NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|110224452|ref|NP_001035959.1|]
View 

solute carrier family 12 member 6 isoform c [Homo sapiens]

Protein Classification

2a30 family protein (domain architecture ID 11489985)

2a30 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


:

Pssm-ID: 273347  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


Pssm-ID: 273347  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
AA_permease pfam00324
Amino acid permease;
131-701 6.99e-48

Amino acid permease;


Pssm-ID: 278739  Cd Length: 467  Bit Score: 179.82  E-value: 6.99e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   131 GVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVG 210
Cdd:pfam00324    1 HVQMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLSLGEISTNGPV-SGGFYTYASRFLGPSLGFATG 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   211 L--CFYLGTTFAAAmyiLGAIEIFLVYIVPRAAIfhsddalkesaamlNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:pfam00324   80 WnyWLSWITVLALE---LTAASILIQFWELVPDI--------------PYLWVWGAVFLVLLTIINLVGVKWYGEAEFWF 142
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAI--KSSFAPPHFPVcmlgnrtlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdEYFV 366
Cdd:pfam00324  143 ALIKIIAIIGFIIVGIilLSGGNPNDGAI-----------------------------------------------FRYL 175
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   367 HNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheYVLVdittsftllvgIFFPSVTGIMAGSNR 446
Cdd:pfam00324  176 GDNGGKNNFPPGFGGGFI--------------------------------SVFV-----------IAFFAFTGIELVGIA 212
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   447 SGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEG--VVLRDKFGDAVKGNLVVGTLSWPS--PWVIVIGSFFSTC 522
Cdd:pfam00324  213 AGEVKNPEKSIPKAILQVIWRITIFYILSLLAIGLLVPWndPGLLNDSASAASPFVIFFKFLGISglAPLINAVILTAAL 292
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   523 GAGLQSLTGAPRLLQAIAKDNIIPFlrVFGHSKANGEPTWALLLTAAIAELGILIASLdlVAPILSMFFLMCYLFVNLAC 602
Cdd:pfam00324  293 SAANSSLYSGSRMLYSLARDGLAPK--FLKKVDKRGVPLRAILVSMVISLLALLLASL--NPAIVFNFLLAISGLSGLIV 368
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   603 ALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFA 682
Cdd:pfam00324  369 WGLISLSHLRFRKAFKYQGRSIDELPFKAPLGPLGVILGLAAIIIILIIQFLYAFLPVPGGPKNWGAGSFAAAYLIVLLF 448
                          570
                   ....*....|....*....
gi 110224452   683 LLRLEEGPPHTKNWRPQLL 701
Cdd:pfam00324  449 LIILIGVKLHVKNWKPQLL 467
PotE COG0531
Amino acid transporter [Amino acid transport and metabolism];
113-668 3.57e-24

Amino acid transporter [Amino acid transport and metabolism];


Pssm-ID: 223605  Cd Length: 466  Bit Score: 107.17  E-value: 3.57e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  113 ITEGKKKPTKTPQMGTFMGVYLPCLQNIFGV-ILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNgvvpAG 191
Cdd:COG0531     1 SSNSMMSSELKKKLGLFDLLTALGVGSMIGSgIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSAIPS----AG 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  192 GSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIeIFLVYIVPRAAIFHSDDALKESAAmlnnmrvygtafLVLMV 271
Cdd:COG0531    77 GAYAYAKRALGPRLGFLAGWLYLLAYVIALAAIAIGAA-SYLSYLFPGPGLLSIGPLLIILIA------------LALIA 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  272 LVVFIGVRYVNKFASLFLACVIVSILAIYAGAIkssFAPPHFPvcmlgnrtlssrhidvcsktkeinnmtvpsklwgffc 351
Cdd:COG0531   144 LLTLLNLRGIKASAKINSIITILKIIILLIFII---LGLFAFG------------------------------------- 183
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  352 nssqffnatcdeyFVHNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVG 431
Cdd:COG0531   184 -------------FSNGNLFAPFNPGGGSFGGI-----------------------------------------LAAILL 209
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  432 IFFpSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSp 510
Cdd:COG0531   210 AFF-AFTGFEAIATLAEEVKNPKRTIPRAIILSLLIVLILYiLGALVIVGVLPAGDLAASAPSAPLALAALFGGGNWGA- 287
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  511 WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGH-SKANGEPTWALLLTAAIAELGILIASL-----DLVA 584
Cdd:COG0531   288 IIIAILALLSLFGSLLAWILAVSRVLYAMARDGLLP--KFFAKvNPKGRTPVIALILTGIISLILLLLFPLssiafNALV 365
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  585 PILSMFFLMCYLFVNLA---CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAI--VAMVIAGMIYKYIE 659
Cdd:COG0531   366 SLASVAFLIAYLLVALAllvLRRKKPDLKRPFRLPLAPLIPILGIVAVLLLLYALYASGLPPLLlgVILIAGGIIIYLLV 445

                  ....*....
gi 110224452  660 YQGAEKEWG 668
Cdd:COG0531   446 YLGLGRLLS 454
frlA PRK11357
putative fructoselysine transporter; Provisional
436-654 4.10e-04

putative fructoselysine transporter; Provisional


Pssm-ID: 183096  Cd Length: 445  Bit Score: 44.08  E-value: 4.10e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFG--DAVKGNL---------VVGT 504
Cdd:PRK11357  207 SYTGMASICYMTGEIKNPGKTMPRALIGSCLLVLVLY----TLLALVISGLMPFDKLAnsETPISDAltwipalgsTAGI 282
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  505 LSWPSPWVIVIGSfFSTCgaglqsLTGAPRLLQAIAKDNIipFLRVFGHSKANGE-PTWALLLTAAIAELGILIASLdlv 583
Cdd:PRK11357  283 FVAITAMIVILGS-LSSC------VMYQPRLEYAMAKDNL--FFKCFGHVHPKYNtPDVSIILQGALGIFFIFVSDL--- 350
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  584 APILSMF-FLMCYLFVNLACALQTLLRTPNWRPRFRYYHWAL-SFMGMSICLALMFiSSWYYAIVAMVIAGMI 654
Cdd:PRK11357  351 TSLLGYFtLVMCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLmTTLAIASSLILVA-STFVWAPIPGLICAVI 422
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other]
50-1091 0e+00

K-Cl cotransporter; [Transport and binding proteins, Other]


Pssm-ID: 273347  Cd Length: 953  Bit Score: 1355.54  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452    50 HKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKP-TKTPQMGT 128
Cdd:TIGR00930    1 NTVDAVPRIEHYRNSEGQGGPKRNRPSLEELHDLLDKVVSLLGPLADYTNNGQGMKEHEEAEDAEGTKEKPpAGAVKFGW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   129 FMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGA 208
Cdd:TIGR00930   81 VMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSLGPEFGGS 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   209 VGLCFYLGTTFAAAMYILGAIEIFLvyivpraAIFHSDdALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:TIGR00930  161 IGLIFAFANAVAVAMYVVGFAETVL-------DLLREN-GSKIMVDPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLF 232
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdeyFVHN 368
Cdd:TIGR00930  233 LVIVLLSILNIFVGTIIPAFDKPAKGFFGLGNEI------------------------------------------FSEN 270
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   369 NvtsIQGIPGLASGiitenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVGIFFPSVTGIMAGSNRSG 448
Cdd:TIGR00930  271 F---IPGIPGPEGG-------------------------------------------FFSLFGIFFPSVTGILAGANISG 304
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   449 DLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVK---------------------GNLVVGTLSW 507
Cdd:TIGR00930  305 DLKDPQKAIPKGTLLAILTTTVVYLGSVVLFGACVVRDATGDKNDTLVTnctsaacfsecahntcsyglmNNLQVMSLVS 384
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   508 PSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKA-NGEPTWALLLTAAIAELGILIASLDLVAPI 586
Cdd:TIGR00930  385 PFPPLITAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGkNGEPLRAYLLTAFIAEGFILIAELNTIAPI 464
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   587 LSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKE 666
Cdd:TIGR00930  465 ISNFFLASYALINFSCFHASLLRSPGWRPRFKYYHWWLSLLGASLCCAIMFLISWWAALVAMVIALFLYKYVTYKKPDVN 544
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   667 WGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDedlhVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYG 746
Cdd:TIGR00930  545 WGSSTQALSYSLALYSLLRLEEVEDHVKNWRPQCLVLTGPP----VCRPALLDFASQFTKGKGLMICGSVIQGPRLECVK 620
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   747 EALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEdARAWKTFIGTVRVTTA 826
Cdd:TIGR00930  621 EAQAAEAKIQTWLEKNKVKAFYAVVVADDLREGVRHLIQASGLGRMKPNTLVMGYKKDWRQAE-PRAWETYIGIIHDAFD 699
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   827 AHLALLVAKNISFFPSNV--------------------------------------EQFSEGNIDVWWIVHDGGMLMLLP 868
Cdd:TIGR00930  700 AHLAVVVVRNSEGLPISVlqvqeelendcsedsielndgkistqpdmhleastqfqKKQGKGTIDVWWLVDDGGLTLLLP 779
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   869 FLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMhdsDISAytYERTLMMEQRSQMLRHMRLS 948
Cdd:TIGR00930  780 YLLTTKKVWKKCKIRIFVGAQKDDRSEQEKKDMATLLYKFRIDAEVIVVLM---DINA--KPQTESMEAFEEMIRPFRLH 854
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   949 KTERDREAqlvKDRnsmlrltsigsdedeetetyqekvHMTWTKDKYMASrgqkaksmegfQDLlnmrpdQSNVRRMHTA 1028
Cdd:TIGR00930  855 KTEKDREA---KDP------------------------KMTWTKPWKITD-----------AEL------QSNVRKSYRQ 890
                         1050      1060      1070      1080      1090      1100
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  1029 VKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS 1091
Cdd:TIGR00930  891 VRLNELLLEYSRDAALVVLSLPVPRKGSIPDELYMAWLEVLSEDLPPVLLVRGNHRNVLTFYS 953
AA_permease pfam00324
Amino acid permease;
131-701 6.99e-48

Amino acid permease;


Pssm-ID: 278739  Cd Length: 467  Bit Score: 179.82  E-value: 6.99e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   131 GVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVG 210
Cdd:pfam00324    1 HVQMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLSLGEISTNGPV-SGGFYTYASRFLGPSLGFATG 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   211 L--CFYLGTTFAAAmyiLGAIEIFLVYIVPRAAIfhsddalkesaamlNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLF 288
Cdd:pfam00324   80 WnyWLSWITVLALE---LTAASILIQFWELVPDI--------------PYLWVWGAVFLVLLTIINLVGVKWYGEAEFWF 142
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   289 LACVIVSILAIYAGAI--KSSFAPPHFPVcmlgnrtlssrhidvcsktkeinnmtvpsklwgffcnssqffnatcdEYFV 366
Cdd:pfam00324  143 ALIKIIAIIGFIIVGIilLSGGNPNDGAI-----------------------------------------------FRYL 175
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   367 HNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheYVLVdittsftllvgIFFPSVTGIMAGSNR 446
Cdd:pfam00324  176 GDNGGKNNFPPGFGGGFI--------------------------------SVFV-----------IAFFAFTGIELVGIA 212
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   447 SGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEG--VVLRDKFGDAVKGNLVVGTLSWPS--PWVIVIGSFFSTC 522
Cdd:pfam00324  213 AGEVKNPEKSIPKAILQVIWRITIFYILSLLAIGLLVPWndPGLLNDSASAASPFVIFFKFLGISglAPLINAVILTAAL 292
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   523 GAGLQSLTGAPRLLQAIAKDNIIPFlrVFGHSKANGEPTWALLLTAAIAELGILIASLdlVAPILSMFFLMCYLFVNLAC 602
Cdd:pfam00324  293 SAANSSLYSGSRMLYSLARDGLAPK--FLKKVDKRGVPLRAILVSMVISLLALLLASL--NPAIVFNFLLAISGLSGLIV 368
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   603 ALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFA 682
Cdd:pfam00324  369 WGLISLSHLRFRKAFKYQGRSIDELPFKAPLGPLGVILGLAAIIIILIIQFLYAFLPVPGGPKNWGAGSFAAAYLIVLLF 448
                          570
                   ....*....|....*....
gi 110224452   683 LLRLEEGPPHTKNWRPQLL 701
Cdd:pfam00324  449 LIILIGVKLHVKNWKPQLL 467
SLC12 pfam03522
Solute carrier family 12;
715-1091 2.28e-42

Solute carrier family 12;


Pssm-ID: 308888  Cd Length: 356  Bit Score: 160.82  E-value: 2.28e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   715 PRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAaeQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKH 794
Cdd:pfam03522    2 PALVDFAHLITKNVSLMICGHVVPGRLSYRLRSELM--KKAYKWLRKRKIKAFYSVVDGDNLREGAQALLQASGLGKLKP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   795 NTVVMGWPNGWRQSeDARAWKTFIGTVRVTTAAHLALLV-----------------------AKNISF-----------F 840
Cdd:pfam03522   80 NILLMGYKSDWRTC-DKEELEDYFNIIHDAFDLQYAVAIlrlpegldvsmksseksdklnnkDRSISYrtasgqelpkeV 158
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   841 PSNVEQF----SEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIE-AEVE 915
Cdd:pfam03522  159 LNQITQFqkkqKKGTIDVWWLYDDGGLTLLIPYILTTRKKWSDCKLRVFALANRKDELEEEQRNMASLLSKFRIDySDLT 238
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   916 VVemhdSDISAYTYERTLMMEQrsQMLRHMRLSKTERDREAQLVKdrnsmlrLTsigsdeDEETETYQEKVHmtwtkdky 995
Cdd:pfam03522  239 VI----PDISKKPKKETKKEFD--ELIEPFRLREDSKESESAPWK-------IT------DSELEALKEKTN-------- 291
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   996 masrgqkaksmegfqdlLNMRpdqsnvrrmhtavkLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLER 1075
Cdd:pfam03522  292 -----------------RQLR--------------LRELLLEHSSDANLIVMTLPMPRKGTVSAPLYMAWLETLTRDLPP 340
                          410
                   ....*....|....*.
gi 110224452  1076 VLLVRGGGSEVITIYS 1091
Cdd:pfam03522  341 FLLVRGNQTSVLTFYS 356
PotE COG0531
Amino acid transporter [Amino acid transport and metabolism];
113-668 3.57e-24

Amino acid transporter [Amino acid transport and metabolism];


Pssm-ID: 223605  Cd Length: 466  Bit Score: 107.17  E-value: 3.57e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  113 ITEGKKKPTKTPQMGTFMGVYLPCLQNIFGV-ILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNgvvpAG 191
Cdd:COG0531     1 SSNSMMSSELKKKLGLFDLLTALGVGSMIGSgIFALPGSAAGLAPAAILAWLIAGIIILFLALSYAELSSAIPS----AG 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  192 GSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIeIFLVYIVPRAAIFHSDDALKESAAmlnnmrvygtafLVLMV 271
Cdd:COG0531    77 GAYAYAKRALGPRLGFLAGWLYLLAYVIALAAIAIGAA-SYLSYLFPGPGLLSIGPLLIILIA------------LALIA 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  272 LVVFIGVRYVNKFASLFLACVIVSILAIYAGAIkssFAPPHFPvcmlgnrtlssrhidvcsktkeinnmtvpsklwgffc 351
Cdd:COG0531   144 LLTLLNLRGIKASAKINSIITILKIIILLIFII---LGLFAFG------------------------------------- 183
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  352 nssqffnatcdeyFVHNNVTSIQGIPGLASGIItenlwsnylpkgeiiekpsakssdvlgslnheyvlvdittsFTLLVG 431
Cdd:COG0531   184 -------------FSNGNLFAPFNPGGGSFGGI-----------------------------------------LAAILL 209
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  432 IFFpSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSp 510
Cdd:COG0531   210 AFF-AFTGFEAIATLAEEVKNPKRTIPRAIILSLLIVLILYiLGALVIVGVLPAGDLAASAPSAPLALAALFGGGNWGA- 287
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  511 WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGH-SKANGEPTWALLLTAAIAELGILIASL-----DLVA 584
Cdd:COG0531   288 IIIAILALLSLFGSLLAWILAVSRVLYAMARDGLLP--KFFAKvNPKGRTPVIALILTGIISLILLLLFPLssiafNALV 365
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  585 PILSMFFLMCYLFVNLA---CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAI--VAMVIAGMIYKYIE 659
Cdd:COG0531   366 SLASVAFLIAYLLVALAllvLRRKKPDLKRPFRLPLAPLIPILGIVAVLLLLYALYASGLPPLLlgVILIAGGIIIYLLV 445

                  ....*....
gi 110224452  660 YQGAEKEWG 668
Cdd:COG0531   446 YLGLGRLLS 454
AA_permease_2 pfam13520
Amino acid permease;
414-655 1.80e-14

Amino acid permease;


Pssm-ID: 316078  Cd Length: 423  Bit Score: 76.97  E-value: 1.80e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   414 NHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKdaQKSIPIGTILAILTTSFVY-LSNVVLFGAC-IEGVVLRDK 491
Cdd:pfam13520  178 ETHTFFPSGWPGVFLGFLGVLWSFTGFESAANVSEEVK--NKTVPKAIFIGVAIVGVLYlLVNIAFLGVVpDDEIALLSG 255
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   492 FGD---AVKGNLVVGTLSWpspwVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTA 568
Cdd:pfam13520  256 VLSvaaLLFQAVGGKWGAI----IVVILLALSLFGAVNTAVVGSSRLLYALARDGVLP--RFFAKVNKFGSPIRAIILTA 329
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   569 AIAELGILIASLDLVAPIL---SMFFLMCYLFVNLACALqtLLRTPNWRPRfRYYHWALSFMGMsICLALMFISSWYYAI 645
Cdd:pfam13520  330 ILSLILLLLFLLGSAYNALlslSAYGYLLVYLLLIIGLL--ILRKKRPDLP-RPGRIPVAILGI-LFSLFLLVALFFPPK 405
                          250
                   ....*....|
gi 110224452   646 VAMVIAGMIY 655
Cdd:pfam13520  406 GPATGSSLNY 415
2A0306 TIGR00909
amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]
431-655 6.30e-08

amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 129987  Cd Length: 429  Bit Score: 56.30  E-value: 6.30e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   431 GIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFGDaVKGNLVVGTLSWPSP 510
Cdd:TIGR00909  202 ALVFFAFIGFEAISTAAEEVKNPERDIPKAIILSLIVVTLLY----VLVAAVILGAVPWRQLAG-STAPLSLVGYDLGQG 276
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   511 ---WVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIP--FLRVfgHSKaNGEPTWALLLTAAIAELGILIASLDLVAP 585
Cdd:TIGR00909  277 iggLILTAGAVFSIASVMLAGIYGTSRVLFAMSRDGLLPgsLSKV--HPK-TGTPHMSIIIFSLTAALLASLVPLEGLAE 353
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 110224452   586 ILSMFFLMCYLFVNLACALQTlLRTPNWRPRFRY-YHWALSFMGMSICLALMF---ISSWYYAIVAMVIAGMIY 655
Cdd:TIGR00909  354 LTSIGTLIAFAAVNVAVIILR-RRRPDIQRAFRCpLVPVLPVLVVSYCIYLLLnlgPGTTVWFLVWMLLGSVFY 426
2A0308 TIGR00911
L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and ...
448-647 5.56e-05

L-type amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 273332  Cd Length: 501  Bit Score: 46.66  E-value: 5.56e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   448 GDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPwvIVIGsfFSTCGAGL 526
Cdd:TIGR00911  259 EEVKNPYRTLPIAIIISMPIVTFIYvLTNIAYFTVLSPEELLASLAVAVDFGERLLGVMSWAMP--ALVG--LSCFGSVN 334
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   527 QSLTGAPRLLQAIAKDNIIPFLRVFGHSKANgEPTWALLLTAAIAELGILIASLDLVAPILSMFFlmcYLFVNLACALQT 606
Cdd:TIGR00911  335 GSLFSSSRLFFVGGREGHLPSLLSMIHVKRL-TPLPSLLIVCTLTLLMLFSGDIYSLINLISFAN---WLFNALAVAGLL 410
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|...
gi 110224452   607 LLR--TPNWRPRFRyyhwalsfmgMSICLALMFISSWYYAIVA 647
Cdd:TIGR00911  411 WLRykRPEMNRPIK----------VPLFFPVFFLLSCLFLIIL 443
frlA PRK11357
putative fructoselysine transporter; Provisional
436-654 4.10e-04

putative fructoselysine transporter; Provisional


Pssm-ID: 183096  Cd Length: 445  Bit Score: 44.08  E-value: 4.10e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYlsnvVLFGACIEGVVLRDKFG--DAVKGNL---------VVGT 504
Cdd:PRK11357  207 SYTGMASICYMTGEIKNPGKTMPRALIGSCLLVLVLY----TLLALVISGLMPFDKLAnsETPISDAltwipalgsTAGI 282
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  505 LSWPSPWVIVIGSfFSTCgaglqsLTGAPRLLQAIAKDNIipFLRVFGHSKANGE-PTWALLLTAAIAELGILIASLdlv 583
Cdd:PRK11357  283 FVAITAMIVILGS-LSSC------VMYQPRLEYAMAKDNL--FFKCFGHVHPKYNtPDVSIILQGALGIFFIFVSDL--- 350
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 110224452  584 APILSMF-FLMCYLFVNLACALQTLLRTPNWRPRFRYYHWAL-SFMGMSICLALMFiSSWYYAIVAMVIAGMI 654
Cdd:PRK11357  351 TSLLGYFtLVMCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLmTTLAIASSLILVA-STFVWAPIPGLICAVI 422
2A0302 TIGR00905
transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several ...
420-650 1.76e-03

transporter, basic amino acid/polyamine antiporter (APA) family; This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines]


Pssm-ID: 129983  Cd Length: 473  Bit Score: 41.97  E-value: 1.76e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   420 VDITTSFTLLVGIFFPSVTGIMA----------GSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFG--ACIEGV 486
Cdd:TIGR00905  184 ADFWGHDVPSLGSVFSQVKNTMLvtlwvfigieGAVVSSGRAKNKSDVGKATVLGTLGALVIYiLITLLSLGvlPQQELA 263
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   487 VLRDKFGDAVkGNLVVGTlsWPSPwVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLL 566
Cdd:TIGR00905  264 NLPNPSMAAV-LEMIVGK--WGAV-LISLGLIISVLGSLLSWTMLAAEVPFSAAKDGLFP--KIFGRVNKNGAPSVALLL 337
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452   567 TAAIAELGILIASL-----DLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRyyHWALSFMGMSICLALMFISSW 641
Cdd:TIGR00905  338 TNILIQLFLLLTLLtssayNVLVSLAVVMILVPYLLSAAYLLKLAKVGTYPKIKNRK--ALIVGVIACVYSIWLLYAAGL 415

                   ....*....
gi 110224452   642 YYAIVAMVI 650
Cdd:TIGR00905  416 KYLLLGFIL 424
FUI1 COG1953
Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme ...
150-301 3.93e-03

Cytosine/uracil/thiamine/allantoin permease [Nucleotide transport and metabolism, Coenzyme transport and metabolism];


Pssm-ID: 224864  Cd Length: 497  Bit Score: 40.73  E-value: 3.93e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  150 TWVVGTAGV------LQAFAIVLICCCctmLTAISMSAIATNGVVpAGGSYFMISRALGPEFGGAVGL-------CFYLG 216
Cdd:COG1953    59 TYMLAAGLFelglspWQALLAILVGNL---IVAIFMVLNGHAGSK-YGIPFPVLSRASFGIYGANFPAliraivaIVWYG 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  217 T-TFAAAmyilGAIEIFLVyivpraAIFHSDDALKESAAMLNnMRVYGTA----FLVLMVLVVFIGVRYVNKFASL--FL 289
Cdd:COG1953   135 VqTYAGG----LAVNLLLG------SIFPSLLIPNTLSPLLG-LTTLELIcffiFWVLQLLVLFKGMESIRKFETWagPL 203
                         170
                  ....*....|..
gi 110224452  290 ACVIVSILAIYA 301
Cdd:COG1953   204 VYIAMLGLAIWA 215
LysP COG0833
Amino acid permease [Amino acid transport and metabolism];
447-579 5.80e-03

Amino acid permease [Amino acid transport and metabolism];


Pssm-ID: 223903  Cd Length: 541  Bit Score: 40.30  E-value: 5.80e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  447 SGDLKDAQKSIPI---GTILAILttsFVYLSNVVLFGACIegvvlrdKFGD-AVKGNLVVGTLSwpSPWVIVI------- 515
Cdd:COG0833   257 AGESENPRKSIPKaikQVFWRIL---LFYILSIFVIGLLV-------PYNDpRLLGNSSSGVAA--SPFVIAIknagipv 324
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 110224452  516 -GSFF------STCGAGLQSLTGAPRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTAAIAELGILIAS 579
Cdd:COG0833   325 aASIMnaviltSVLSAANSGLYASSRMLYSLAKQGKAP--KIFAKVDRRGVPLVALLVTLLFGLLAFLNSS 393
PRK10644 PRK10644
arginine:agmatin antiporter; Provisional
436-651 8.21e-03

arginine:agmatin antiporter; Provisional


Pssm-ID: 182613  Cd Length: 445  Bit Score: 39.77  E-value: 8.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  436 SVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVY-LSNVVLFGAcIEGVVLR---DKFGDAVKgnLVVGTLSwpspw 511
Cdd:PRK10644  203 SFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYvLSSTAIMGM-IPNAALRvsaSPFGDAAR--MALGDTA----- 274
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110224452  512 viviGSFFSTCGAG--LQSLTG----APRLLQAIAKDNIIPflRVFGHSKANGEPTWALLLTAAIAELgILIASL----- 580
Cdd:PRK10644  275 ----GAIVSFCAAAgcLGSLGGwtllAGQTAKAAADDGLFP--PIFARVNKAGTPVAGLLIVGVLMTI-FQLSSIspnas 347
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 110224452  581 ---DLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFryyhWALSFMGMSICLALMFISS-----WYYAIVAMVIA 651
Cdd:PRK10644  348 kefGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAY----LAVTLIAFVYCIWAVVGSGakevmWSFVTLMVITA 422
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH