:TIGR02168  687 EELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEEL 766
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   117 EKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEE 196
Cdd:TIGR02168  767 EERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQ 846
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   197 LKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQ---LYHQLEQNRRLTNE 273
Cdd:TIGR02168  847 IEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKrseLRRELEELREKLAQ 926

                   ....*..
gi 256000794   274 LKLALNE 280
Cdd:TIGR02168  927 LELRLEG 933
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
21-280 3.45e-13

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 69.36  E-value: 3.45e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   21 RAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD 100
Cdd:COG1196   668 ELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELE 747
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  101 RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE 180
Cdd:COG1196   748 ELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLE 827
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  181 ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQL 260
Cdd:COG1196   828 QEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEI 907
                         250       260
                  ....*....|....*....|
gi 256000794  261 YHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   908 EKLRERLEELEAKLERLEVE 927
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
11-260 1.96e-11

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 63.92  E-value: 1.96e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    11 LKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNR 90
Cdd:TIGR02168  230 LVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRE 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    91 RIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLV 170
Cdd:TIGR02168  310 RLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVA 389
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   171 IIE-------SDLERAEERAELSEGKCAELEEELKTVTNNLKslEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAE 243
Cdd:TIGR02168  390 QLElqiaslnNEIERLEARLERLEDRRERLQQEIEELLKKLE--EAELKELQAELEELEEELEELQEELERLEEALEELR 467
                          250
                   ....*....|....*..
gi 256000794   244 RSVTKLEKSIDDLEDQL 260
Cdd:TIGR02168  468 EELEEAEQALDAAEREL 484
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
3-268 2.43e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 60.88  E-value: 2.43e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    3 AIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAE 82
Cdd:COG1196   692 SLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLE 771
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   83 ADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEiqeiqlkEAKHIAEDADRKY 162
Cdd:COG1196   772 EALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIE-------ELEEEIEELEEKL 844
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  163 EEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFA 242
Cdd:COG1196   845 DELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERL 924
                         250       260
                  ....*....|....*....|....*.
gi 256000794  243 ERSVTKLEKSIDDLEDQLYHQLEQNR 268
Cdd:COG1196   925 EVELPELEEELEEEYEDTLETELERE 950
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-280 2.49e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 60.88  E-value: 2.49e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:COG1196   213 ERYQELKAELRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLE 292
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAadesergmkvIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   293 LKEEIEELEGEISLLRERLEELENELEELEERLEELKEK----------IEALKEELEERETLLEELEQLLAELEEAKEE 362
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   363 LEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELE 442
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|
gi 256000794  241 FAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   443 ELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKE 482
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
4-280 3.33e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 60.46  E-value: 3.33e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     4 IKKKMQMLKLDKENALD----RAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKAT 79
Cdd:TIGR02168  198 LERQLKSLERQAEKAERykelKAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVS 277
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    80 DAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDAD 159
Cdd:TIGR02168  278 ELEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLE 357
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   160 RKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAE--- 236
Cdd:TIGR02168  358 AELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAElke 437
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....*.
gi 256000794   237 --TRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:TIGR02168  438 lqAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERE 483
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
4-273 4.76e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 59.73  E-value: 4.76e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    4 IKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEA 83
Cdd:COG1196   735 LQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALER 814
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   84 DVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Cdd:COG1196   815 ELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELR 894
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  164 EVARKLVIIESDLERAEERAELSEGKCAELEEELK----------------TVTNNLKSLEAQAEKYSQKEDKYEEEIKV 227
Cdd:COG1196   895 ELESELAELKEEIEKLRERLEELEAKLERLEVELPeleeeleeeyedtletELEREIERLEEEIEALGPVNLRAIEEYEE 974
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 256000794  228 LSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNE 273
Cdd:COG1196   975 VEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINE 1020
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
5-266 5.05e-10

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 59.69  E-value: 5.05e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     5 KKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEAD 84
Cdd:TIGR02168  676 RREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKE 755
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    85 VASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES-----RAQKDEEKMEIQEIQLKEAKHIAEDAD 159
Cdd:TIGR02168  756 LTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREaldelRAELTLLNEEAANLRERLESLERRIAA 835
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   160 --RKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAET 237
Cdd:TIGR02168  836 teRRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSELRR 915
                          250       260
                   ....*....|....*....|....*....
gi 256000794   238 RAEFAERSVTKLEKSIDDLEDQLYHQLEQ 266
Cdd:TIGR02168  916 ELEELREKLAQLELRLEGLEVRIDNLQER 944
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
34-275 8.78e-10

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 58.93  E-value: 8.78e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    34 DRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKL 113
Cdd:TIGR02169  681 ERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSEL 760
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   114 EEAEKAADESERGMKVIE------------SRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEE 181
Cdd:TIGR02169  761 KELEARIEELEEDLHKLEealndlearlshSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQE 840
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   182 RAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLY 261
Cdd:TIGR02169  841 QRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLS 920
                          250
                   ....*....|....
gi 256000794   262 HQLEQNRRLTNELK 275
Cdd:TIGR02169  921 ELKAKLEALEEELS 934
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
43-268 1.39e-08

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809  Cd Length: 499  Bit Score: 55.03  E-value: 1.39e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  43 LVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQ-------LVEEELDRAQERLATALQKLEE 115
Cdd:COG4372   62 LFLLNRNLRSGVFQLDDIRPQLRALRTELGTAQGEKRAAETEREAARSELQkarqereAVRQELAAARQNLAKAQQELAR 141
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 116 -AEKAADESERGMKVIESRAQKDEEKMEI--QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAE 192
Cdd:COG4372  142 lTKQAQDLQTRLKTLAEQRRQLEAQAQSLqaSQKQLQASATQLKSQVLDLKLRSAQIEQEAQNLATRANAAQARTEELAR 221
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 256000794 193 LEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNR 268
Cdd:COG4372  222 RAAAAQQTAQAIQQRDAQISQKAQQIAARAEQIRERERQLQRLETAQARLEQEVAQLEAYYQAYVRLRQQAAATQR 297
PRK05771 PRK05771
V-type ATP synthase subunit I; Validated
23-262 1.40e-08

V-type ATP synthase subunit I; Validated


Pssm-ID: 235600  Cd Length: 646  Bit Score: 55.32  E-value: 1.40e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  23 EQAEADKKAAEDRSK--QLEDELVSLQKKLKGTEDELDKYS-----EALKDAQEKLELAEKKATDAEADVASLNRRIQLV 95
Cdd:PRK05771  40 LSNERLRKLRSLLTKlsEALDKLRSYLPKLNPLREEKKKVSvksleELIKDVEEELEKIEKEIKELEEEISELENEIKEL 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  96 EEELDRAQerlatALQKLEEAEKAADESERgMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVA---RKLVII 172
Cdd:PRK05771 120 EQEIERLE-----PWGNFDLDLSLLLGFKY-VSVFVGTVPEDKLEELKLESDVENVEYISTDKGYVYVVVVvlkELSDEV 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 173 ESDLERAE-ERAELSEGKC-----AELEEELKTVTNNLKSLEAQAEKYSQkedKYEEEIKVLSDKL----KEAETRAEFA 242
Cdd:PRK05771 194 EEELKKLGfERLELEEEGTpseliREIKEELEEIEKERESLLEELKELAK---KYLEELLALYEYLeielERAEALSKFL 270
                        250       260       270
                 ....*....|....*....|....*....|...
gi 256000794 243 -------------ERSVTKLEKSIDDLEDQLYH 262
Cdd:PRK05771 271 ktdktfaiegwvpEDRVKKLKELIDKATGGSAY 303
PRK02224 PRK02224
chromosome segregation protein; Provisional
2-258 1.53e-08

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 55.43  E-value: 1.53e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:PRK02224 324 EELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDA 403
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER----------GMKVIES----RAQKDEEKMEIQEIQ 147
Cdd:PRK02224 404 PVDLGNAEDFLEELREERDELREREAELEATLRTARERVEEAEAlleagkcpecGQPVEGSphveTIEEDRERVEELEAE 483
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 148 LKEAKHIAEDADRKYEEvARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKV 227
Cdd:PRK02224 484 LEDLEEEVEEVEERLER-AEDLVEAEDRIERLEERREDLEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAE 562
                        250       260       270
                 ....*....|....*....|....*....|.
gi 256000794 228 LSDKLKEAETRAEFAERSVTKLEKSIDDLED 258
Cdd:PRK02224 563 AEEEAEEAREEVAELNSKLAELKERIESLER 593
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
6-256 2.12e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 55.06  E-value: 2.12e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     6 KKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADV 85
Cdd:TIGR02168  747 ERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERL 826
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    86 ASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRkyeev 165
Cdd:TIGR02168  827 ESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSE----- 901
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   166 arklviiesDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ-AEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAER 244
Cdd:TIGR02168  902 ---------ELRELESKRSELRRELEELREKLAQLELRLEGLEVRiDNLQERLSEEYSLTLEEAEALENKIEDDEEEARR 972
                          250
                   ....*....|..
gi 256000794   245 SVTKLEKSIDDL 256
Cdd:TIGR02168  973 RLKRLENKIKEL 984
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1-240 5.69e-08

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 53.52  E-value: 5.69e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR02168  262 LQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAE 341
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:TIGR02168  342 LEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEARLERLEDRRERLQQ 421
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   161 KYEEVARKLViiESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:TIGR02168  422 EIEELLKKLE--EAELKELQAELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQE 499
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
20-246 1.09e-07

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 52.76  E-value: 1.09e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    20 DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQ------ 93
Cdd:TIGR02169  273 LLEELNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEeerkrr 352
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    94 -LVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVII 172
Cdd:TIGR02169  353 dKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGI 432
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 256000794   173 ESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSV 246
Cdd:TIGR02169  433 EAKINELEEEKEDKALEIKKQEWKLEQLAADLSKYEQELYDLKEEYDRVEKELSKLQRELAEAEAQARASEERV 506
PRK10929 PRK10929
putative mechanosensitive channel protein; Provisional
23-274 1.22e-07

putative mechanosensitive channel protein; Provisional


Pssm-ID: 236798  Cd Length: 1109  Bit Score: 52.75  E-value: 1.22e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   23 EQAEADKKAAE-DRSKQLEDELVSLQKKlKGTEDELDKYSEALKD---------AQEKLELAEKKATDAEADVASLNRRI 92
Cdd:PRK10929   33 EQAKAAKTPAQaEIVEALQSALNWLEER-KGSLERAKQYQQVIDNfpklsaelrQQLNNERDEPRSVPPNMSTDALEQEI 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   93 -----QLVEE------ELDRAQE---RLATALQKLEEAEKAADESERGMKVIESRAQKDEEkmeiqeiqlkeakhiAEDA 158
Cdd:PRK10929  112 lqvssQLLEKsrqaqqEQDRAREisdSLSQLPQQQTEARRQLNEIERRLQTLGTPNTPLAQ---------------AQLT 176
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  159 DRKYEEVARKLVIIESDLER--AEERAELSEgkcaeLEEELktvtnnlksleaqAEKYSQKEDKYEEEIKVLSDKLKEAE 236
Cdd:PRK10929  177 ALQAESAALKALVDELELAQlsANNRQELAR-----LRSEL-------------AKKRSQQLDAYLQALRNQLNSQRQRE 238
                         250       260       270
                  ....*....|....*....|....*....|....*...
gi 256000794  237 trAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNEL 274
Cdd:PRK10929  239 --AERALESTELLAEQSGDLPKSIVAQFKINRELSQAL 274
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-240 1.41e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 52.41  E-value: 1.41e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:COG1196   262 LEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEE 341
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 AEADVASLNRRIQLVEEELDRAQERLATAlqkLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   342 RETLLEELEQLLAELEEAKEELEEKLSAL---LEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSE 418
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   419 RLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQR 498
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
20-280 3.43e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 51.25  E-value: 3.43e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   20 DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELaekKATDAEADVASLNRRIQLVEEEL 99
Cdd:COG1196   172 ERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELREL---ELALLLAKLKELRKELEELEEEL 248
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  100 DRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERA 179
Cdd:COG1196   249 SRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEERLEEL 328
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  180 EERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF----AERSVTKLEKSIDD 255
Cdd:COG1196   329 KEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAelaeIRNELEELKREIES 408
                         250       260
                  ....*....|....*....|....*
gi 256000794  256 LEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   409 LEERLERLSERLEDLKEELKELEAE 433
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-235 5.08e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 50.48  E-value: 5.08e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:COG1196   788 RQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEE 867
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEakhiaedadr 160
Cdd:COG1196   868 LEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEE---------- 937
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256000794  161 kyEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEA 235
Cdd:COG1196   938 --EYEDTLETELEREIERLEEEIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRER 1010
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
1-260 5.46e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 50.48  E-value: 5.46e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:COG1196   241 LEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEE 320
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEsraQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:COG1196   321 LEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALL---EELEELFEALREELAELEAELAEIRN 397
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG1196   398 ELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQ 477
                         250       260
                  ....*....|....*....|
gi 256000794  241 FAERSVTKLEKSIDDLEDQL 260
Cdd:COG1196   478 RLEKELSSLEARLDRLEAEQ 497
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
47-260 7.50e-07

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 50.06  E-value: 7.50e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    47 QKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAE-----------ADVASLNRRIQLVEEELDRAQERLATALQKLEE 115
Cdd:TIGR02168  178 ERKLERTRENLDRLEDILNELERQLKSLERQAEKAErykelkaelreLELALLVLRLEELREELEELQEELKEAEEELEE 257
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   116 AEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEE 195
Cdd:TIGR02168  258 LTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAE 337
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 256000794   196 ELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQL 260
Cdd:TIGR02168  338 ELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEI 402
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
26-280 8.01e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 50.10  E-value: 8.01e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   26 EADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKAtdaEADVASLNRRIQLVEEELDRAQER 105
Cdd:COG1196   171 KERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELR---ELELALLLAKLKELRKELEELEEE 247
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  106 LATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDadrkyeevarklviIESDLERAEERAEL 185
Cdd:COG1196   248 LSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEE--------------LEGEISLLRERLEE 313
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  186 SEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLE 265
Cdd:COG1196   314 LENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELA 393
                         250
                  ....*....|....*
gi 256000794  266 QNRRLTNELKLALNE 280
Cdd:COG1196   394 EIRNELEELKREIES 408
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
2-260 1.28e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 49.28  E-value: 1.28e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:TIGR02168  708 EELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEEL 787
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRK 161
Cdd:TIGR02168  788 EAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEEL 867
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   162 YEEvarklviIESDLEraeeraelsegkcaELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF 241
Cdd:TIGR02168  868 IEE-------LESELE--------------ALLNERASLEEALALLRSELEELSEELRELESKRSELRRELEELREKLAQ 926
                          250
                   ....*....|....*....
gi 256000794   242 AERSVTKLEKSIDDLEDQL 260
Cdd:TIGR02168  927 LELRLEGLEVRIDNLQERL 945
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1-206 1.37e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 49.28  E-value: 1.37e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR02168  311 LANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQ 390
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGmkviESRAQKDEEKMEIQEIQLKEAKHIA--EDA 158
Cdd:TIGR02168  391 LELQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELK----ELQAELEELEEELEELQEELERLEEalEEL 466
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*...
gi 256000794   159 DRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKS 206
Cdd:TIGR02168  467 REELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKALLKN 514
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
28-246 2.38e-06

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278  Cd Length: 420  Bit Score: 48.18  E-value: 2.38e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  28 DKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLA 107
Cdd:COG4942   32 SAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQER 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 108 TALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSE 187
Cdd:COG4942  112 EQRRRLAEQLAALQRSGRNPPPALLVSPEDAQRSVRLAIYYGALNPARAERIDALKATLKQLAAVRAEIAAEQAELTTLL 191
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 256000794 188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSV 246
Cdd:COG4942  192 SEQRAQQAKLAQLLEERKKTLAQLNSELSADQKKLEELRANESRLKNEIASAEAAAAKA 250
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
1-270 2.56e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 48.53  E-value: 2.56e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR02169  704 LDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEEALND 783
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    81 AEADVAslNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:TIGR02169  784 LEARLS--HSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNG 861
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAEtRAE 240
Cdd:TIGR02169  862 KKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKLEALEEELSEIE-DPK 940
                          250       260       270
                   ....*....|....*....|....*....|
gi 256000794   241 FAERSVTKLEKSIDDLEDQLYHQLEQNRRL 270
Cdd:TIGR02169  941 GEDEEIPEEELSLEDVQAELQRVEEEIRAL 970
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2-260 2.82e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 48.53  E-value: 2.82e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     2 DAIKKKMQMLKLDKENALdraEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:TIGR02169  194 DEKRQQLERLRREREKAE---RYQALLKEKREYEGYELLKEKEALERQKEAIERQLASLEEELEKLTEEISELEKRLEEI 270
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    82 EADVASLNRRIQ-LVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLkeakhiaEDADR 160
Cdd:TIGR02169  271 EQLLEELNKKIKdLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEI-------EELER 343
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   161 KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:TIGR02169  344 EIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKRELDRLQEELQRLSEELA 423
                          250       260
                   ....*....|....*....|
gi 256000794   241 FAERSVTKLEKSIDDLEDQL 260
Cdd:TIGR02169  424 DLNAAIAGIEAKINELEEEK 443
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
4-257 5.59e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 47.37  E-value: 5.59e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     4 IKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEA 83
Cdd:TIGR02169  700 IENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEE 779
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    84 DVASLNRRIqlveeeldrAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Cdd:TIGR02169  780 ALNDLEARL---------SHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIK 850
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   164 EVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAE 243
Cdd:TIGR02169  851 SIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKLEALE 930
                          250
                   ....*....|....
gi 256000794   244 RSVTKLEKSIDDLE 257
Cdd:TIGR02169  931 EELSEIEDPKGEDE 944
PTZ00121 PTZ00121
MAEBL; Provisional
5-281 5.65e-06

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 47.44  E-value: 5.65e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    5 KKKMQMLKLDKENALDRAEQ---AEADKKAAEDRSKQLEDELVSLQKKLKGTE----DELDKYSEALKDAQEKLELAEKK 77
Cdd:PTZ00121 1390 KKKADEAKKKAEEDKKKADElkkAAAAKKKADEAKKKAEEKKKADEAKKKAEEakkaDEAKKKAEEAKKAEEAKKKAEEA 1469
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   78 ATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES-RAQKDEEKMEIQEIQLKEAKHIAE 156
Cdd:PTZ00121 1470 KKADEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKKAdEAKKAEEAKKADEAKKAEEKKKAD 1549
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  157 DADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAE 236
Cdd:PTZ00121 1550 ELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAE 1629
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 256000794  237 TRAEFAERSVTKLEKSIDDLEdQLYHQLEQNRRLTNELKLALNED 281
Cdd:PTZ00121 1630 EEKKKVEQLKKKEAEEKKKAE-ELKKAEEENKIKAAEEAKKAEED 1673
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
79-280 7.46e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 47.02  E-value: 7.46e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   79 TDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDA 158
Cdd:COG1196   663 LAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEEL 742
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  159 DRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETR 238
Cdd:COG1196   743 EEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQR 822
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 256000794  239 AEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   823 RERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEE 864
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
59-280 1.03e-05

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 46.59  E-value: 1.03e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    59 KYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQE------------------RLATALQKLEEAEKAA 120
Cdd:TIGR02168  169 KYKERRKETERKLERTRENLDRLEDILNELERQLKSLERQAEKAERykelkaelrelelallvlRLEELREELEELQEEL 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   121 DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV 200
Cdd:TIGR02168  249 KEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEEL 328
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   201 TNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:TIGR02168  329 ESKLDELAEELAELEEKLEELKEELESLEAELEELEAELEELESRLEELEEQLETLRSKVAQLELQIASLNNEIERLEAR 408
pepcterm_ChnLen TIGR03007
polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; Members of this ...
21-223 1.09e-05

polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]


Pssm-ID: 274386  Cd Length: 498  Bit Score: 46.20  E-value: 1.09e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   21 RAEQAEADK------KAAEDRSKQLEDELVS-LQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQ 93
Cdd:TIGR03007 156 RQDSDSAQRfideqiKTYEKKLEAAENRLKAfKQENGGILPDQEGDYYSEISEAQEELEAARLELNEAIAQRDALKRQLG 235
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   94 LVEEELDRAQERLATALQ-KLEEAEKAADE-----SERGMKVIESRAQKDE-EKMEIQEIQLKEA-KHIAEDADRKYEEV 165
Cdd:TIGR03007 236 GEEPVLLAGSSVANSELDgRIEALEKQLDAlrlryTDKHPDVIATKREIAQlEEQKEEEGSAKNGgPERGEIANPVYQQL 315
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 256000794  166 ARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:TIGR03007 316 QIELAEAEAEIASLEARVAELTARIERLESLLRTIPEVEAELTQLNRDYEVNKSNYEQ 373
GumC COG3206
Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane ...
18-223 1.51e-05

Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 225747  Cd Length: 458  Bit Score: 45.90  E-value: 1.51e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  18 ALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYsealkDAQEKLELAEKKATDAEADVASLNRRIQLVEE 97
Cdd:COG3206  179 QAYLADQLEAQLEAFRRASDSLDERLEELRARLQEAEAQVEDF-----RAQHGLTDAARGQLLSEQQLSALNTQLQSARA 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  98 ELDRAQERLATALQKLEEAEKAADESER-GMKVIES-RAQKDEEKMEIQEIQLK-EAKHIAEDADRKYEEVARKLVIIES 174
Cdd:COG3206  254 RLAQAEARLASLLQLLPLGREAAALREVlESPTIQDlRQQYAQVRQQIADLSTElGAKHPQLVALEAQLAELRQQIAAEL 333
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 256000794 175 DLERAEERAELsegkcAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:COG3206  334 RQILASLPNEL-----ALLEQQEAALEKELAQLKGRLSKLPKLQVQLRE 377
NtpI COG1269
Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];
13-246 1.99e-05

Archaeal/vacuolar-type H+-ATPase subunit I/STV1 [Energy production and conversion];


Pssm-ID: 224188  Cd Length: 660  Bit Score: 45.43  E-value: 1.99e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  13 LDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRI 92
Cdd:COG1269   43 LKELEKLKVAEVAQISLSSLLSEVLDYLRSVKGLEGRLFILPEEVEKLEAELKSLEEVIKPAEKFSSEVEELTRKLEERL 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  93 QLVEEELD--RAQERLATALQKLEEAEKAADESERG-MKVIESRAQKDEEKmeIQEIQLKEAKHIAEDADRKY------E 163
Cdd:COG1269  123 SELDEELEdlEDLLEELEPLAYLDFDLSLLRGLKFLlVRLGLVRREKLEAL--VGVIEDEVALYGENVEASVVivvahgA 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 164 EVARKLVIIESdlERAEERAELSEGK------CAELEEELKTVTNNLKSLEAQAEKYSqkeDKYEEEIKVLSDKLKEAET 237
Cdd:COG1269  201 EDLDKVSKILN--ELGFELYEVPEFDggpselISELEEVIAEIQDELESLRSELEALA---EKIAEELLAVREILEIEKA 275

                 ....*....
gi 256000794 238 RAEFAERSV 246
Cdd:COG1269  276 LGDVLSKLA 284
PRK02224 PRK02224
chromosome segregation protein; Provisional
52-260 2.07e-05

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 45.42  E-value: 2.07e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  52 GTEDELDKYSEALKDAQEklELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIE 131
Cdd:PRK02224 177 GVERVLSDQRGSLDQLKA--QIEEKEEKDLHERLNGLESELAELDEEIERYEEQREQARETRDEADEVLEEHEERREELE 254
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 132 SRAQ----------KDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVT 201
Cdd:PRK02224 255 TLEAeiedlretiaETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEAVEARREELEDRDEELRDRLEECR 334
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 256000794 202 NNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQL 260
Cdd:PRK02224 335 VAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRREEIEELEEEI 393
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
89-275 2.81e-05

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 45.09  E-value: 2.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   89 NRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARK 168
Cdd:COG1196   659 KRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSR 738
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  169 LVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTK 248
Cdd:COG1196   739 LEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELES 818
                         170       180
                  ....*....|....*....|....*..
gi 256000794  249 LEKSIDDLEDQLYHQLEQNRRLTNELK 275
Cdd:COG1196   819 LEQRRERLEQEIEELEEEIEELEEKLD 845
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
4-214 2.99e-05

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 45.09  E-value: 2.99e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    4 IKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEA 83
Cdd:COG1196   293 LKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLE 372
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   84 DVASlnrRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Cdd:COG1196   373 ELEE---LFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELE 449
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 256000794  164 EVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKY 214
Cdd:COG1196   450 ELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQRAS 500
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
19-260 6.89e-05

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 43.90  E-value: 6.89e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    19 LDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLE--------LAEKKATDAEADVASLNR 90
Cdd:TIGR02169  229 LKEKEALERQKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKdlgeeeqlRVKEKIGELEAEIASLER 308
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    91 RIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLV 170
Cdd:TIGR02169  309 SIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDELK 388
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   171 IIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLE 250
Cdd:TIGR02169  389 DYREKLEKLKREINELKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKYE 468
                          250
                   ....*....|
gi 256000794   251 KSIDDLEDQL 260
Cdd:TIGR02169  469 QELYDLKEEY 478
PTZ00121 PTZ00121
MAEBL; Provisional
14-226 7.62e-05

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.98  E-value: 7.62e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   14 DKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQ 93
Cdd:PTZ00121 1575 DKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKK 1654
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   94 LVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIE 173
Cdd:PTZ00121 1655 AEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKIKAEE 1734
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 256000794  174 SDLERAEERAELSEGKCAElEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIK 226
Cdd:PTZ00121 1735 AKKEAEEDKKKAEEAKKDE-EEKKKIAHLKKEEEKKAEEIRKEKEAVIEEELD 1786
RNase_Y TIGR03319
ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from ...
15-165 8.36e-05

ribonuclease Y; Members of this family are RNase Y, an endoribonuclease. The member from Bacillus subtilis, YmdA, has been shown to be involved in turnover of yitJ riboswitch. [Transcription, Degradation of RNA]


Pssm-ID: 188306  Cd Length: 514  Bit Score: 43.38  E-value: 8.36e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   15 KENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQL 94
Cdd:TIGR03319  50 KEALLEAKEEVHKLRAELERELKERRNELQRLERRLLQREETLDRKMESLDKKEENLEKKEKELSNKEKNLDEKEEELEE 129
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 256000794   95 VEEELDRAQERLATALQklEEAEkaadesERGMKVIESRAQKDEEKMeIQEIQlKEAKhiaEDADRKYEEV 165
Cdd:TIGR03319 130 LIAEQREELERISGLTQ--EEAK------EILLEEVEEEARHEAAKL-IKEIE-EEAK---EEADKKAKEI 187
PTZ00121 PTZ00121
MAEBL; Provisional
5-246 1.13e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.59  E-value: 1.13e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    5 KKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEAD 84
Cdd:PTZ00121 1342 KKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAEEKKKADEAKKKAEEDKKKADELKKAAAAKKKAD 1421
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   85 VASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEE 164
Cdd:PTZ00121 1422 EAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADE 1501
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  165 VARKlviiESDLERAEERAELSEGKCAeleEELKTVTNNLKSLEAQA--EKYSQKEDKYEEEIKVLSDKLKEAETRAEFA 242
Cdd:PTZ00121 1502 AKKA----AEAKKKADEAKKAEEAKKA---DEAKKAEEAKKADEAKKaeEKKKADELKKAEELKKAEEKKKAEEAKKAEE 1574

                  ....
gi 256000794  243 ERSV 246
Cdd:PTZ00121 1575 DKNM 1578
PTZ00121 PTZ00121
MAEBL; Provisional
2-268 1.27e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.21  E-value: 1.27e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:PTZ00121 1507 EAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEA 1586
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   82 -EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEakhiaEDADR 160
Cdd:PTZ00121 1587 kKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKKAE-----EENKI 1661
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  161 KYEEVARKLviiESDLERAEEraelsegkCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:PTZ00121 1662 KAAEEAKKA---EEDKKKAEE--------AKKAEEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKKAEEENKI 1730
                         250       260
                  ....*....|....*....|....*...
gi 256000794  241 FAERSVTKLEKSIDDLEDQLYHQLEQNR 268
Cdd:PTZ00121 1731 KAEEAKKEAEEDKKKAEEAKKDEEEKKK 1758
PTZ00121 PTZ00121
MAEBL; Provisional
6-252 1.46e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 43.21  E-value: 1.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    6 KKMQMLKLDKENA--LDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKySEALKDAQEKLELAEKKATDAEA 83
Cdd:PTZ00121 1230 KKAEEAKKDAEEAkkAEEERNNEEIRKFEEARMAHFARRQAAIKAEEARKADELKK-AEEKKKADEAKKAEEKKKADEAK 1308
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   84 DVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Cdd:PTZ00121 1309 KKAEEAKKADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAAKKKAE 1388
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  164 EVARKlviiesdlERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAE 243
Cdd:PTZ00121 1389 EKKKA--------DEAKKKAEEDKKKADELKKAAAAKKKADEAKKKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAE 1460

                  ....*....
gi 256000794  244 RSVTKLEKS 252
Cdd:PTZ00121 1461 EAKKKAEEA 1469
PTZ00121 PTZ00121
MAEBL; Provisional
1-252 1.85e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 42.82  E-value: 1.85e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL--KGTEDELDKYSEalkDAQEKLELAEKKA 78
Cdd:PTZ00121 1262 MAHFARRQAAIKAEEARKADELKKAEEKKKADEAKKAEEKKKADEAKKKAeeAKKADEAKKKAE---EAKKKADAAKKKA 1338
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   79 TDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADE----SERGMKVIESRAQKDEEKMEIQEIQLK-EAKH 153
Cdd:PTZ00121 1339 EEAKKAAEAAKAEAEAAADEAEAAEEKAEAAEKKKEEAKKKADAakkkAEEKKKADEAKKKAEEDKKKADELKKAaAAKK 1418
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  154 IAEDADRKYEEVARKlviiESDLERAEERAELSEGKcAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLK 233
Cdd:PTZ00121 1419 KADEAKKKAEEKKKA----DEAKKKAEEAKKADEAK-KKAEEAKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAE 1493
                         250
                  ....*....|....*....
gi 256000794  234 EAETRAEFAERSVTKLEKS 252
Cdd:PTZ00121 1494 EAKKKADEAKKAAEAKKKA 1512
PTZ00121 PTZ00121
MAEBL; Provisional
2-281 2.01e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 42.82  E-value: 2.01e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAE-KKATD 80
Cdd:PTZ00121 1119 EAKKKAEDARKAEEARKAEDARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARKAEEVRKAEElRKAED 1198
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 A-EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDAD 159
Cdd:PTZ00121 1199 ArKAEAARKAEEERKAEEARKAEDAKKAEAVKKAEEAKKDAEEAKKAEEERNNEEIRKFEEARMAHFARRQAAIKAEEAR 1278
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  160 RKYEEVARKLVIIESDLERAEERAELSEGK--------CAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDK 231
Cdd:PTZ00121 1279 KADELKKAEEKKKADEAKKAEEKKKADEAKkkaeeakkADEAKKKAEEAKKKADAAKKKAEEAKKAAEAAKAEAEAAADE 1358
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|
gi 256000794  232 LKEAETRAEFAERSVTKLEKSIDDLEDQlyhqlEQNRRLTNELKLALNED 281
Cdd:PTZ00121 1359 AEAAEEKAEAAEKKKEEAKKKADAAKKK-----AEEKKKADEAKKKAEED 1403
PTZ00121 PTZ00121
MAEBL; Provisional
15-269 2.02e-04

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 42.44  E-value: 2.02e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   15 KENALDRAEQAEADKKAAEDRSKqleDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRiql 94
Cdd:PTZ00121 1450 KKKAEEAKKAEEAKKKAEEAKKA---DEAKKKAEEAKKADEAKKKAEEAKKKADEAKKAAEAKKKADEAKKAEEAKK--- 1523
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   95 vEEELDRAQE-RLATALQKLEEAEKAAD--ESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVI 171
Cdd:PTZ00121 1524 -ADEAKKAEEaKKADEAKKAEEKKKADElkKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYE 1602
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  172 IESDLERAEERAELSEGKCAE---LEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTK 248
Cdd:PTZ00121 1603 EEKKMKAEEAKKAEEAKIKAEelkKAEEEKKKVEQLKKKEAEEKKKAEELKKAEEENKIKAAEEAKKAEEDKKKAEEAKK 1682
                         250       260
                  ....*....|....*....|.
gi 256000794  249 LEKSIDDLEDQLYHQLEQNRR 269
Cdd:PTZ00121 1683 AEEDEKKAAEALKKEAEEAKK 1703
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
98-274 2.09e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 42.35  E-value: 2.09e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    98 ELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLE 177
Cdd:TIGR02168  678 EIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELT 757
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   178 RAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKE-------AETRAEFAERSVTKLE 250
Cdd:TIGR02168  758 ELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLlneeaanLRERLESLERRIAATE 837
                          170       180
                   ....*....|....*....|....
gi 256000794   251 KSIDDLEDQLYHQLEQNRRLTNEL 274
Cdd:TIGR02168  838 RRLEDLEEQIEELSEDIESLAAEI 861
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
2-201 2.25e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 42.39  E-value: 2.25e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDA----QEKLELAEKK 77
Cdd:COG1196   312 EELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEELfealREELAELEAE 391
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   78 ATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAED 157
Cdd:COG1196   392 LAEIRNELEELKREIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAE 471
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 256000794  158 ADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVT 201
Cdd:COG1196   472 LQEELQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESGLP 515
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
23-275 3.03e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 41.98  E-value: 3.03e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    23 EQAEADKKAAEDRSKQLE---DELVSLQKKLKGTEDELDKYSEALKDAQE-KLELAEKKATDAEADVASLNRRIQLVEEE 98
Cdd:TIGR02169  173 EKALEELEEVEENIERLDliiDEKRQQLERLRREREKAERYQALLKEKREyEGYELLKEKEALERQKEAIERQLASLEEE 252
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    99 LDRAQERLATALQKLEEAEKAADE-SERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLE 177
Cdd:TIGR02169  253 LEKLTEEISELEKRLEEIEQLLEElNKKIKDLGEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAKLEAEID 332
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   178 RAEERAElsegkcaELEEELKT-------VTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLE 250
Cdd:TIGR02169  333 KLLAEIE-------ELEREIEEerkrrdkLTEEYAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELK 405
                          250       260
                   ....*....|....*....|....*
gi 256000794   251 KSIDDLEDQLYHQLEQNRRLTNELK 275
Cdd:TIGR02169  406 RELDRLQEELQRLSEELADLNAAIA 430
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
54-280 3.15e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 42.01  E-value: 3.15e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   54 EDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIqlveEELDRAQERLATALQKLEEAEKAADESErgmKVIESR 133
Cdd:COG1196   666 KRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLL----EELRRQLEELERQLEELKRELAALEEEL---EQLQSR 738
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  134 AQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEK 213
Cdd:COG1196   739 LEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELES 818
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 256000794  214 YSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:COG1196   819 LEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEE 885
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2-260 3.91e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 41.59  E-value: 3.91e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQL-EDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR02169  247 ASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLgEEEQLRVKEKIGELEAEIASLERSIAEKERELEDAEERLAK 326
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    81 AEADVASLNRRIqlveEELDRAQERLATALQKLEEAekaADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR 160
Cdd:TIGR02169  327 LEAEIDKLLAEI----EELEREIEEERKRRDKLTEE---YAELKEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKR 399
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   161 KYEEvarklviIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:TIGR02169  400 EINE-------LKRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKYEQELY 472
                          250       260
                   ....*....|....*....|
gi 256000794   241 FAERSVTKLEKSIDDLEDQL 260
Cdd:TIGR02169  473 DLKEEYDRVEKELSKLQREL 492
EmrA COG1566
Multidrug resistance efflux pump [Defense mechanisms];
11-117 4.56e-04

Multidrug resistance efflux pump [Defense mechanisms];


Pssm-ID: 224482  Cd Length: 352  Bit Score: 40.78  E-value: 4.56e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  11 LKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQ--------KKLKGTEDELDKYSEALKD---AQEKLELAEKKAT 79
Cdd:COG1566   82 FRIDPRDYRAALEQAEAALAAAEAQLRNLRAQLASAQaliaqaeaQDLDQAQNELERRAELAQRgvvSREELDRARAALQ 161
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 256000794  80 DAEADVA----SLNRRIQLVEEELDRAQERLATALQKLEEAE 117
Cdd:COG1566  162 AAEAALAaaqaAQKQNLALLESEVSGAQAQVASAEAALDQAK 203
8a0101 TIGR00998
efflux pump membrane protein (multidrug resistance protein A); [Transport and binding proteins, ...
1-155 4.95e-04

efflux pump membrane protein (multidrug resistance protein A); [Transport and binding proteins, Other]


Pssm-ID: 273385  Cd Length: 334  Bit Score: 40.93  E-value: 4.95e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKENALDRAEQAEADkkaaedrskqledeLVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR00998  61 TDYVKQGDVLVRLDPTNAELALAKAEAN--------------LAALVRQTKQLEITVQQLQAKVESLKIKLEQAREKLLQ 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   81 AEADvasLNRRIQLVE------EELDRAQERLATALQKLE----EAEKAADESERGMKVIESRA-QKDEEKMEIQEIQLK 149
Cdd:TIGR00998 127 AELD---LRRRVPLFKkglisrEELDHARKALLSAKAALNaaiqEQLNANQALVRGTPLKKQPAvQEAKERLKTAWLALK 203

                  ....*.
gi 256000794  150 EAKHIA 155
Cdd:TIGR00998 204 RTVIRA 209
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
2-251 7.82e-04

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 40.51  E-value: 7.82e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:COG0419  203 DLLEALEEELKELKKLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERL 282
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADEsergMKVIESRAQKDEEKMEIQEIQLKEakhIAEDADRK 161
Cdd:COG0419  283 LEELEEKIERLEELEREIEELEEELEGLRALLEELEELLEK----LKSLEERLEKLEEKLEKLESELEE---LAEEKNEL 355
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 162 YEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF 241
Cdd:COG0419  356 AKLLEERLKELEERLEELEKELEKALERLKQLEEAIQELKEELAELSAALEEIQEELEELEKELEELERELEELEEEIKK 435
                        250
                 ....*....|
gi 256000794 242 AERSVTKLEK 251
Cdd:COG0419  436 LEEQINQLES 445
HlyD pfam00529
HlyD membrane-fusion protein of T1SS; HlyD is a component of the prototypical alpha-haemolysin ...
2-186 7.86e-04

HlyD membrane-fusion protein of T1SS; HlyD is a component of the prototypical alpha-haemolysin (HlyA) bacterial type I secretion system, along with the other components HlyB and TolC. HlyD and HlyB are inner-membrane proteins and specific components of the transport apparatus of alpha-haemolysin. HlyD is anchored in the cytoplasmic membrane by a single transmembrane domain and has a large periplasmic domain within the carboxy-terminal 100 amino acids, HlyB and HlyD form a stable complex that binds the recombinant protein bearing a C-terminal HlyA signal sequence and ATP in the cytoplasm. HlyD, HlyB and TolC combine to form the three-component ABC transporter complex that forms a trans-membrane channel or pore through which HlyA can be transferred directly to the extracellular medium. Cutinase has been shown to be transported effectively through this pore.


Pssm-ID: 306914  Cd Length: 332  Bit Score: 40.10  E-value: 7.86e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGT---EDELDKYSEALKDAQEKLELAEKKA 78
Cdd:pfam00529  50 DRVKAGDVLFQLDPTDYQAALDSAEAQLAQAQAQVARLQAELDRLQALVFPAlllRQDYDGATAQLRAAQAAVKAAQAQL 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   79 TDAEADvasLNRRIQLVEEELdRAQERLATALQKLEEAEKAADESergmkvIESRAQKDEEKMEIQEIQLKEAKHIAEDA 158
Cdd:pfam00529 130 AQAQID---LARRRVLAPIGG-ISRESLVTAGALVAQAQANLLAT------VAQLDQIYVQITQSAAENQAEVRSELSGA 199
                         170       180
                  ....*....|....*....|....*...
gi 256000794  159 DRKYEEVARKLVIIESDLERAEERAELS 186
Cdd:pfam00529 200 QLQIAEAEAELKLAKLDLERTEIRAPVD 227
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
2-200 8.70e-04

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 40.44  E-value: 8.70e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:TIGR02169  815 REIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKKERDEL 894
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES--RAQKDEEKMEIQEIQLKEAKHIAED-- 157
Cdd:TIGR02169  895 EAQLRELERKIEELEAQIEKKRKRLSELKAKLEALEEELSEIEDPKGEDEEipEEELSLEDVQAELQRVEEEIRALEPvn 974
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|....*
gi 256000794   158 --ADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV 200
Cdd:TIGR02169  975 mlAIQEYEEVLKRLDELKEKRAKLEEERKAILERIEEYEKKKREV 1019
PTZ00121 PTZ00121
MAEBL; Provisional
2-259 1.06e-03

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 40.51  E-value: 1.06e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA 81
Cdd:PTZ00121 1543 EEKKKADELKKAEELKKAEEKKKAEEAKKAEEDKNMALRKAEEAKKAEEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKA 1622
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   82 EAdvaslNRRIQLVEEELDRAQERLATALQKLEEAEKAadESERGMKVIESRAQKDEEKMEIQEI-QLKEAKHIAEDADR 160
Cdd:PTZ00121 1623 EE-----LKKAEEEKKKVEQLKKKEAEEKKKAEELKKA--EEENKIKAAEEAKKAEEDKKKAEEAkKAEEDEKKAAEALK 1695
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  161 KYEEVARKLVIIESDLERAEERAElsegKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:PTZ00121 1696 KEAEEAKKAEELKKKEAEEKKKAE----ELKKAEEENKIKAEEAKKEAEEDKKKAEEAKKDEEEKKKIAHLKKEEEKKAE 1771
                         250
                  ....*....|....*....
gi 256000794  241 FAERSVTKLEKSIDDLEDQ 259
Cdd:PTZ00121 1772 EIRKEKEAVIEEELDEEDE 1790
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
82-259 1.16e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009  Cd Length: 1164  Bit Score: 40.05  E-value: 1.16e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    82 EADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRK 161
Cdd:TIGR02169  673 PAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQE 752
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   162 YEEVARKLVIIESDLERAEERAELSEGKCAELEEELKtvTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEF 241
Cdd:TIGR02169  753 IENVKSELKELEARIEELEEDLHKLEEALNDLEARLS--HSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEY 830
                          170
                   ....*....|....*...
gi 256000794   242 AERSVTKLEKSIDDLEDQ 259
Cdd:TIGR02169  831 LEKEIQELQEQRIDLKEQ 848
PRK02224 PRK02224
chromosome segregation protein; Provisional
15-213 1.18e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 40.02  E-value: 1.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  15 KENALDRAEQAEADKKAAEDRSKQLED---ELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDA-------EAD 84
Cdd:PRK02224 229 REQARETRDEADEVLEEHEERREELETleaEIEDLRETIAETEREREELAEEVRDLRERLEELEEERDDLlaeagldDAD 308
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  85 VASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDA------ 158
Cdd:PRK02224 309 AEAVEARREELEDRDEELRDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAAELESELEEAREAVEDRreeiee 388
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 256000794 159 -DRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEK 213
Cdd:PRK02224 389 lEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLRTARERVEE 444
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
18-197 1.32e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length. [Hypothetical proteins, Conserved]


Pssm-ID: 274256  Cd Length: 1353  Bit Score: 40.17  E-value: 1.32e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    18 ALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEAL-----KDAQEKLELAEKKATDAEADVASLNRRI 92
Cdd:TIGR02680  791 AHRRAAEAERQAESAERELARAARKAAAAAAAWKQARRELERDAADLdlptdPDALEAVGLALKRFGDHLHTLEVAVREL 870
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    93 QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKM--EIQEIQLKEAkhiaeDADRKYEEVARKLV 170
Cdd:TIGR02680  871 RHAATRAAEQRARAARAESDAREAAEDAAEARAEAEEASLRLRTLEESVgaMVDEIRARLA-----ETRAALASGGRELP 945
                          170       180
                   ....*....|....*....|....*..
gi 256000794   171 IIESDLERAEERAELSEGKCAELEEEL 197
Cdd:TIGR02680  946 RLAEALATAEEARGRAEEKRAEADATL 972
CALCOCO1 pfam07888
Calcium binding and coiled-coil domain (CALCOCO1) like; Proteins found in this family are ...
8-278 1.76e-03

Calcium binding and coiled-coil domain (CALCOCO1) like; Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein coexpressed by Mus musculus (CoCoA/CALCOCO1). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1, and thus enhances transcriptional activation by a number of nuclear receptors. CALCOCO1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region.


Pssm-ID: 311715  Cd Length: 545  Bit Score: 39.45  E-value: 1.76e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    8 MQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKD--------AQEKLELAEKKAT 79
Cdd:pfam07888 156 LQAQEAANRQREKEKERYKRDREQWERQRKELESRISELKEELRHSREKHEELEEKQKEeqdlseelTQEKDALLEQRAE 235
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   80 ------DAEADVASLNRRIQLVEEELDRAQERL--ATALQKLEEAEKAADESE-----RGMKVIESRAQKDEEKMEIQEI 146
Cdd:pfam07888 236 hearirELEEDIKTLTQRVLERETELERMKERVkkAGAQRKEEEAEREQLQAEneallEELRSLQERLNASERKVEGLGE 315
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  147 QLKEakhIAEDADRKYEEVAR-KLVIIESDLERAEERAELSEGKCAELEEElktvtnnlKSLEAQAEKYSQKEDKYEEEI 225
Cdd:pfam07888 316 ELSS---MAAQRDRTQAELHQaRLQAAQLTLQLADASLALREGRARWAQER--------ETLQQSAEADKDRILKLSAEL 384
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|...
gi 256000794  226 KVLSDKLKEAETRAEfaersvtKLEKSIDDLEDQLYHQLEQNRRLTNELKLAL 278
Cdd:pfam07888 385 QRLEEALQEERMERE-------KLEVELGREKDCNRVQLSESRRELQELKASL 430
mukB PRK04863
cell division protein MukB; Provisional
15-275 2.60e-03

cell division protein MukB; Provisional


Pssm-ID: 235316  Cd Length: 1486  Bit Score: 39.17  E-value: 2.60e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   15 KENALDRAEQA-EADKKAAEDRsKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEAdvaslnrRIQ 93
Cdd:PRK04863  315 ELAELNEAESDlEQDYQAASDH-LNLVQTALRQQEKIERYQADLEELEERLEEQNEVVEEADEQQEENEA-------RAE 386
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   94 LVEEELDRAQERLA-----------------TALQKLEEAEK---AADESERGMKVIESRAQKDEEKMEIQEIQLKEAKH 153
Cdd:PRK04863  387 AAEEEVDELKSQLAdyqqaldvqqtraiqyqQAVQALERAKQlcgLPDLTADNAEDWLEEFQAKEQEATEELLSLEQKLS 466
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  154 IAEDADRKYEEVARKLVIIESDLERAEERAELSEgKCAELEEElKTVTNNLKSLEAQ---AEKYSQKEDKYEEEIKVLSD 230
Cdd:PRK04863  467 VAQAAHSQFEQAYQLVRKIAGEVSRSEAWDVARE-LLRRLREQ-RHLAEQLQQLRMRlseLEQRLRQQQRAERLLAEFCK 544
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 256000794  231 KLKEAETRAEFAERSVTKLEKSIDDLEDQ----------LYHQLEQNRRLTNELK 275
Cdd:PRK04863  545 RLGKNLDDEDELEQLQEELEARLESLSESvsearerrmaLRQQLEQLQARIQRLA 599
Spc7 pfam08317
Spc7 kinetochore protein; This domain is found in cell division proteins which are required ...
7-125 2.89e-03

Spc7 kinetochore protein; This domain is found in cell division proteins which are required for kinetochore-spindle association.


Pssm-ID: 311978  Cd Length: 311  Bit Score: 38.36  E-value: 2.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    7 KMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDK----YSEALKDAQEKLELAEKKATDAE 82
Cdd:pfam08317 134 RMQLLEGLKEGLEENLEGLEEDKAVLEKQEELLDELLPELVKEYAELEEELELlqerAEELENCDKDELEELREELAEQD 213
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 256000794   83 ADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER 125
Cdd:pfam08317 214 AEIEEKKRELAELQEQLEELEEKIEELKEQKQELLEEIAEAER 256
COG4913 COG4913
Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];
56-267 3.13e-03

Uncharacterized protein, contains a C-terminal ATPase domain [Function unknown];


Pssm-ID: 227250  Cd Length: 1104  Bit Score: 38.85  E-value: 3.13e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   56 ELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIES--- 132
Cdd:COG4913   678 ELQARLERLTHTQSDIAIAKAALDAAQTRQKVLERQYQQEVTECAGLKKDLKRAAMLSRKVHSIAKQGMTGALQALGaah 757
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  133 -RAQKDEEKMEIQEIQLKEakhIAEDADRKYEEVARKLVIIESDLERAEERA-ELSEGKCAELEEELKTVTNNLKSL-EA 209
Cdd:COG4913   758 fPQVAPEQHDDIVDIERIE---HRRQLQKRIDAVNARLRRLREEIIGRMSDAkKEDTAALSEVGAELDDIPEYLARLqTL 834
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 256000794  210 QAEKYSQKEDKYEEEIKVLSDklKEAETRAEFAERSVTKLEKSIDDLEDQLyHQLEQN 267
Cdd:COG4913   835 TEDALPEFLARFQELLNRSSD--DGVTQLLSHLDHERALIEERIEAINDSL-RRVDFN 889
PRK09039 PRK09039
hypothetical protein; Validated
46-199 3.30e-03

hypothetical protein; Validated


Pssm-ID: 181619  Cd Length: 343  Bit Score: 38.41  E-value: 3.30e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  46 LQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESEr 125
Cdd:PRK09039  44 LSREISGKDSALDRLNSQIAELADLLSLERQGNQDLQDSVANLRASLSAAEAERSRLQALLAELAGAGAAAEGRAGELA- 122
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 256000794 126 gmkviesrAQKDEEKMEIQeiqlkEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKT 199
Cdd:PRK09039 123 --------QELDSEKQVSA-----RALAQVELLNQQIAALRRQLAALEAALDASEKRDRESQAKIADLGRRLNV 183
Surf_Exclu_PgrA TIGR04320
SEC10/PgrA surface exclusion domain; This model describes a conserved domain found in surface ...
2-100 3.45e-03

SEC10/PgrA surface exclusion domain; This model describes a conserved domain found in surface proteins of a number of Firmutes. Many members have LPXTG C-terminal anchoring motifs and a substantial number have the KxYKxGKxW putative sorting signal at the N-terminus. The tetracycline resistance plasmid pCF10 in Enterococcus faecalis promotes conjugal plasmid transfer in response to sex pheromones, but PgrA/Sec10 encoded by that plasmid, a member of this family, specifically inhibits the ability of cells to receive homologous plasmids. The phenomenon is called surface exclusion.


Pssm-ID: 275124  Cd Length: 356  Bit Score: 38.17  E-value: 3.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    2 DAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSE-ALKDAQEKLELAEKKATD 80
Cdd:TIGR04320 257 AALQAKLATAQADLAAAQTALNTAQAALTSAQTAYAAAQAALATAQKELANAQAQALQTAQnNLATAQAALANAEARLAK 336
                          90       100
                  ....*....|....*....|
gi 256000794   81 AEADVASLNRRIQLVEEELD 100
Cdd:TIGR04320 337 AKEALANLNADLAKKQAALD 356
mukB PRK04863
cell division protein MukB; Provisional
37-278 3.60e-03

cell division protein MukB; Provisional


Pssm-ID: 235316  Cd Length: 1486  Bit Score: 38.78  E-value: 3.60e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   37 KQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEA-DVASLNRRIQLVEEELDRAQErlatALQKLEE 115
Cdd:PRK04863  840 RQLNRRRVELERALADHESQEQQQRSQLEQAKEGLSALNRLLPRLNLlADETLADRVEEIREQLDEAEE----AKRFVQQ 915
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  116 AEKAADESERGMKVIesraQKDEEKMEIQEIQLKEAKHIAEDADRKY----EEVARKLVIIESD-LERAEERAELSE--- 187
Cdd:PRK04863  916 HGNALAQLEPIVSVL----QSDPEQFEQLKQDYQQAQQTQRDAKQQAfaltEVVQRRAHFSYEDaAEMLAKNSDLNEklr 991
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  188 GKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETR-AEFAERSVTKLEKSIDDLEDQLYHQLEQ 266
Cdd:PRK04863  992 QRLEQAEQERTRAREQLRQAQAQLAQYNQVLASLKSSYDAKRQMLQELKQElQDLGVPADSGAEERARARRDELHARLSA 1071
                         250
                  ....*....|..
gi 256000794  267 NRRLTNELKLAL 278
Cdd:PRK04863 1072 NRSRRNQLEKQL 1083
Exonuc_VII_L pfam02601
Exonuclease VII, large subunit; This family consist of exonuclease VII, large subunit EC:3.1. ...
14-114 3.71e-03

Exonuclease VII, large subunit; This family consist of exonuclease VII, large subunit EC:3.1.11.6 This enzyme catalyzes exonucleolytic cleavage in either 5'->3' or 3'->5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones.


Pssm-ID: 308296  Cd Length: 289  Bit Score: 37.82  E-value: 3.71e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   14 DKENALDRAEQAEAD-KKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELA-EKKATDAEADVASLNRR 91
Cdd:pfam02601 141 DRAELLARLEQLQQRlARAMQRRLERRRQRLDRLARRLPSPSRLLERQRQRLDELSQRLERAlARRLARARQRLERLEQR 220
                          90       100
                  ....*....|....*....|...
gi 256000794   92 IQLvEEELDRAQERLATALQKLE 114
Cdd:pfam02601 221 LKA-ERLLERKRQRLELLASRLE 242
IncA pfam04156
IncA protein; Chlamydia trachomatis is an obligate intracellular bacterium that develops ...
20-133 4.10e-03

IncA protein; Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is non-fusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA, is functionally associated with the homotypic fusion of inclusions. This family probably includes members of the wider Inc family rather than just IncA. Members are usually either 2 or 4TM proteins.


Pssm-ID: 309330  Cd Length: 187  Bit Score: 37.45  E-value: 4.10e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   20 DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEEL 99
Cdd:pfam04156  71 PKKLEEQGELSELQQQLAELQEELEELEERLSELEAELLDLKEDLQLLLELLKSVEERLDSLEESIKELAKELRELREVQ 150
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 256000794  100 DRAQE--RLATALQKLEEAEKAADESERGMKVIESR 133
Cdd:pfam04156 151 DLREEvqELREELERLQELLEDLKEAIAELQELLEQ 186
Surf_Exclu_PgrA TIGR04320
SEC10/PgrA surface exclusion domain; This model describes a conserved domain found in surface ...
14-121 4.20e-03

SEC10/PgrA surface exclusion domain; This model describes a conserved domain found in surface proteins of a number of Firmutes. Many members have LPXTG C-terminal anchoring motifs and a substantial number have the KxYKxGKxW putative sorting signal at the N-terminus. The tetracycline resistance plasmid pCF10 in Enterococcus faecalis promotes conjugal plasmid transfer in response to sex pheromones, but PgrA/Sec10 encoded by that plasmid, a member of this family, specifically inhibits the ability of cells to receive homologous plasmids. The phenomenon is called surface exclusion.


Pssm-ID: 275124  Cd Length: 356  Bit Score: 37.78  E-value: 4.20e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   14 DKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK-LELAEKKATDAEADVASLnrri 92
Cdd:TIGR04320 255 SLAALQAKLATAQADLAAAQTALNTAQAALTSAQTAYAAAQAALATAQKELANAQAQaLQTAQNNLATAQAALANA---- 330
                          90       100
                  ....*....|....*....|....*....
gi 256000794   93 qlvEEELDRAQERLATALQKLEEAEKAAD 121
Cdd:TIGR04320 331 ---EARLAKAKEALANLNADLAKKQAALD 356
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
1-184 4.92e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008  Cd Length: 1179  Bit Score: 38.11  E-value: 4.92e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:TIGR02168  833 IAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNERASLEEALALLRSELEELSEELRELESKRSE 912
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    81 AEADVASLNRRIQLVEEELDRAQERLATALQKL-EEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDAD 159
Cdd:TIGR02168  913 LRRELEELREKLAQLELRLEGLEVRIDNLQERLsEEYSLTLEEAEALENKIEDDEEEARRRLKRLENKIKELGPVNLAAI 992
                          170       180
                   ....*....|....*....|....*...
gi 256000794   160 RKYEEVARKLVIIES---DLERAEERAE 184
Cdd:TIGR02168  993 EEYEELKERYDFLTAqkeDLTEAKETLE 1020
hsdR PRK11448
type I restriction enzyme EcoKI subunit R; Provisional
144-239 4.99e-03

type I restriction enzyme EcoKI subunit R; Provisional


Pssm-ID: 236912  Cd Length: 1123  Bit Score: 38.01  E-value: 4.99e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  144 QEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Cdd:PRK11448  140 PENLLHALQQEVLTLKQQLELQAREKAQSQALAEAQQQELVALEGLAAELEEKQQELEAQLEQLQEKAAETSQERKQKRK 219
                          90
                  ....*....|....*....
gi 256000794  224 EIKVLSDK---LKEAETRA 239
Cdd:PRK11448  220 EITDQAAKrleLSEEETRI 238
APG6 pfam04111
Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. ...
1-118 5.17e-03

Autophagy protein Apg6; In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway.


Pssm-ID: 309295  Cd Length: 308  Bit Score: 37.55  E-value: 5.17e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    1 MDAIKKKMQMLKLDKEN------ALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELA 74
Cdd:pfam04111  11 LEELDKELEQLEKERDAyqeflkKLEKEKPSDEEIEALEKELEKLEKEEEELLQELEELEKEREELDAELEKLEEELEEL 90
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 256000794   75 EKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEK 118
Cdd:pfam04111  91 DEEEEEYWREYNAFQLELLEFQDERDSLENQYEHAQDQLDRLRK 134
PTZ00121 PTZ00121
MAEBL; Provisional
5-251 5.34e-03

MAEBL; Provisional


Pssm-ID: 173412  Cd Length: 2084  Bit Score: 38.20  E-value: 5.34e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    5 KKKMQMLKLDKENALDRAEQAeadKKAAEDRSKQleDELVSLQKKLKGteDELDKYSEALKdaQEKLELAEKKATDAEAD 84
Cdd:PTZ00121 1482 AKKADEAKKKAEEAKKKADEA---KKAAEAKKKA--DEAKKAEEAKKA--DEAKKAEEAKK--ADEAKKAEEKKKADELK 1552
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   85 VASLNRRIQLVE--EELDRAQERLATALQKLEEAEKAadesERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKY 162
Cdd:PTZ00121 1553 KAEELKKAEEKKkaEEAKKAEEDKNMALRKAEEAKKA----EEARIEEVMKLYEEEKKMKAEEAKKAEEAKIKAEELKKA 1628
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  163 EEVARKLVIIESDLERAEERAE---LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRA 239
Cdd:PTZ00121 1629 EEEKKKVEQLKKKEAEEKKKAEelkKAEEENKIKAAEEAKKAEEDKKKAEEAKKAEEDEKKAAEALKKEAEEAKKAEELK 1708
                         250
                  ....*....|..
gi 256000794  240 EFAERSVTKLEK 251
Cdd:PTZ00121 1709 KKEAEEKKKAEE 1720
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
83-281 5.79e-03

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117  Cd Length: 1163  Bit Score: 37.77  E-value: 5.79e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   83 ADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEI-----------QLKEA 151
Cdd:COG1196   165 AGVSKYKERKEEAERKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELAlllaklkelrkELEEL 244
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  152 KHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDK 231
Cdd:COG1196   245 EEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEER 324
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 256000794  232 LKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNED 281
Cdd:COG1196   325 LEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEEL 374
outer_NodT TIGR01845
efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; Members of this ...
16-112 6.42e-03

efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins]


Pssm-ID: 273830  Cd Length: 460  Bit Score: 37.39  E-value: 6.42e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   16 ENALDRAEQAEADKKAAEdrsKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKK----------ATDAEADV 85
Cdd:TIGR01845 147 ESALAQLEAAEADSQAAR---LTLSASIANAYVQLAALRAQLDVYHAALASRRKTLELTQKRyaagvaaasdVRQAEAAV 223
                          90       100
                  ....*....|....*....|....*..
gi 256000794   86 ASLNRRIQLVEEELDRAQERLATALQK 112
Cdd:TIGR01845 224 ASAEAELPSLDVQIAQARNALAALLGK 250
PRK02224 PRK02224
chromosome segregation protein; Provisional
14-260 6.68e-03

chromosome segregation protein; Provisional


Pssm-ID: 179385  Cd Length: 880  Bit Score: 37.71  E-value: 6.68e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  14 DKENALDRAEQAEADKKAAEDRSKQLEDELVSLqkklkgtEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQ 93
Cdd:PRK02224 294 ERDDLLAEAGLDDADAEAVEARREELEDRDEEL-------RDRLEECRVAAQAHNEEAESLREDADDLEERAEELREEAA 366
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  94 LVEEELDRAQERLATALQKLEEAEKAADESergmkviesraqkdEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIE 173
Cdd:PRK02224 367 ELESELEEAREAVEDRREEIEELEEEIEEL--------------RERFGDAPVDLGNAEDFLEELREERDELREREAELE 432
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 174 SDLERAEERAE-----LSEGKCAELEEELK--TVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEfAERSV 246
Cdd:PRK02224 433 ATLRTARERVEeaealLEAGKCPECGQPVEgsPHVETIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVE-AEDRI 511
                        250
                 ....*....|....
gi 256000794 247 TKLEKSIDDLEDQL 260
Cdd:PRK02224 512 ERLEERREDLEELI 525
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
16-275 7.03e-03

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638  Cd Length: 1480  Bit Score: 37.56  E-value: 7.03e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   16 ENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLV 95
Cdd:COG3096   323 EGDLEADYQAASDHLNLVQTALRQQEKIERYQADLEELTIRLEEQNEVVEEANERQEENEARAEAAELEVDELKSQLADY 402
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   96 EEELDRAQER---LATALQKLEEAEKAADESERGMKVIESRA---QKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKL 169
Cdd:COG3096   403 QQALDVQQTRaiqYQQAIAALERAKELCHLPDLTADSAEEWLetfQAKEEEATEKLLSLEQKMSMAQAAHSQFEQAYQLV 482
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  170 VIIESDLERAEerAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAET--RAEFAERSVT 247
Cdd:COG3096   483 VAIAGELARSE--AWDVARELLREGPDQRHLAEQVQPLRMRLSELEQRLRQQQSAERLLADFCKRQGKnlDAEELEALHQ 560
                         250       260
                  ....*....|....*....|....*...
gi 256000794  248 KLEKSIDDLEDQLYHQLEQNRRLTNELK 275
Cdd:COG3096   561 ELEALIESLSDSVSNAREQRMALRQEQE 588
mukB PRK04863
cell division protein MukB; Provisional
27-152 8.52e-03

cell division protein MukB; Provisional


Pssm-ID: 235316  Cd Length: 1486  Bit Score: 37.24  E-value: 8.52e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   27 ADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELdRAQERL 106
Cdd:PRK04863  272 ADYMRHANERRVHLEEALELRRELYTSRRQLAAEQYRLVEMARELAELNEAESDLEQDYQAASDHLNLVQTAL-RQQEKI 350
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 256000794  107 ATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK 152
Cdd:PRK04863  351 ERYQADLEELEERLEEQNEVVEEADEQQEENEARAEAAEEEVDELK 396
PRK12704 PRK12704
phosphodiesterase; Provisional
109-229 8.75e-03

phosphodiesterase; Provisional


Pssm-ID: 237177  Cd Length: 520  Bit Score: 37.07  E-value: 8.75e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 109 ALQKLEEAEKAADEsergmKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEE----RAE 184
Cdd:PRK12704  29 AEAKIKEAEEEAKR-----ILEEAKKEAEAIKKEALLEAKEEIHKLRNEFEKELRERRNELQKLEKRLLQKEEnldrKLE 103
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 256000794 185 LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLS 229
Cdd:PRK12704 104 LLEKREEELEKKEKELEQKQQELEKKEEELEELIEEQLQELERIS 148
PRK12704 PRK12704
phosphodiesterase; Provisional
149-273 9.39e-03

phosphodiesterase; Provisional


Pssm-ID: 237177  Cd Length: 520  Bit Score: 37.07  E-value: 9.39e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 149 KEAKHIAEDADRKYEEVARKLViiesdLERAEERAELSEgkcaELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVL 228
Cdd:PRK12704  38 EEAKRILEEAKKEAEAIKKEAL-----LEAKEEIHKLRN----EFEKELRERRNELQKLEKRLLQKEENLDRKLELLEKR 108
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 256000794 229 SDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNE 273
Cdd:PRK12704 109 EEELEKKEKELEQKQQELEKKEEELEELIEEQLQELERISGLTAE 153
Borrelia_P83 pfam05262
Borrelia P83/100 protein; This family consists of several Borrelia P83/P100 antigen proteins.
58-237 9.66e-03

Borrelia P83/100 protein; This family consists of several Borrelia P83/P100 antigen proteins.


Pssm-ID: 114011  Cd Length: 489  Bit Score: 36.90  E-value: 9.66e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   58 DKYSEALKDAQEK-LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQK 136
Cdd:pfam05262 180 KKVVEALREDNEKgVNFRRDMTDLKERESQEDAKRAQQLKEELDKKQIDADKAQQKADFAQDNADKQRDEVRQKQQEAKN 259
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  137 DE---------EKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLER-AEERAELSEGKCAELEEELKTVTNNLKS 206
Cdd:pfam05262 260 LPkpadtsspkEDKQVAENQKREIEKAQIEIKKNDEEALKAKDHKAFDLKQeSKASEKEAEDKELEAQKKREPVAEDLQK 339
                         170       180       190
                  ....*....|....*....|....*....|...
gi 256000794  207 L--EAQAEKYSQKEDKYEEEIKVLSDKLKEAET 237
Cdd:pfam05262 340 TkpQVEAQPTSLNEDAIDSSNPVYGLKVVDPIT 372
TIGR02680 TIGR02680
TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene ...
82-269 9.70e-03

TIGR02680 family protein; Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length. [Hypothetical proteins, Conserved]


Pssm-ID: 274256  Cd Length: 1353  Bit Score: 37.09  E-value: 9.70e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794    82 EADVASLNRRIQLVEEELDRAQERLA--TALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDAD 159
Cdd:TIGR02680  741 LRRIAELDARLAAVDDELAELARELRalGARQRALADELAGAPSDRSLRAAHRRAAEAERQAESAERELARAARKAAAAA 820
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   160 RKYEEVARKLVIIESDLERAEERAELSEGKCA-----ELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKE 234
Cdd:TIGR02680  821 AAWKQARRELERDAADLDLPTDPDALEAVGLAlkrfgDHLHTLEVAVRELRHAATRAAEQRARAARAESDAREAAEDAAE 900
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 256000794   235 AETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRR 269
Cdd:TIGR02680  901 ARAEAEEASLRLRTLEESVGAMVDEIRARLAETRA 935
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
1-280 9.86e-03

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496  Cd Length: 908  Bit Score: 37.05  E-value: 9.86e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794   1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD 80
Cdd:COG0419  317 LEELLEKLKSLEERLEKLEEKLEKLESELEELAEEKNELAKLLEERLKELEERLEELEKELEKALERLKQLEEAIQELKE 396
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794  81 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEakHIAEDADR 160
Cdd:COG0419  397 ELAELSAALEEIQEELEELEKELEELERELEELEEEIKKLEEQINQLESKELMIAELAGAGEKCPVCGQE--LPEEHEKE 474
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 256000794 161 KYEEVARKLVIIESDLERAEERAELsegkCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE 240
Cdd:COG0419  475 LLELYELELEELEEELSREKEEAEL----REEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENLLEELEELKE 550
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 256000794 241 FAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280
Cdd:COG0419  551 KLQLQQLKEELRQLEDRLQELKELLEELRLLRTRKEELEE 590
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH