NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|54873644|ref|NP_001006669.1|]
View 

potassium voltage-gated channel subfamily KQT member 2 isoform 4 [Mus musculus]

Protein Classification

Ion_trans and KCNQ_channel domain-containing protein (domain architecture ID 11999097)

protein containing domains Ion_trans, KCNQ_channel, and KCNQ2_u3

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
KCNQ_channel pfam03520
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
426-648 3.25e-112

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


:

Pssm-ID: 308886  Cd Length: 189  Bit Score: 341.37  E-value: 3.25e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   426 SPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDnKSCNCEFVTEDLTPGLKVSIRAVC 505
Cdd:pfam03520   1 SPGAEDSAEASPSKVQKSWSFNDRTRFRTSLRLKGSASRQSSEEASGPGEEVGEE-KGCHCDFLTEDLIPALKTVIRAVR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   506 VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRHKKypTKGPTAPsrespqyspr 585
Cdd:pfam03520  80 IMKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQIVGRGPIPTDKKVR--EKGPKRA---------- 147
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 54873644   586 vdqivgrgptitdkdrtkgpaETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP 648
Cdd:pfam03520 148 ---------------------EGEAVEDLSMMGRVVKVEKQVQSMEKKLDFLVDIYSQCLRKG 189
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
92-324 1.76e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 306908  Cd Length: 238  Bit Score: 149.72  E-value: 1.76e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    92 AFIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVI 171
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKRY---------FRSPWNIL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   172 DIMVLIASIAVLAAGSQGNVFatsALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVY 251
Cdd:pfam00520  72 DFVVVLPSLISLVLSSVGSLS---GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGY 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   252 LAEKG----------ENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGR-------LLAATFTLIGVSFFALPAGILGS 314
Cdd:pfam00520 149 QLFGGklktwenpdnGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKgefwayiYFVSFIILGGFLLLNLFIAVIID 228
                         250
                  ....*....|
gi 54873644   315 GFALKVQEQH 324
Cdd:pfam00520 229 NFQELTERTE 238
KCNQ2_u3 pfam16642
Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of ...
663-742 1.55e-32

Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of natively unstructured sequence on potassium voltage-gated channel subfamily KQT member 2 proteins from higher eukaryotes. It lies between families KCNQ_channel, pfam03520, and KCNQC3-Ank_bd, pfam11956. The function is not known.


:

Pssm-ID: 318783  Cd Length: 95  Bit Score: 123.01  E-value: 1.55e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   663 PAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQ----SHQR---HGTSPVGDHGSLVl 735
Cdd:pfam16642   1 PAPPYHSPEDSREHKDKNGCIEKIVRSSSSMGQKNFSAPPAAPASHCPPSTSWQQqlqhPQQRpswNGSSPVGDPGSLV- 79
                          90
                  ....*....|...
gi 54873644   736 RL------ERSAG 742
Cdd:pfam16642  80 RIppppahERSSS 92
 
Name Accession Description Interval E-value
KCNQ_channel pfam03520
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
426-648 3.25e-112

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


Pssm-ID: 308886  Cd Length: 189  Bit Score: 341.37  E-value: 3.25e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   426 SPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDnKSCNCEFVTEDLTPGLKVSIRAVC 505
Cdd:pfam03520   1 SPGAEDSAEASPSKVQKSWSFNDRTRFRTSLRLKGSASRQSSEEASGPGEEVGEE-KGCHCDFLTEDLIPALKTVIRAVR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   506 VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRHKKypTKGPTAPsrespqyspr 585
Cdd:pfam03520  80 IMKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQIVGRGPIPTDKKVR--EKGPKRA---------- 147
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 54873644   586 vdqivgrgptitdkdrtkgpaETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP 648
Cdd:pfam03520 148 ---------------------EGEAVEDLSMMGRVVKVEKQVQSMEKKLDFLVDIYSQCLRKG 189
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
92-324 1.76e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 149.72  E-value: 1.76e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    92 AFIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVI 171
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKRY---------FRSPWNIL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   172 DIMVLIASIAVLAAGSQGNVFatsALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVY 251
Cdd:pfam00520  72 DFVVVLPSLISLVLSSVGSLS---GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGY 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   252 LAEKG----------ENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGR-------LLAATFTLIGVSFFALPAGILGS 314
Cdd:pfam00520 149 QLFGGklktwenpdnGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKgefwayiYFVSFIILGGFLLLNLFIAVIID 228
                         250
                  ....*....|
gi 54873644   315 GFALKVQEQH 324
Cdd:pfam00520 229 NFQELTERTE 238
KCNQ2_u3 pfam16642
Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of ...
663-742 1.55e-32

Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of natively unstructured sequence on potassium voltage-gated channel subfamily KQT member 2 proteins from higher eukaryotes. It lies between families KCNQ_channel, pfam03520, and KCNQC3-Ank_bd, pfam11956. The function is not known.


Pssm-ID: 318783  Cd Length: 95  Bit Score: 123.01  E-value: 1.55e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   663 PAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQ----SHQR---HGTSPVGDHGSLVl 735
Cdd:pfam16642   1 PAPPYHSPEDSREHKDKNGCIEKIVRSSSSMGQKNFSAPPAAPASHCPPSTSWQQqlqhPQQRpswNGSSPVGDPGSLV- 79
                          90
                  ....*....|...
gi 54873644   736 RL------ERSAG 742
Cdd:pfam16642  80 RIppppahERSSS 92
 
Name Accession Description Interval E-value
KCNQ_channel pfam03520
KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type ...
426-648 3.25e-112

KCNQ voltage-gated potassium channel; This family matches to the C-terminal tail of KCNQ type potassium channels.


Pssm-ID: 308886  Cd Length: 189  Bit Score: 341.37  E-value: 3.25e-112
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   426 SPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDnKSCNCEFVTEDLTPGLKVSIRAVC 505
Cdd:pfam03520   1 SPGAEDSAEASPSKVQKSWSFNDRTRFRTSLRLKGSASRQSSEEASGPGEEVGEE-KGCHCDFLTEDLIPALKTVIRAVR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   506 VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRHKKypTKGPTAPsrespqyspr 585
Cdd:pfam03520  80 IMKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQIVGRGPIPTDKKVR--EKGPKRA---------- 147
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 54873644   586 vdqivgrgptitdkdrtkgpaETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIP 648
Cdd:pfam03520 148 ---------------------EGEAVEDLSMMGRVVKVEKQVQSMEKKLDFLVDIYSQCLRKG 189
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
92-324 1.76e-40

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 306908  Cd Length: 238  Bit Score: 149.72  E-value: 1.76e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644    92 AFIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYrgwrgrlkfARKPFCVI 171
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKRY---------FRSPWNIL 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   172 DIMVLIASIAVLAAGSQGNVFatsALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVY 251
Cdd:pfam00520  72 DFVVVLPSLISLVLSSVGSLS---GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGY 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   252 LAEKG----------ENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGR-------LLAATFTLIGVSFFALPAGILGS 314
Cdd:pfam00520 149 QLFGGklktwenpdnGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKgefwayiYFVSFIILGGFLLLNLFIAVIID 228
                         250
                  ....*....|
gi 54873644   315 GFALKVQEQH 324
Cdd:pfam00520 229 NFQELTERTE 238
KCNQ2_u3 pfam16642
Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of ...
663-742 1.55e-32

Unstructured region on Potassium channel subunit alpha KvLQT2; KCNQ2_u3 is a region of natively unstructured sequence on potassium voltage-gated channel subfamily KQT member 2 proteins from higher eukaryotes. It lies between families KCNQ_channel, pfam03520, and KCNQC3-Ank_bd, pfam11956. The function is not known.


Pssm-ID: 318783  Cd Length: 95  Bit Score: 123.01  E-value: 1.55e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54873644   663 PAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQ----SHQR---HGTSPVGDHGSLVl 735
Cdd:pfam16642   1 PAPPYHSPEDSREHKDKNGCIEKIVRSSSSMGQKNFSAPPAAPASHCPPSTSWQQqlqhPQQRpswNGSSPVGDPGSLV- 79
                          90
                  ....*....|...
gi 54873644   736 RL------ERSAG 742
Cdd:pfam16642  80 RIppppahERSSS 92
Ion_trans_2 pfam07885
Ion channel; This family includes the two membrane helix type ion channels found in bacteria.
240-314 1.70e-13

Ion channel; This family includes the two membrane helix type ion channels found in bacteria.


Pssm-ID: 311712  Cd Length: 76  Bit Score: 68.02  E-value: 1.70e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 54873644   240 FLCLILASFLVYLAEKGendhfdTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGS 314
Cdd:pfam07885   4 LLVLIFGTVYYLLEEGW------SFLDALYFSFVTLTTVGYGDIVPVTDAGRLFTIVYILIGIPLFLLFLAVLGR 72
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH