NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|108802613|ref|NP_001035820.1|]
View 

tyrosine-protein phosphatase non-receptor type 20 isoform 6 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Y_phosphatase super family cl27757
Protein-tyrosine phosphatase;
150-188 6.05e-05

Protein-tyrosine phosphatase;


The actual alignment was detected with superfamily member smart00194:

Pssm-ID: 332578  Cd Length: 259  Bit Score: 42.65  E-value: 6.05e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 108802613   150 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPFQH 188
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDH 41
 
Name Accession Description Interval E-value
PTPc smart00194
Protein tyrosine phosphatase, catalytic domain;
150-188 6.05e-05

Protein tyrosine phosphatase, catalytic domain;


Pssm-ID: 214550  Cd Length: 259  Bit Score: 42.65  E-value: 6.05e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 108802613   150 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPFQH 188
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDH 41
 
Name Accession Description Interval E-value
PTPc smart00194
Protein tyrosine phosphatase, catalytic domain;
150-188 6.05e-05

Protein tyrosine phosphatase, catalytic domain;


Pssm-ID: 214550  Cd Length: 259  Bit Score: 42.65  E-value: 6.05e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 108802613   150 IMQEFMAL-ELKNLPGEFNSGNQPSNREKNRYRDILPFQH 188
Cdd:smart00194   2 LEEEFEKLdRLKPDDESCTVAAFPENRDKNRYKDVLPYDH 41
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH