NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|188595716|ref|NP_001120972|]
View 

hepatocyte growth factor receptor isoform a preproprotein [Homo sapiens]

Protein Classification

Sema_MET and PTKc_Met_Ron domain-containing protein (domain architecture ID 10876287)

protein containing domains Sema_MET, IPT_plexin_repeat1, IPT_plexin_repeat2, and PTKc_Met_Ron

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Sema_MET cd11278
The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor ...
25-516 0e+00

The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor receptor, HGFR); MET is encoded by the c-met protooncogene. MET is a receptor tyrosine kinase that binds its ligand, hepatocyte growth factor/scatter factor (HGF/SF). HGF/SF and MET are essential for the development of several tissues and organs, including the placenta, liver, and several groups of skeletal muscles. It also plays a major role in the abnormal migration of cancer cells as a result of overexpression or MET mutations. MET is composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a Sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic tyrosine kinase domain. The cytoplasmic C-terminal region acts as a docking site for multiple protein substrates, including Grb2, Gab1, STAT3, Shc, SHIP-1 and Src. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. The Sema domain of Met is necessary for receptor dimerization and activation.


:

Pssm-ID: 200539  Cd Length: 492  Bit Score: 985.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   25 ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEeDLQKVAEYKTGPVLEHPDCFPCQDCSSK 104
Cdd:cd11278     1 QCKEAAKKSEMNLNMKYQLPNFTAETPIQNVILHKHHIYVGAVNKIYVLNE-DLQKVSEYKTGPVLEHPDCFPCQDCSDK 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  105 ANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQI-EEPSQCPDCVVSALGAK 183
Cdd:cd11278    80 ANLSNGVWKDNVNMALFVETYYDDQLISCGSVNRGTCQRHVFPHDHPADIQSEVHCIYSPQIeEEPDQCPDCVVSTLGSK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  184 VLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLT 263
Cdd:cd11278   160 VLVTVKDRFVNFFVGNTINSSYFPDHPLHSISVRRLKETQDGFEFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFVYFLT 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  264 VQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILF 343
Cdd:cd11278   240 VQRESLDSQTFHTRIIRFCSIDSELRSYMEMPLECIFTEKRRKRSTKKEVFNILQAAYVSKPGAQLAREMGASLNDDILF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  344 GVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTA 423
Cdd:cd11278   320 GVFAQSKPDSAEPMNRSAVCAVSIKTINEFFNKIVDKQNVKCLQHFYGKNHEHCFNRTFLRNASYCEARRDEYRVEVTTA 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  424 LQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 503
Cdd:cd11278   400 LQRVDLFMGQFSNVLLTSISVFTKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 479
                         490
                  ....*....|...
gi 188595716  504 VITGKKITKIPLN 516
Cdd:cd11278   480 VITGKKITKIPLN 492
PTKc_Met_Ron cd05058
Catalytic domain of the Protein Tyrosine Kinases, Met and Ron; PTKs catalyze the transfer of ...
1100-1361 0e+00

Catalytic domain of the Protein Tyrosine Kinases, Met and Ron; PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor PTKs (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also called the HGF receptor. HGF/Met signaling plays a role in growth, transformation, cell motility, invasion, metastasis, angiogenesis, wound healing, and tissue regeneration. Aberrant expression of Met through mutations or gene amplification is associated with many human cancers including hereditary papillary renal and gastric carcinomas. The ligand for Ron is macrophage stimulating protein (MSP). Ron signaling is important in regulating cell motility, adhesion, proliferation, and apoptosis. Aberrant Ron expression is implicated in tumorigenesis and metastasis. The Met/Ron subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


:

Pssm-ID: 270649 [Multi-domain]  Cd Length: 262  Bit Score: 601.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1100 EVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMK 1179
Cdd:cd05058     1 EVIGKGHFGCVYHGTLIDSDGQKIHCAVKSLNRITDIEEVEQFLKEGIIMKDFSHPNVLSLLGICLPSEGSPLVVLPYMK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1180 HGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT 1259
Cdd:cd05058    81 HGDLRNFIRSETHNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLAARNCMLDESFTVKVADFGLARDIYDKEYYSVHNHT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1260 GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWH 1339
Cdd:cd05058   161 GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVDSFDITVYLLQGRRLLQPEYCPDPLYEVMLSCWH 240
                         250       260
                  ....*....|....*....|..
gi 188595716 1340 PKAEMRPSFSELVSRISAIFST 1361
Cdd:cd05058   241 PKPEMRPTFSELVSRISQIFST 262
IPT_plexin_repeat1 cd01180
First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are ...
563-656 1.39e-32

First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


:

Pssm-ID: 238585  Cd Length: 94  Bit Score: 121.65  E-value: 1.39e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  563 PAIYKVFPNSAPLEGGTRLTICGWDFGFRRNnkfdLKKTRVLLGNESCTLTLSE-STMNTLKCTVGPAMNKHFNMSIIIS 641
Cdd:cd01180     1 PVITEFFPLSGPLEGGTRLTICGSNLGLRKN----DVRHGVRVGGVPCNPEPPEySSSEKIVCTTGPAGNPVFNGPVEVT 76
                          90
                  ....*....|....*...
gi 188595716  642 NGHG---TTQYSTFSYVD 656
Cdd:cd01180    77 VGHGsfrTESSEGFSFVD 94
IPT_plexin_repeat2 cd01179
Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are ...
657-740 6.93e-32

Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


:

Pssm-ID: 238584  Cd Length: 85  Bit Score: 119.25  E-value: 6.93e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  657 PVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRE-TSI 735
Cdd:cd01179     1 PSITSLSPSYGPQSGGTRLTITGKHLNAGSSVRVTVGGQPCKILSVSSSQIVCLTPPSASPGEAPVKVLIDGARRLaPLV 80

                  ....*
gi 188595716  736 FSYRE 740
Cdd:cd01179    81 FTYTE 85
IPT super family cl15674
Immunoglobulin-like fold, Plexins, Transcription factors (IPT). IPTs are also known as ...
742-855 4.74e-24

Immunoglobulin-like fold, Plexins, Transcription factors (IPT). IPTs are also known as Transcription factor ImmunoGlobin (TIG) domains. They are present in intracellular transcription factors, cell surface receptors (such as plexins and scatter factor receptors), as well as, cyclodextrin glycosyltransferase and similar enzymes. Although they are involved in DNA binding in transcription factors, their function in other proteins is unknown. In these transcription factors, IPTs form homo- or heterodimers with the exception of the nuclear factor of activated Tcells (NFAT) transcription factors which are mainly monomers.


The actual alignment was detected with superfamily member cd01181:

Pssm-ID: 353966  Cd Length: 99  Bit Score: 97.49  E-value: 4.74e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  742 PIVYEIHPTKSFIStwwkeplnivsflfcfasGGSTITGVGKNLNSVSVPRMVINVHEagrNFTVACQHRsNSEIICCTT 821
Cdd:cd01181     1 PTITRIEPEWSFLS------------------GGTPITVTGTNLNTVQEPRIRVKYGG---VEKTSCKVR-NSTLMTCPA 58
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 188595716  822 PS-LQQLNLQLPLKTKAFFMLDGI------LSKYFDLIYVH 855
Cdd:cd01181    59 PSlALLNRSPEPGERPVEFGLDGDnvqsllILNRTSFSYYP 99
PSI smart00423
domain found in Plexins, Semaphorins and Integrins;
519-561 7.32e-09

domain found in Plexins, Semaphorins and Integrins;


:

Pssm-ID: 214655  Cd Length: 47  Bit Score: 52.55  E-value: 7.32e-09
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*..
gi 188595716    519 GCRHFQSCSQCLSAPPFvQCGWC--HDKCVRSEECLSG--TWTQQIC 561
Cdd:smart00423    1 RCSKYTSCSECLLARDP-YCAWCssQGRCTSGERCDSRrqNWLSGGC 46
IPT smart00429
ig-like, plexins, transcription factors;
856-952 2.42e-05

ig-like, plexins, transcription factors;


:

Pssm-ID: 214657  Cd Length: 90  Bit Score: 43.95  E-value: 2.42e-05
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    856 NPVFKPFEKPVMISMGNENVLeIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNdLLKLNSELNIEwkqaISS 935
Cdd:smart00429    1 DPVITRISPTSGPVSGGTEIT-LCGKNLKSISVVFVEVGVGEAPCTFSPSSSTAIVCKTPP-YHNIPGSVPVR----TVG 74
                            90
                    ....*....|....*..
gi 188595716    936 TVLGKVIVQPdQNFTGL 952
Cdd:smart00429   75 LRNGGVPSSP-QPFTYV 90
 
Name Accession Description Interval E-value
Sema_MET cd11278
The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor ...
25-516 0e+00

The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor receptor, HGFR); MET is encoded by the c-met protooncogene. MET is a receptor tyrosine kinase that binds its ligand, hepatocyte growth factor/scatter factor (HGF/SF). HGF/SF and MET are essential for the development of several tissues and organs, including the placenta, liver, and several groups of skeletal muscles. It also plays a major role in the abnormal migration of cancer cells as a result of overexpression or MET mutations. MET is composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a Sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic tyrosine kinase domain. The cytoplasmic C-terminal region acts as a docking site for multiple protein substrates, including Grb2, Gab1, STAT3, Shc, SHIP-1 and Src. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. The Sema domain of Met is necessary for receptor dimerization and activation.


Pssm-ID: 200539  Cd Length: 492  Bit Score: 985.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   25 ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEeDLQKVAEYKTGPVLEHPDCFPCQDCSSK 104
Cdd:cd11278     1 QCKEAAKKSEMNLNMKYQLPNFTAETPIQNVILHKHHIYVGAVNKIYVLNE-DLQKVSEYKTGPVLEHPDCFPCQDCSDK 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  105 ANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQI-EEPSQCPDCVVSALGAK 183
Cdd:cd11278    80 ANLSNGVWKDNVNMALFVETYYDDQLISCGSVNRGTCQRHVFPHDHPADIQSEVHCIYSPQIeEEPDQCPDCVVSTLGSK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  184 VLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLT 263
Cdd:cd11278   160 VLVTVKDRFVNFFVGNTINSSYFPDHPLHSISVRRLKETQDGFEFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFVYFLT 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  264 VQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILF 343
Cdd:cd11278   240 VQRESLDSQTFHTRIIRFCSIDSELRSYMEMPLECIFTEKRRKRSTKKEVFNILQAAYVSKPGAQLAREMGASLNDDILF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  344 GVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTA 423
Cdd:cd11278   320 GVFAQSKPDSAEPMNRSAVCAVSIKTINEFFNKIVDKQNVKCLQHFYGKNHEHCFNRTFLRNASYCEARRDEYRVEVTTA 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  424 LQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 503
Cdd:cd11278   400 LQRVDLFMGQFSNVLLTSISVFTKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 479
                         490
                  ....*....|...
gi 188595716  504 VITGKKITKIPLN 516
Cdd:cd11278   480 VITGKKITKIPLN 492
PTKc_Met_Ron cd05058
Catalytic domain of the Protein Tyrosine Kinases, Met and Ron; PTKs catalyze the transfer of ...
1100-1361 0e+00

Catalytic domain of the Protein Tyrosine Kinases, Met and Ron; PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor PTKs (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also called the HGF receptor. HGF/Met signaling plays a role in growth, transformation, cell motility, invasion, metastasis, angiogenesis, wound healing, and tissue regeneration. Aberrant expression of Met through mutations or gene amplification is associated with many human cancers including hereditary papillary renal and gastric carcinomas. The ligand for Ron is macrophage stimulating protein (MSP). Ron signaling is important in regulating cell motility, adhesion, proliferation, and apoptosis. Aberrant Ron expression is implicated in tumorigenesis and metastasis. The Met/Ron subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.


Pssm-ID: 270649 [Multi-domain]  Cd Length: 262  Bit Score: 601.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1100 EVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMK 1179
Cdd:cd05058     1 EVIGKGHFGCVYHGTLIDSDGQKIHCAVKSLNRITDIEEVEQFLKEGIIMKDFSHPNVLSLLGICLPSEGSPLVVLPYMK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1180 HGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT 1259
Cdd:cd05058    81 HGDLRNFIRSETHNPTVKDLIGFGLQVAKGMEYLASKKFVHRDLAARNCMLDESFTVKVADFGLARDIYDKEYYSVHNHT 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1260 GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWH 1339
Cdd:cd05058   161 GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVDSFDITVYLLQGRRLLQPEYCPDPLYEVMLSCWH 240
                         250       260
                  ....*....|....*....|..
gi 188595716 1340 PKAEMRPSFSELVSRISAIFST 1361
Cdd:cd05058   241 PKPEMRPTFSELVSRISQIFST 262
Pkinase_Tyr pfam07714
Protein tyrosine kinase;
1096-1355 5.15e-131

Protein tyrosine kinase;


Pssm-ID: 336778 [Multi-domain]  Cd Length: 258  Bit Score: 404.19  E-value: 5.15e-131
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  1096 VHFNEVIGRGHFGCVYHGTLL-DNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEgSPLVV 1174
Cdd:pfam07714    1 LTLGEKLGEGAFGEVYKGTLKgEGENTKIKVAVKTLKEGADEEEREEFLEEASIMKKLDHPNIVKLLGVCTQGE-PLYIV 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  1175 LPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYS 1254
Cdd:pfam07714   80 TEYMPGGDLLDFLRKHKGKLTLKDLLSMALQIAKGMEYLESKNFVHRDLAARNILVTENLVVKISDFGLSRDVYDDDYYR 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  1255 VhnKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVM 1334
Cdd:pfam07714  160 K--RGGGKLPIKWMAPESLKDGKFTSKSDVWSFGVLLWEIFTLGEQPYPGMSNEEVLEFLEDGYRLPQPENCPDELYDLM 237
                          250       260
                   ....*....|....*....|.
gi 188595716  1335 LKCWHPKAEMRPSFSELVSRI 1355
Cdd:pfam07714  238 TQCWAYDPEDRPTFSELVEDL 258
TyrKc smart00219
Tyrosine kinase, catalytic domain; Phosphotransferases. Tyrosine-specific kinase subfamily.
1096-1355 5.58e-124

Tyrosine kinase, catalytic domain; Phosphotransferases. Tyrosine-specific kinase subfamily.


Pssm-ID: 197581 [Multi-domain]  Cd Length: 257  Bit Score: 385.35  E-value: 5.58e-124
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   1096 VHFNEVIGRGHFGCVYHGTLLDNDGKK-IHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLrSEGSPLVV 1174
Cdd:smart00219    1 LTLGKKLGEGAFGEVYKGKLKGKGGKKkVEVAVKTLKEDASEQQIEEFLREARIMRKLDHPNVVKLLGVCT-EEEPLYIV 79
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   1175 LPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYS 1254
Cdd:smart00219   80 MEYMEGGDLLSYLRKNRPKLSLSDLLSFALQIARGMEYLESKNFIHRDLAARNCLVGENLVVKISDFGLSRDLYDDDYYR 159
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   1255 vhnKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVM 1334
Cdd:smart00219  160 ---KRGGKLPIRWMAPESLKEGKFTSKSDVWSFGVLLWEIFTLGEQPYPGMSNEEVLEYLKNGYRLPQPPNCPPELYDLM 236
                           250       260
                    ....*....|....*....|.
gi 188595716   1335 LKCWHPKAEMRPSFSELVSRI 1355
Cdd:smart00219  237 LQCWAEDPEDRPTFSELVEIL 257
Sema smart00630
semaphorin domain;
52-487 2.11e-97

semaphorin domain;


Pssm-ID: 214747 [Multi-domain]  Cd Length: 390  Bit Score: 318.16  E-value: 2.11e-97
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716     52 IQNVILHE--HHIFLGATNYIYVLNEeDLQKVAEYKTGPVLEHPDCFPCQdcsSKANLSggvWKDNINMALVVDTYYDDQ 129
Cdd:smart00630    1 LQHLLLDEdnGTLYVGARNRLYQLSL-NLILEAELKTGPVLSSPDCEECV---SKGKDP---PTDCVNYIRLLLDYNEDR 73
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    130 LISCGS-VNRGTCQRHVFPhnhtadiqsevhcifspqieepsqcpdcvvsalgakvlssvkdrfiNFFVGNTINSSYFPD 208
Cdd:smart00630   74 LLVCGTnAFQPVCRLRNLG----------------------------------------------ELYVGTVADFSGSDP 107
                           170       180       190       200       210       220       230       240
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    209 HPLHSISVRRLKETkdgfmflTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDA---QTFHTRIIRFC--- 282
Cdd:smart00630  108 AIPRSLSVRRLKGT-------SGVSLRTVLYDSKWLNEPNFVYAFESGDFVYFFFRETAVEDDncgKAVHSRVARVCknd 180
                           250       260       270       280       290       300       310       320
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    283 -----SINSGLHSYMEMPLECILTEkrkkrsTKKEVFNILQAAYVSKPGaqlarqigaSLNDDILFGVFAQskpdSAEPM 357
Cdd:smart00630  181 vggprSLDKKWTSFLKARLECSVPG------EDPFYFNELQAAFLLPPG---------SESDDVLYGVFST----SSNPI 241
                           330       340       350       360       370       380       390       400
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    358 DRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHE-------HCFNRTLLRNSSGCE----ARRDEYRTEFTTALQR 426
Cdd:smart00630  242 PGSAVCAFSLSDINAVFNGPFKECETSTSQWLPYSRGKvpyprpgTCPNKPPSSKDLPDEtlnfIKSHPLMDEVVQPLTG 321
                           410       420       430       440       450       460
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 188595716    427 VDLFMGQFSEVLLTSIS---TFIKGDLTIANLGTSEGRFMQVVVSRSGPS---TPHVNFLL--DSHPVS 487
Cdd:smart00630  322 RPLFVKTDSNYLLTSIAvdrVATDGNYTVLFLGTSDGRILKVVLSESSSSsesVVLEEISVfpDGSPIS 390
Sema pfam01403
Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and ...
54-491 6.60e-40

Sema domain; The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in the hepatocyte growth factor receptor and plexin-A3.


Pssm-ID: 334525  Cd Length: 345  Bit Score: 151.65  E-value: 6.60e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    54 NVILHEHH--IFLGATNYIYVLNEEDLQKVAEYKTGPVLE--HPDCFPCQ----DCsskanlsggvwkdnINMALVVDTY 125
Cdd:pfam01403    1 TLLLDEDSgrLYVGARNALYSLSLSNLQLLSYQVTGPISEedNEECLPKGkdetEC--------------ANYIRVLQPL 66
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   126 YDDQLISCGS-VNRGTCQRHVFPHNHTADIQSEvhcifspqieepSQCPDCVVSALGAKVLSSVKDrfiNFFVGNTINSS 204
Cdd:pfam01403   67 NDTHLYVCGTnAFQPVCALIDLGVFSLEDLSVE------------GGKGKCPFDPSQTSTAVVVDG---ELYSGTSIDFL 131
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   205 -----YFPDHPLHSISVRRLketkdgfmfltdqsyidvlpEFRDSYPIKYVHAFESNNFIYFLTVQRE---TLDAQTFHT 276
Cdd:pfam01403  132 gkdpvIFRSLSRPSLRTERS--------------------DSKWLNEPKFVGSFEIGDSVYFFFRERAveyDSRGKAIVS 191
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   277 RIIRFCSINSG--------LHSYMEMPLECIltekrkkRSTKKEVFNILQAAYVSKPGaqlarqigaSLNDDILFGVFAQ 348
Cdd:pfam01403  192 RVARVCKNDVGgqrtlqnkWTSFLKARLVCS-------VPGVEFYFNELQDVFLLGIG---------DEDDTVLYGVFST 255
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   349 SKPDsaepMDRSAMCAFPIKYVNDFFnkivnknnvrclqhfygpnhehcFNRTLLRNSSgcearrdeyrtefttalqrvd 428
Cdd:pfam01403  256 GSNS----FPGSAVCAFSLADINAVF-----------------------LVRRGVRLTQ--------------------- 287
                          410       420       430       440       450       460
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 188595716   429 lfmgqfsevlLTSISTFIKGDLTIANLGTSEGRFMQVVVSRS-GPSTPHVNFLL--DSHPVSPEVI 491
Cdd:pfam01403  288 ----------VAVDRVQAGGGYTVLFLGTDSGTLLKVVVLGSaVELHIIEEIQVfkSPQPVLNLLL 343
IPT_plexin_repeat1 cd01180
First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are ...
563-656 1.39e-32

First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


Pssm-ID: 238585  Cd Length: 94  Bit Score: 121.65  E-value: 1.39e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  563 PAIYKVFPNSAPLEGGTRLTICGWDFGFRRNnkfdLKKTRVLLGNESCTLTLSE-STMNTLKCTVGPAMNKHFNMSIIIS 641
Cdd:cd01180     1 PVITEFFPLSGPLEGGTRLTICGSNLGLRKN----DVRHGVRVGGVPCNPEPPEySSSEKIVCTTGPAGNPVFNGPVEVT 76
                          90
                  ....*....|....*...
gi 188595716  642 NGHG---TTQYSTFSYVD 656
Cdd:cd01180    77 VGHGsfrTESSEGFSFVD 94
IPT_plexin_repeat2 cd01179
Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are ...
657-740 6.93e-32

Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


Pssm-ID: 238584  Cd Length: 85  Bit Score: 119.25  E-value: 6.93e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  657 PVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRE-TSI 735
Cdd:cd01179     1 PSITSLSPSYGPQSGGTRLTITGKHLNAGSSVRVTVGGQPCKILSVSSSQIVCLTPPSASPGEAPVKVLIDGARRLaPLV 80

                  ....*
gi 188595716  736 FSYRE 740
Cdd:cd01179    81 FTYTE 85
IPT_plexin_repeat3 cd01181
Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are ...
742-855 4.74e-24

Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


Pssm-ID: 238586  Cd Length: 99  Bit Score: 97.49  E-value: 4.74e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  742 PIVYEIHPTKSFIStwwkeplnivsflfcfasGGSTITGVGKNLNSVSVPRMVINVHEagrNFTVACQHRsNSEIICCTT 821
Cdd:cd01181     1 PTITRIEPEWSFLS------------------GGTPITVTGTNLNTVQEPRIRVKYGG---VEKTSCKVR-NSTLMTCPA 58
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 188595716  822 PS-LQQLNLQLPLKTKAFFMLDGI------LSKYFDLIYVH 855
Cdd:cd01181    59 PSlALLNRSPEPGERPVEFGLDGDnvqsllILNRTSFSYYP 99
SPS1 COG0515
Serine/threonine protein kinase [Signal transduction mechanisms];
1100-1355 1.69e-22

Serine/threonine protein kinase [Signal transduction mechanisms];


Pssm-ID: 223589 [Multi-domain]  Cd Length: 384  Bit Score: 101.36  E-value: 1.69e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1100 EVIGRGHFGCVYHGTlldndgKKIHCAVKSLNR--ITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPY 1177
Cdd:COG0515     6 RKLGEGSFGEVYLAR------DRKLVALKVLAKklESKSKEVERFLREIQILASLNHPPNIVKLYDFFQDEGSLYLVMEY 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1178 MKHGDLRNFIRNETHNP--TVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEK-FTVKVADFGLARdMYDKEYYS 1254
Cdd:COG0515    80 VDGGSLEDLLKKIGRKGplSESEALFILAQILSALEYLHSKGIIHRDIKPENILLDRDgRVVKLIDFGLAK-LLPDPGST 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1255 VHNKTGAKLPVK---WMALESLQ---TQKFTTKSDVWSFGVLLWELMTrGAPPYPDVNTFDITVYLLQGRRLLQPEYCPD 1328
Cdd:COG0515   159 SSIPALPSTSVGtpgYMAPEVLLglsLAYASSSSDIWSLGITLYELLT-GLPPFEGEKNSSATSQTLKIILELPTPSLAS 237
                         250       260
                  ....*....|....*....|....*..
gi 188595716 1329 PLYevmlkcWHPKAEMRPSFSELVSRI 1355
Cdd:COG0515   238 PLS------PSNPELISKAASDLLKKL 258
IPT smart00429
ig-like, plexins, transcription factors;
656-739 4.14e-18

ig-like, plexins, transcription factors;


Pssm-ID: 214657  Cd Length: 90  Bit Score: 80.16  E-value: 4.14e-18
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    656 DPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISI--GGKTCTLKSVSNSILECYTPAQTI--STEFAVKLKIDLANR 731
Cdd:smart00429    1 DPVITRISPTSGPVSGGTEITLCGKNLKSISVVFVEVgvGEAPCTFSPSSSTAIVCKTPPYHNipGSVPVRTVGLRNGGV 80
                            90
                    ....*....|
gi 188595716    732 ETS--IFSYR 739
Cdd:smart00429   81 PSSpqPFTYV 90
TIG pfam01833
IPT/TIG domain; This family consists of a domain that has an immunoglobulin like fold. These ...
563-654 1.21e-16

IPT/TIG domain; This family consists of a domain that has an immunoglobulin like fold. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. CAUTION: This family does not currently recognize a significant number of members.


Pssm-ID: 307788  Cd Length: 85  Bit Score: 75.97  E-value: 1.21e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   563 PAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNkfdlkkTRVLLGNESCTLTLSeSTMNTLKCTVGPAMNKHFNMSIIISN 642
Cdd:pfam01833    1 PVITSISPSSGPASGGTTITITGSNFGTDSSD------TKVTIGGTPCTVIAS-VSSTTIVCTTPPGTSGLVNVSVTVGG 73
                           90
                   ....*....|..
gi 188595716   643 GHGTTQYSTFSY 654
Cdd:pfam01833   74 GGLSSSNLTFTY 85
PTZ00024 PTZ00024
cyclin-dependent protein kinase; Provisional
1102-1309 2.73e-16

cyclin-dependent protein kinase; Provisional


Pssm-ID: 240233 [Multi-domain]  Cd Length: 335  Bit Score: 81.73  E-value: 2.73e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1102 IGRGHFGCVYHGtlLDNDGKKIhCAVKSLNRI---TDIGEVSQFLTE-GI---------IMKDFSHPNVLSLLGICLrSE 1168
Cdd:PTZ00024   17 LGEGTYGKVEKA--YDTLTGKI-VAIKKVKIIeisNDVTKDRQLVGMcGIhfttlrelkIMNEIKHENIMGLVDVYV-EG 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716 1169 GSPLVVLPYMkHGDLRNFIRNETH--NPTVKDLIgfgLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLAR- 1245
Cdd:PTZ00024   93 DFINLVMDIM-ASDLKKVVDRKIRltESQVKCIL---LQILNGLNVLHKWYFMHRDLSPANIFINSKGICKIADFGLARr 168
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 188595716 1246 ---DMY-----DKEYYSVHNKTGAKLPVKWM-ALESLQ-TQKFTTKSDVWSFGVLLWELMTrGAPPYPDVNTFD 1309
Cdd:PTZ00024  169 ygyPPYsdtlsKDETMQRREEMTSKVVTLWYrAPELLMgAEKYHFAVDMWSVGCIFAELLT-GKPLFPGENEID 241
IPT smart00429
ig-like, plexins, transcription factors;
562-655 1.74e-14

ig-like, plexins, transcription factors;


Pssm-ID: 214657  Cd Length: 90  Bit Score: 70.14  E-value: 1.74e-14
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    562 LPAIYKVFPNSAPLEGGTRLTICGWDFgfrrnNKFDLKKTRVLLGNESCTLTLSESTmnTLKCTVGPAMNKHFNMSII-- 639
Cdd:smart00429    1 DPVITRISPTSGPVSGGTEITLCGKNL-----KSISVVFVEVGVGEAPCTFSPSSST--AIVCKTPPYHNIPGSVPVRtv 73
                            90
                    ....*....|....*..
gi 188595716    640 -ISNGHGTTQYSTFSYV 655
Cdd:smart00429   74 gLRNGGVPSSPQPFTYV 90
TIG pfam01833
IPT/TIG domain; This family consists of a domain that has an immunoglobulin like fold. These ...
657-738 5.39e-12

IPT/TIG domain; This family consists of a domain that has an immunoglobulin like fold. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. CAUTION: This family does not currently recognize a significant number of members.


Pssm-ID: 307788  Cd Length: 85  Bit Score: 62.87  E-value: 5.39e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   657 PVITSISPKYGPMAGGTLLTLTGNYLNSGNSR-HISIGGKTCT-LKSVSNSILECYTPAQTISTeFAVKLKIDLANRETS 734
Cdd:pfam01833    1 PVITSISPSSGPASGGTTITITGSNFGTDSSDtKVTIGGTPCTvIASVSSTTIVCTTPPGTSGL-VNVSVTVGGGGLSSS 79

                   ....*.
gi 188595716   735 I--FSY 738
Cdd:pfam01833   80 NltFTY 85
IPT smart00429
ig-like, plexins, transcription factors;
741-854 1.75e-11

ig-like, plexins, transcription factors;


Pssm-ID: 214657  Cd Length: 90  Bit Score: 61.28  E-value: 1.75e-11
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    741 DPIVYEIHPTKSFIStwwkeplnivsflfcfasGGSTITGVGKNLNSVSVPRMVINVHEagrnftVAC--QHRSNSEIIC 818
Cdd:smart00429    1 DPVITRISPTSGPVS------------------GGTEITLCGKNLKSISVVFVEVGVGE------APCtfSPSSSTAIVC 56
                            90       100       110
                    ....*....|....*....|....*....|....*.
gi 188595716    819 CTTPSLQQLNLQLPlkTKAFFMLDGILSKYFDLIYV 854
Cdd:smart00429   57 KTPPYHNIPGSVPV--RTVGLRNGGVPSSPQPFTYV 90
PSI smart00423
domain found in Plexins, Semaphorins and Integrins;
519-561 7.32e-09

domain found in Plexins, Semaphorins and Integrins;


Pssm-ID: 214655  Cd Length: 47  Bit Score: 52.55  E-value: 7.32e-09
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|....*..
gi 188595716    519 GCRHFQSCSQCLSAPPFvQCGWC--HDKCVRSEECLSG--TWTQQIC 561
Cdd:smart00423    1 RCSKYTSCSECLLARDP-YCAWCssQGRCTSGERCDSRrqNWLSGGC 46
PSI pfam01437
Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The ...
519-555 9.72e-08

Plexin repeat; A cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found Plexin. Two copies of the repeat are found in mahogany protein. A related C. elegans protein contains four copies of the repeat. The Met receptor contains a single copy of the repeat. The Pfam alignment shows 6 conserved cysteine residues that may form three conserved disulphide bridges, whereas shows 8 conserved cysteines. The pattern of conservation suggests that cysteines 5 and 7 (that are not absolutely conserved) form a disulphide bridge (Personal observation. A Bateman).


Pssm-ID: 334539  Cd Length: 46  Bit Score: 49.53  E-value: 9.72e-08
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 188595716   519 GCRHFQSCSQCLSAPPfvQCGWCHD--KCVRSEECLSGT 555
Cdd:pfam01437    1 NCSQYTSCSSCLASDP--YCGWCSSegRCTRRSACPGAP 37
IPT smart00429
ig-like, plexins, transcription factors;
856-952 2.42e-05

ig-like, plexins, transcription factors;


Pssm-ID: 214657  Cd Length: 90  Bit Score: 43.95  E-value: 2.42e-05
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716    856 NPVFKPFEKPVMISMGNENVLeIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNdLLKLNSELNIEwkqaISS 935
Cdd:smart00429    1 DPVITRISPTSGPVSGGTEIT-LCGKNLKSISVVFVEVGVGEAPCTFSPSSSTAIVCKTPP-YHNIPGSVPVR----TVG 74
                            90
                    ....*....|....*..
gi 188595716    936 TVLGKVIVQPdQNFTGL 952
Cdd:smart00429   75 LRNGGVPSSP-QPFTYV 90
IPT_PCSR cd00603
IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins . This subgroup ...
857-950 4.01e-05

IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins . This subgroup contains IPT domains of plexins, receptors, like the plasminogen-related growth factor receptors, the hepatocyte growth factor-scatter factors, and the macrophage-stimulating receptors and of fibrocystin. Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT_PCSR domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.


Pssm-ID: 238337  Cd Length: 90  Bit Score: 43.21  E-value: 4.01e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  857 PVFKPFEkPVMISMGNENVLEIKGNDIDPEAVKGEVlKVGNKSCENIHLHSEAVLCTVP--NDLLKLNSELNIEWKQais 934
Cdd:cd00603     1 PVITSIS-PSSGPLSGGTRLTITGSNLGSGSPRVRV-TVGGVPCKVLNVSSTEIVCRTPaaATPGEGPVEVTVDGAN--- 75
                          90
                  ....*....|....*.
gi 188595716  935 stvlGKVIVQPDQNFT 950
Cdd:cd00603    76 ----VSARVLSNTTFT 87
 
Name Accession Description Interval E-value
Sema_MET cd11278
The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor ...
25-516 0e+00

The Sema domain, a protein interacting module, of MET (also called hepatocyte growth factor receptor, HGFR); MET is encoded by the c-met protooncogene. MET is a receptor tyrosine kinase that binds its ligand, hepatocyte growth factor/scatter factor (HGF/SF). HGF/SF and MET are essential for the development of several tissues and organs, including the placenta, liver, and several groups of skeletal muscles. It also plays a major role in the abnormal migration of cancer cells as a result of overexpression or MET mutations. MET is composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a Sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic tyrosine kinase domain. The cytoplasmic C-terminal region acts as a docking site for multiple protein substrates, including Grb2, Gab1, STAT3, Shc, SHIP-1 and Src. The Sema domain is located at the N-terminus and contains four disulfide bonds formed by eight conserved cysteine residues. The Sema domain of Met is necessary for receptor dimerization and activation.


Pssm-ID: 200539  Cd Length: 492  Bit Score: 985.51  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   25 ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEeDLQKVAEYKTGPVLEHPDCFPCQDCSSK 104
Cdd:cd11278     1 QCKEAAKKSEMNLNMKYQLPNFTAETPIQNVILHKHHIYVGAVNKIYVLNE-DLQKVSEYKTGPVLEHPDCFPCQDCSDK 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  105 ANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQI-EEPSQCPDCVVSALGAK 183
Cdd:cd11278    80 ANLSNGVWKDNVNMALFVETYYDDQLISCGSVNRGTCQRHVFPHDHPADIQSEVHCIYSPQIeEEPDQCPDCVVSTLGSK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  184 VLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLT 263
Cdd:cd11278   160 VLVTVKDRFVNFFVGNTINSSYFPDHPLHSISVRRLKETQDGFEFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFVYFLT 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  264 VQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILF 343
Cdd:cd11278   240 VQRESLDSQTFHTRIIRFCSIDSELRSYMEMPLECIFTEKRRKRSTKKEVFNILQAAYVSKPGAQLAREMGASLNDDILF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  344 GVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTA 423
Cdd:cd11278   320 GVFAQSKPDSAEPMNRSAVCAVSIKTINEFFNKIVDKQNVKCLQHFYGKNHEHCFNRTFLRNASYCEARRDEYRVEVTTA 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  424 LQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 503
Cdd:cd11278   400 LQRVDLFMGQFSNVLLTSISVFTKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTL 479
                         490
                  ....*....|...
gi 188595716  504 VITGKKITKIPLN 516
Cdd:cd11278   480 VITGKKITKIPLN 492
Sema_MET_like cd11248
The Sema domain, a protein interacting module, of MET and RON receptor tyrosine kinases; This ...
43-516 0e+00

The Sema domain, a protein interacting module, of MET and RON receptor tyrosine kinases; This family includes MET and RON receptor tyrosine kinases. MET is encoded by the c-met protooncogene. MET is the receptor for hepatocyte growth factor/scatter factor (HGF/SF). HGF/SF and MET regulates multiple cellular events and are essential for the development of several tissues and organs, including the placenta, liver, and several groups of skeletal muscles. RON receptor tyrosine kinase is a Macrophage-stimulating protein (MSP) receptor. Upon binding of MSP, RON is activated via autophosphorylation within its kinase catalytic domain, resulting in a variety of effects including proliferation, tubular morphogenesis, angiogenesis, cellular motility and invasiveness. By interacting with downstream signaling molecules, it regulates macrophage migration, phagocytosis, and nitric oxide production. MET and RON receptors have been implicated in cancer development and migration. They are composed of alpha-beta heterodimers. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a Sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic tyrosine kinase domain. The Sema domain is necessary for receptor dimerization and activation.


Pssm-ID: 200509  Cd Length: 467  Bit Score: 748.48  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716   43 LPNFTAETPIQNVILHEHH--IFLGATNYIYVLNEeDLQKVAEYKTGPVLEhPDCFPCQDCSSKANlsGGVWKDNINMAL 120
Cdd:cd11248     1 LPFFTADTPIQNIVLNEGSteVYVAAQNVIYALNP-DLQKVWEYKTGPVGS-PDCQTCQDCSSGAD--PGVPKDTDNMVL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  121 VVDTYYDDQLISCGSVNRGTCQRHVFPHNhtADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNT 200
Cdd:cd11248    77 VLETYYDDYLYSCGSTQNGVCYRHVLEDG--ADIQSEVHCLFSKKNNSPSYCPDCVASPLGTKVTNVESGRTIYFFVANS 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  201 INSSYFPDHPLHSISVRRLKEtkDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETL--DAQTFHTRI 278
Cdd:cd11248   155 VNSSLAGSFPPHSISVRRLKE--DGFGFLSDQSYLDVLPSLRDSYPIKYVYSFHSGPFVYFLTVQRESLtkPSSAFHTRL 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  279 IRFCSINSGLHSYMEMPLECILTEKRKKRSTK-KEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPM 357
Cdd:cd11248   233 VRLCSSDSEIWRYREMPLECIFTPKRRRRSTEeDVVYNVLQAAHVSKVGADLADELGASEGDDILFGVFARSKPDSGEPM 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188595716  358 DRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEV 437
Cdd:cd11248   313 PNSALCAFPIKYVNDAIEKGVEKCCTSGLEHFSGSLCHFQPCPTCPGESSSCEATCKEYRTEVTKPYQRVDLFNGQMSNV 392
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 188595716  438 LLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPsTPHVNFLLDSHPVSPEVIVEHtlnQNGYTLVITGKKITKIPLN 516
Cdd:cd11248   393 LLTSILVTTIGNHTVAHLGTSDGRVLQVVLSRSGP-IPHVNFSLDSQPVSREVAVLS---SNGSLLFVTGDKITKVPLI 467
PTKc_Met_Ron cd05058
Catalytic domain of the