NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|63025214|ref|NP_001017980.1|]
View 

vacuolar ATPase assembly integral membrane protein VMA21 isoform 1 [Homo sapiens]

Protein Classification

VMA21 domain-containing protein (domain architecture ID 10559582)

VMA21 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
VMA21 pfam09446
VMA21-like domain; This presumed short domain appears to contain two potential transmembrane ...
25-88 2.59e-12

VMA21-like domain; This presumed short domain appears to contain two potential transmembrane helices. VMA21 is localized in the ER where it is needed as an accessory factor for assembly of the V0 component of the vacuolar ATPase.


:

Pssm-ID: 312820  Cd Length: 64  Bit Score: 58.31  E-value: 2.59e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 63025214    25 STLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAW 88
Cdd:pfam09446   1 SVFKKLLIFSLLMVTLPIAIFFGFKHFLFEGVFGLSSSDSTLYSGILAVIVVNVVLALYIYRAY 64
 
Name Accession Description Interval E-value
VMA21 pfam09446
VMA21-like domain; This presumed short domain appears to contain two potential transmembrane ...
25-88 2.59e-12

VMA21-like domain; This presumed short domain appears to contain two potential transmembrane helices. VMA21 is localized in the ER where it is needed as an accessory factor for assembly of the V0 component of the vacuolar ATPase.


Pssm-ID: 312820  Cd Length: 64  Bit Score: 58.31  E-value: 2.59e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 63025214    25 STLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAW 88
Cdd:pfam09446   1 SVFKKLLIFSLLMVTLPIAIFFGFKHFLFEGVFGLSSSDSTLYSGILAVIVVNVVLALYIYRAY 64
 
Name Accession Description Interval E-value
VMA21 pfam09446
VMA21-like domain; This presumed short domain appears to contain two potential transmembrane ...
25-88 2.59e-12

VMA21-like domain; This presumed short domain appears to contain two potential transmembrane helices. VMA21 is localized in the ER where it is needed as an accessory factor for assembly of the V0 component of the vacuolar ATPase.


Pssm-ID: 312820  Cd Length: 64  Bit Score: 58.31  E-value: 2.59e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 63025214    25 STLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAW 88
Cdd:pfam09446   1 SVFKKLLIFSLLMVTLPIAIFFGFKHFLFEGVFGLSSSDSTLYSGILAVIVVNVVLALYIYRAY 64
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH