NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|255652944|ref|NP_000262|]
View 

NPC intracellular cholesterol transporter 1 precursor [Homo sapiens]

Protein Classification

2A060601 family protein (domain architecture ID 11489961)

2A060601 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
25-1252 0e+00

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


:

Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 1929.30  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944    25 CVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQELCpGFFFGNVS--LCCDVRQLQTLKDNLQLPLQFLSRCPSCFY 102
Cdd:TIGR00917    1 CAMYDICGARSDGKVLNCPYNIPSVKPPDLLSSLIQSLC-QYSHPTISgnVCCTETQFDTLRSNVQQAIPFIVRCPACLR 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   103 NLLNLFCELTCSPRQSQFLNVTATEDyvdpvtNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDAD 182
Cdd:TIGR00917   80 NFLNLFCELTCSPDQSLFINVTSTTK------VKTNSTVDGIQYYITDDFAAGMYNSCKNVKFGSSNSRALDFLGGGAKN 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   183 ACNATNWIEYMFNKDNGQAPFTITPVFSDFPV-HGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPKPQPPPPPAPWT 261
Cdd:TIGR00917  154 FKEWFNWIGQKAGVNLPGAPYGIAFLPTPCPVsSGMRPMNVSIYSCGDESLGCSCGDCPSAATCSCKAKVPTQKKHSCSI 233
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   262 ILGLDAMYVIMWITYMAFLLVFFG--AFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLF 339
Cdd:TIGR00917  234 KLGVKCVDFILAILYIVLVSVFLGggLLHPVRGKKKTSQMGTLSEADGEINSVNQQKDQNTPQRNWGQLSTVQGHLARFF 313
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   340 TRWGSFCVRNPGCVIFFSLVFITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHi 419
Cdd:TIGR00917  314 GKYGIWVARHPTLVICLSVSVVLLLCVGLIRFKVETRPVKLWVAPGSRAALEKQYFDTHFGPFYRIEQLIIATVQTSSH- 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   420 yqpypsgadVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNtnCTILSVLNYFQNSHSVLDHKK 499
Cdd:TIGR00917  393 ---------EKAPEILTDDNLKLLFDIQKKVSQLFANYEGELITLDSPCFKPNHPYN--CFIYSTCKKLQNMYSKLKPEN 461
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   500 GDDFFVyADYHTHFLYCVRAPaslndtsllhDPCLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQR 579
Cdd:TIGR00917  462 YDDYGG-VDYVKYCFEHFTSP----------ESCLSAFGGPVDPTTVLGGFSGNNFSEASAFVVTFPVNNFVNKTNKTEK 530
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   580 AQAWEKEFINFVKNYKNPNL--TISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLG 657
Cdd:TIGR00917  531 AVAWEKAFIQLAKDELLPMVqaTISFSAERSIEDELKRESTADVITIAISYLVMFAYISLTLGDSPRLKSLYVTSKVLLG 610
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   658 IAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGE---------TLDQQLGRVL 728
Cdd:TIGR00917  611 LSGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYFYLEYFYRQvgvdneqelTLERRLSRAL 690
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   729 GEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDG- 807
Cdd:TIGR00917  691 MEVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPCIKTSKSSi 770
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   808 ----TSVQASESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYL 883
Cdd:TIGR00917  771 saekGSGQRKAGLLTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLPQDSYLQIYFASLTPLL 850
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   884 HAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQifnaaqLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNIT 963
Cdd:TIGR00917  851 EVGPPFYIVIKGDYNYTDFESQNKLCTMGGCDKDSIVNV------FNNLSYIAKPASSWLDDYLVWLSPQASCCCRKFTN 924
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   964 DQFCNasVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILlGHGTRVGATYFMTYHT 1043
Cdd:TIGR00917  925 GTFCN--GPDPQCFRCADLSSDAQGRPSTTQFKEKLPWFLNALPSADCAKGGHAAYSSAVDLQ-GYATIIQASSFRTYHT 1001
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1044 VLQTSADFIDALKKARLIASNVTEtmginGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWS 1123
Cdd:TIGR00917 1002 PLNTQVDFINAMRAAQEFAAKVSR-----SSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLQLNALS 1076
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1124 AVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGIT 1203
Cdd:TIGR00917 1077 VVNLIMSVGMAVVFCVGIMHLWSISLNAVSVVNSVMHKGIAIEFCTHINAQFSTGKHFSRNHRAKEALGGMGSSVFSGIT 1156
                         1210      1220      1230      1240
                   ....*....|....*....|....*....|....*....|....*....
gi 255652944  1204 LTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIG 1252
Cdd:TIGR00917 1157 LTKLVGVVVLGFSRSEIFVVYYFRMYLALVLLGFLHGLVFLPVLLSVLG 1205
 
Name Accession Description Interval E-value
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
25-1252 0e+00

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 1929.30  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944    25 CVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQELCpGFFFGNVS--LCCDVRQLQTLKDNLQLPLQFLSRCPSCFY 102
Cdd:TIGR00917    1 CAMYDICGARSDGKVLNCPYNIPSVKPPDLLSSLIQSLC-QYSHPTISgnVCCTETQFDTLRSNVQQAIPFIVRCPACLR 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   103 NLLNLFCELTCSPRQSQFLNVTATEDyvdpvtNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDAD 182
Cdd:TIGR00917   80 NFLNLFCELTCSPDQSLFINVTSTTK------VKTNSTVDGIQYYITDDFAAGMYNSCKNVKFGSSNSRALDFLGGGAKN 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   183 ACNATNWIEYMFNKDNGQAPFTITPVFSDFPV-HGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPKPQPPPPPAPWT 261
Cdd:TIGR00917  154 FKEWFNWIGQKAGVNLPGAPYGIAFLPTPCPVsSGMRPMNVSIYSCGDESLGCSCGDCPSAATCSCKAKVPTQKKHSCSI 233
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   262 ILGLDAMYVIMWITYMAFLLVFFG--AFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLF 339
Cdd:TIGR00917  234 KLGVKCVDFILAILYIVLVSVFLGggLLHPVRGKKKTSQMGTLSEADGEINSVNQQKDQNTPQRNWGQLSTVQGHLARFF 313
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   340 TRWGSFCVRNPGCVIFFSLVFITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHi 419
Cdd:TIGR00917  314 GKYGIWVARHPTLVICLSVSVVLLLCVGLIRFKVETRPVKLWVAPGSRAALEKQYFDTHFGPFYRIEQLIIATVQTSSH- 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   420 yqpypsgadVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNtnCTILSVLNYFQNSHSVLDHKK 499
Cdd:TIGR00917  393 ---------EKAPEILTDDNLKLLFDIQKKVSQLFANYEGELITLDSPCFKPNHPYN--CFIYSTCKKLQNMYSKLKPEN 461
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   500 GDDFFVyADYHTHFLYCVRAPaslndtsllhDPCLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQR 579
Cdd:TIGR00917  462 YDDYGG-VDYVKYCFEHFTSP----------ESCLSAFGGPVDPTTVLGGFSGNNFSEASAFVVTFPVNNFVNKTNKTEK 530
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   580 AQAWEKEFINFVKNYKNPNL--TISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLG 657
Cdd:TIGR00917  531 AVAWEKAFIQLAKDELLPMVqaTISFSAERSIEDELKRESTADVITIAISYLVMFAYISLTLGDSPRLKSLYVTSKVLLG 610
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   658 IAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGE---------TLDQQLGRVL 728
Cdd:TIGR00917  611 LSGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYFYLEYFYRQvgvdneqelTLERRLSRAL 690
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   729 GEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDG- 807
Cdd:TIGR00917  691 MEVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPCIKTSKSSi 770
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   808 ----TSVQASESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYL 883
Cdd:TIGR00917  771 saekGSGQRKAGLLTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLPQDSYLQIYFASLTPLL 850
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   884 HAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQifnaaqLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNIT 963
Cdd:TIGR00917  851 EVGPPFYIVIKGDYNYTDFESQNKLCTMGGCDKDSIVNV------FNNLSYIAKPASSWLDDYLVWLSPQASCCCRKFTN 924
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   964 DQFCNasVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILlGHGTRVGATYFMTYHT 1043
Cdd:TIGR00917  925 GTFCN--GPDPQCFRCADLSSDAQGRPSTTQFKEKLPWFLNALPSADCAKGGHAAYSSAVDLQ-GYATIIQASSFRTYHT 1001
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1044 VLQTSADFIDALKKARLIASNVTEtmginGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWS 1123
Cdd:TIGR00917 1002 PLNTQVDFINAMRAAQEFAAKVSR-----SSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLQLNALS 1076
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1124 AVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGIT 1203
Cdd:TIGR00917 1077 VVNLIMSVGMAVVFCVGIMHLWSISLNAVSVVNSVMHKGIAIEFCTHINAQFSTGKHFSRNHRAKEALGGMGSSVFSGIT 1156
                         1210      1220      1230      1240
                   ....*....|....*....|....*....|....*....|....*....
gi 255652944  1204 LTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIG 1252
Cdd:TIGR00917 1157 LTKLVGVVVLGFSRSEIFVVYYFRMYLALVLLGFLHGLVFLPVLLSVLG 1205
NPC1_N pfam16414
Niemann-Pick C1 N-terminus; This is the N-terminal domain of Niemann-Pick C1 family proteins. ...
23-267 5.39e-92

Niemann-Pick C1 N-terminus; This is the N-terminal domain of Niemann-Pick C1 family proteins. This family of proteins mediates transport of cholesterol from the intestinal lumen to enterocytes. This domain contains a cholesterol-binding pocket.


Pssm-ID: 339733  Cd Length: 238  Bit Score: 295.66  E-value: 5.39e-92
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944    23 QSCVWYGECGIAY-GDKRYNCEYSGPPKPLPKDGYDLVQELCPGFFFGNVSLCCDVRQLQTLKDNLQLPLQFLSRCPSCF 101
Cdd:pfam16414    1 GRCAMYGECGKKSlFGKELPCPYNGPAKPLDDEVRDLLAELCPELWADEGPVCCDADQLNTLRANLKLAEPLISRCPACK 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   102 YNLLNLFCELTCSPRQSQFLNVTATEdyvdpVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKda 181
Cdd:pfam16414   81 KNFFNLFCEFTCSPDQSLFLNVTKTE-----KSVDGKEAVTELDYYISEEYASGFYDSCKDVKFPATNGYAMDLICGG-- 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   182 dACNATNWIEYMFNKDNGQAPFTITPVF-SDFPVHGMEPMNNATKGCDEsVDEvTAPCSCQDCSIVCGPKPQP-PPPPAP 259
Cdd:pfam16414  154 -ACNYQRWLKFLGDKKNGGSPFQINFPYpPEEPPSGMEPLNPNTTDCNE-YDA-SYACSCVDCPLSCPVLPPLpPPPPGP 230

                   ....*...
gi 255652944   260 WTILGLDA 267
Cdd:pfam16414  231 CKVGGLPC 238
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
571-1248 2.14e-19

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 94.29  E-value: 2.14e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  571 YNDTEKlqraqawEKEFINFVKNYKNpnltiSFTAERSIEDELNRESDSDVFTVVisyAIMFLYISLALghmkscrrLLV 650
Cdd:COG1033   160 YEEIER-------IIEIAKFPSGVKL-----YLTGDPAIRYQILREIQKDMVVLL---ALAVILMVIVL--------YYV 216
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  651 DSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLvLAVGVDNIFILVQAYQrDERLQGETLDQQLGRVLGE 730
Cdd:COG1033   217 FRSVRRALLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYGVHFHNRYE-EERRKGRTVEEAVVEAIKH 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  731 VAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLgldikrqekNRLDIFCCVRGAEDGTSV 810
Cdd:COG1033   295 TGPAVLIAALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALL---------ILIPKGRKKREEKKDSKK 365
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  811 QASEsclFRFFKNSYSPLLlkdwmRPIVIAIFVGVLS-FSIAVLNKVDIGLDQSLSMPDDS-YMVDYfKSISQYLHAGPP 888
Cdd:COG1033   366 GKLE---KRLSKIAKIIAR-----HPVTVLVVALIIVgVSLYGASKVKIETDIEKYLPQDLpALKAL-DFIEKEFGGSDP 436
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  889 VYFVLEEGHDYTSSKGQNMvcggmgcnnDSLVQQIfnaaqldnyTRIGFAPSSwIDDYFDWVKpqssccrvdnitdqfcn 968
Cdd:COG1033   437 ITIVLEAEDVRDPEVLRWM---------DELEEEL---------EKGEEHVFS-ASSIVDLVK----------------- 480
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  969 asvvdpacvrcrplTPEGKQRPQGGDFMRFLpmflsdNPNPKCGKGGHaaYSSAVNILLGhgtrvgatYFMTyhtvlQTS 1048
Cdd:COG1033   481 --------------QVNGGIIPDKSKIQIIL------EELPESIKKRY--ISGDQLNLLG--------YSLG-----DTQ 525
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1049 ADFIDALKKA-RLIASNVTETM---GINGSAyrvfpysvfYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGcELWSA 1124
Cdd:COG1033   526 GELEDVGREIlRDIEKENIPTGvkvYVTGES---------VIYVEMNELLTSSQLISTVLGIILVFALLLIIFR-SPLKA 595
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1125 VIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSM-KGSRVERAEEALAHMGSSVFSGiT 1203
Cdd:COG1033   596 IIPLIPIAIVVGWNFGLMGLLGIPLTPATATLGAIILGIGVDYSIHITERYREERkKGGPKEAIETTVERTGKAILAS-A 674
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*
gi 255652944 1204 LTKFGGIVVLAFAKSQIFQIFYFRMYLAMvLLGATHGLIFLPVLL 1248
Cdd:COG1033   675 LTTAIGFLALIFSPFPIISNFGLLTVIGI-LLSLLASLVLLPALL 718
 
Name Accession Description Interval E-value
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
25-1252 0e+00

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 1929.30  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944    25 CVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQELCpGFFFGNVS--LCCDVRQLQTLKDNLQLPLQFLSRCPSCFY 102
Cdd:TIGR00917    1 CAMYDICGARSDGKVLNCPYNIPSVKPPDLLSSLIQSLC-QYSHPTISgnVCCTETQFDTLRSNVQQAIPFIVRCPACLR 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   103 NLLNLFCELTCSPRQSQFLNVTATEDyvdpvtNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDAD 182
Cdd:TIGR00917   80 NFLNLFCELTCSPDQSLFINVTSTTK------VKTNSTVDGIQYYITDDFAAGMYNSCKNVKFGSSNSRALDFLGGGAKN 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   183 ACNATNWIEYMFNKDNGQAPFTITPVFSDFPV-HGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPKPQPPPPPAPWT 261
Cdd:TIGR00917  154 FKEWFNWIGQKAGVNLPGAPYGIAFLPTPCPVsSGMRPMNVSIYSCGDESLGCSCGDCPSAATCSCKAKVPTQKKHSCSI 233
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   262 ILGLDAMYVIMWITYMAFLLVFFG--AFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLF 339
Cdd:TIGR00917  234 KLGVKCVDFILAILYIVLVSVFLGggLLHPVRGKKKTSQMGTLSEADGEINSVNQQKDQNTPQRNWGQLSTVQGHLARFF 313
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   340 TRWGSFCVRNPGCVIFFSLVFITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHi 419
Cdd:TIGR00917  314 GKYGIWVARHPTLVICLSVSVVLLLCVGLIRFKVETRPVKLWVAPGSRAALEKQYFDTHFGPFYRIEQLIIATVQTSSH- 392
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   420 yqpypsgadVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNtnCTILSVLNYFQNSHSVLDHKK 499
Cdd:TIGR00917  393 ---------EKAPEILTDDNLKLLFDIQKKVSQLFANYEGELITLDSPCFKPNHPYN--CFIYSTCKKLQNMYSKLKPEN 461
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   500 GDDFFVyADYHTHFLYCVRAPaslndtsllhDPCLGTFGGPVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQR 579
Cdd:TIGR00917  462 YDDYGG-VDYVKYCFEHFTSP----------ESCLSAFGGPVDPTTVLGGFSGNNFSEASAFVVTFPVNNFVNKTNKTEK 530
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   580 AQAWEKEFINFVKNYKNPNL--TISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLG 657
Cdd:TIGR00917  531 AVAWEKAFIQLAKDELLPMVqaTISFSAERSIEDELKRESTADVITIAISYLVMFAYISLTLGDSPRLKSLYVTSKVLLG 610
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   658 IAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGE---------TLDQQLGRVL 728
Cdd:TIGR00917  611 LSGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYFYLEYFYRQvgvdneqelTLERRLSRAL 690
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   729 GEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDG- 807
Cdd:TIGR00917  691 MEVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPCIKTSKSSi 770
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   808 ----TSVQASESCLFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYL 883
Cdd:TIGR00917  771 saekGSGQRKAGLLTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLPQDSYLQIYFASLTPLL 850
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   884 HAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQifnaaqLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNIT 963
Cdd:TIGR00917  851 EVGPPFYIVIKGDYNYTDFESQNKLCTMGGCDKDSIVNV------FNNLSYIAKPASSWLDDYLVWLSPQASCCCRKFTN 924
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   964 DQFCNasVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILlGHGTRVGATYFMTYHT 1043
Cdd:TIGR00917  925 GTFCN--GPDPQCFRCADLSSDAQGRPSTTQFKEKLPWFLNALPSADCAKGGHAAYSSAVDLQ-GYATIIQASSFRTYHT 1001
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1044 VLQTSADFIDALKKARLIASNVTEtmginGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWS 1123
Cdd:TIGR00917 1002 PLNTQVDFINAMRAAQEFAAKVSR-----SSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLQLNALS 1076
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1124 AVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGIT 1203
Cdd:TIGR00917 1077 VVNLIMSVGMAVVFCVGIMHLWSISLNAVSVVNSVMHKGIAIEFCTHINAQFSTGKHFSRNHRAKEALGGMGSSVFSGIT 1156
                         1210      1220      1230      1240
                   ....*....|....*....|....*....|....*....|....*....
gi 255652944  1204 LTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIG 1252
Cdd:TIGR00917 1157 LTKLVGVVVLGFSRSEIFVVYYFRMYLALVLLGFLHGLVFLPVLLSVLG 1205
NPC1_N pfam16414
Niemann-Pick C1 N-terminus; This is the N-terminal domain of Niemann-Pick C1 family proteins. ...
23-267 5.39e-92

Niemann-Pick C1 N-terminus; This is the N-terminal domain of Niemann-Pick C1 family proteins. This family of proteins mediates transport of cholesterol from the intestinal lumen to enterocytes. This domain contains a cholesterol-binding pocket.


Pssm-ID: 339733  Cd Length: 238  Bit Score: 295.66  E-value: 5.39e-92
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944    23 QSCVWYGECGIAY-GDKRYNCEYSGPPKPLPKDGYDLVQELCPGFFFGNVSLCCDVRQLQTLKDNLQLPLQFLSRCPSCF 101
Cdd:pfam16414    1 GRCAMYGECGKKSlFGKELPCPYNGPAKPLDDEVRDLLAELCPELWADEGPVCCDADQLNTLRANLKLAEPLISRCPACK 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   102 YNLLNLFCELTCSPRQSQFLNVTATEdyvdpVTNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKda 181
Cdd:pfam16414   81 KNFFNLFCEFTCSPDQSLFLNVTKTE-----KSVDGKEAVTELDYYISEEYASGFYDSCKDVKFPATNGYAMDLICGG-- 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   182 dACNATNWIEYMFNKDNGQAPFTITPVF-SDFPVHGMEPMNNATKGCDEsVDEvTAPCSCQDCSIVCGPKPQP-PPPPAP 259
Cdd:pfam16414  154 -ACNYQRWLKFLGDKKNGGSPFQINFPYpPEEPPSGMEPLNPNTTDCNE-YDA-SYACSCVDCPLSCPVLPPLpPPPPGP 230

                   ....*...
gi 255652944   260 WTILGLDA 267
Cdd:pfam16414  231 CKVGGLPC 238
Patched pfam02460
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
524-1249 6.48e-75

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


Pssm-ID: 308203  Cd Length: 793  Bit Score: 265.76  E-value: 6.48e-75
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   524 NDTSLLHDPCLGTFGGPVFPWLVLGG---YDDQNYNNATALVITFPVNnyYNDTEKLQRAQAWEKEFINFVKN-YKNPNL 599
Cdd:pfam02460  117 NTRIDITYPIMPVLGTPIYLGPHFGGvdfEPPGNISYAKAIVLWYFLK--FDEEEVEEDSKEWEDELSQLLHNkYASEHI 194
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   600 TISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIG 679
Cdd:pfam02460  195 QFTIFHDQILNDELVRNALTLTPFFVIGFFLLLTFSIIVSVTLSSYTIDWVRSKPILAALGLLSPVMAIVSSFGLLFWMG 274
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   680 LPLTLIVIeVIPFLVLAVGVDNIFILVQAYQRDERLQgeTLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHT 759
Cdd:pfam02460  275 FPFNSIVC-VTPFLVLAIGVDDMFLMVAAWQRTTATL--SVKKRMGEALSEAGVSITITSLTDVLSFGIGTYTPTPAIQL 351
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   760 FSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRG----AEDGTSV----QASESCLFRFFKNSYSPLLLK 831
Cdd:pfam02460  352 FCAYTAVAIFFDFIYQITFFAAIMAICAKPEAEGRHCLFVWATSspqrIDSEGSEpdksHNIEQLKSRFFLDIYCPFLLN 431
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   832 DWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYL-HAGPPVYFVLEEGHDYTSSKgqnmvcg 910
Cdd:pfam02460  432 PSVRVCMLVLFVVYIAIAIYGCVNIKEGLEPDKLVLEDSPLVEYLSLREKHFwPEGLQIQVAVNNPPNLTIPE------- 504
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   911 gmgcNNDSLvQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQssccrvdnitdqfcNASVVDpacvrcrpltpEGKQRP 990
Cdd:pfam02460  505 ----SRDRM-NEMVDEFENTPYSLGPNSTLFWLREYENFLSTL--------------NMEEEE-----------DEEKEW 554
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   991 QGGDfmrfLPMFLSDNPNPKCGKGGHAAYSsavnillghGTRVGATYFMTYHTVLQTSADFIDALKKARLIASNvtetmg 1070
Cdd:pfam02460  555 SYGN----LPSFLKAPGNSHWAGDLVWDDN---------TTMVTKFRFTLAGKGLSTWNDRTRALQEWRSIADQ------ 615
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1071 ingsaYRVFPYSVF---YVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCAtIAMVLVNMFGVMWLWGI 1147
Cdd:pfam02460  616 -----YPEFNVTVFdedAPFADQYLTILPSTIQNIVITLICMFIVCFLFIPNPPCVFVITLA-IASIDIGVFGFLSLWGV 689
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1148 SLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSGITLTkFGGIVVLAFAKSQIFQIFYFR 1227
Cdd:pfam02460  690 DLDPISMITIIMSIGFSVDFSAHIAYHFVRSRGDTPAERVVDALEALGWPVFQGGLST-ILGVLVLLFVPSYMVVVFFKT 768
                          730       740
                   ....*....|....*....|..
gi 255652944  1228 MYLaMVLLGATHGLIFLPVLLS 1249
Cdd:pfam02460  769 VFL-VVAIGLLHGLFILPIILS 789
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
649-803 2.94e-66

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 338325 [Multi-domain]  Cd Length: 153  Bit Score: 220.16  E-value: 2.94e-66
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   649 LVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQRDERLQGEtlDQQLGRVL 728
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAVGVDNIFILVKAVQRTPRSLDV--SERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 255652944   729 GEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRG 803
Cdd:pfam12349   79 GEVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVAVLFDFLLQITFFVAVLSLDIRREESNRLDVFCCVRV 153
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
581-1253 2.84e-64

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 239.01  E-value: 2.84e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   581 QAWEKEFINFVKNY--KNPNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALghmksCRRLLVDSKVSLGI 658
Cdd:TIGR00918  357 EAWQRNFSEEVQQSlpKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTM-----LRWDCAKSQGSVGL 431
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   659 AGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVDNIFILVQAYQrdERLQGETLDQQLGRVLGEVAPSMFLS 738
Cdd:TIGR00918  432 AGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFS--ETGQNIPFEERTGECLKRTGASVVLT 509
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   739 SFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGA-------------- 804
Cdd:TIGR00918  510 SISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPcsarviqiepqaya 589
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   805 --------------------EDGTSVQASESC------------------------------------------------ 816
Cdd:TIGR00918  590 dgsappvysshmqstvqlrtEYDPGTQHYYTTneprshlsvqpsdplscqspdiagstrdllsqfedskaaclslpcarw 669
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   817 -LFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLhAGPPVYFVLEE 895
Cdd:TIGR00918  670 tLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYF-SFYNMYAVTQG 748
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   896 GHDYTSSKgqnmvcggmgcnndslvQQIFNAAQldNYTRI--------GFAPSSWIDDYFDWV----KPQSSCCRVDNIT 963
Cdd:TIGR00918  749 NFDYPTQQ-----------------QLLYDLHQ--SFSSVkyvlkednGQLPRMWLHYFRDWLqglqKAFDEDWRDGRIT 809
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   964 -DQFCNASvvDPACVRCRPLTPEGkQRPQGGDFMRFLPMFLSDNP---NPKCGKGGHAAYSSavNILLGHGTRVGATY-- 1037
Cdd:TIGR00918  810 kENYRNGS--DDAVLAYKLLVQTG-HRDKPVDKEQLTTQRLVNADgiiNPNAFYIYLSAWVS--NDPVAYAASQANIYph 884
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1038 ----------------------------FMTYHTVLQTSADFIDALKKARLIASNVTetmginGSAYRVFPYSVFYVFYE 1089
Cdd:TIGR00918  885 ppewlhdkndydpenlripaaepleyaqFPFYLNGLRETSQFVEAIEHVRAICNNYE------GFGLPSYPSGYPFLFWE 958
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1090 QYLTIIDDTIFNLGVSLGAIFLVTMVLLgCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCS 1169
Cdd:TIGR00918  959 QYMGLRHWLLLSISVVLACTFLVCALLL-LNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTV 1037
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1170 HITRAFTVSMkGSRVERAEEALAHMGSSVFSGITLTKFGgivVLAFAKSQI-FQIFYFRMYLAMV-LLGATHGLIFLPVL 1247
Cdd:TIGR00918 1038 HIALGFLTAI-GDRNRRAVLALEHMFAPVLDGALSTLLG---VLMLAGSEFdFIVRYFFAVLAVLtCLGVLNGLVLLPVL 1113

                   ....*.
gi 255652944  1248 LSYIGP 1253
Cdd:TIGR00918 1114 LSMFGP 1119
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
571-1248 2.14e-19

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 94.29  E-value: 2.14e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  571 YNDTEKlqraqawEKEFINFVKNYKNpnltiSFTAERSIEDELNRESDSDVFTVVisyAIMFLYISLALghmkscrrLLV 650
Cdd:COG1033   160 YEEIER-------IIEIAKFPSGVKL-----YLTGDPAIRYQILREIQKDMVVLL---ALAVILMVIVL--------YYV 216
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  651 DSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLvLAVGVDNIFILVQAYQrDERLQGETLDQQLGRVLGE 730
Cdd:COG1033   217 FRSVRRALLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYGVHFHNRYE-EERRKGRTVEEAVVEAIKH 294
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  731 VAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLgldikrqekNRLDIFCCVRGAEDGTSV 810
Cdd:COG1033   295 TGPAVLIAALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALL---------ILIPKGRKKREEKKDSKK 365
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  811 QASEsclFRFFKNSYSPLLlkdwmRPIVIAIFVGVLS-FSIAVLNKVDIGLDQSLSMPDDS-YMVDYfKSISQYLHAGPP 888
Cdd:COG1033   366 GKLE---KRLSKIAKIIAR-----HPVTVLVVALIIVgVSLYGASKVKIETDIEKYLPQDLpALKAL-DFIEKEFGGSDP 436
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  889 VYFVLEEGHDYTSSKGQNMvcggmgcnnDSLVQQIfnaaqldnyTRIGFAPSSwIDDYFDWVKpqssccrvdnitdqfcn 968
Cdd:COG1033   437 ITIVLEAEDVRDPEVLRWM---------DELEEEL---------EKGEEHVFS-ASSIVDLVK----------------- 480
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  969 asvvdpacvrcrplTPEGKQRPQGGDFMRFLpmflsdNPNPKCGKGGHaaYSSAVNILLGhgtrvgatYFMTyhtvlQTS 1048
Cdd:COG1033   481 --------------QVNGGIIPDKSKIQIIL------EELPESIKKRY--ISGDQLNLLG--------YSLG-----DTQ 525
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1049 ADFIDALKKA-RLIASNVTETM---GINGSAyrvfpysvfYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGcELWSA 1124
Cdd:COG1033   526 GELEDVGREIlRDIEKENIPTGvkvYVTGES---------VIYVEMNELLTSSQLISTVLGIILVFALLLIIFR-SPLKA 595
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1125 VIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSM-KGSRVERAEEALAHMGSSVFSGiT 1203
Cdd:COG1033   596 IIPLIPIAIVVGWNFGLMGLLGIPLTPATATLGAIILGIGVDYSIHITERYREERkKGGPKEAIETTVERTGKAILAS-A 674
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*
gi 255652944 1204 LTKFGGIVVLAFAKSQIFQIFYFRMYLAMvLLGATHGLIFLPVLL 1248
Cdd:COG1033   675 LTTAIGFLALIFSPFPIISNFGLLTVIGI-LLSLLASLVLLPALL 718
AcrB COG0841
Multidrug efflux pump subunit AcrB [Defense mechanisms];
1079-1251 1.58e-10

Multidrug efflux pump subunit AcrB [Defense mechanisms];


Pssm-ID: 223911 [Multi-domain]  Cd Length: 1009  Bit Score: 65.71  E-value: 1.58e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1079 FPYSVFY-VFYEQYLTI---IDDTIFNLGVSLGAIFLVTMVLLGcELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSL 1154
Cdd:COG0841   308 LPQGVDIaIPYDTTEFIkasIEEVIKTLFEAIVLVVLVMYLFLG-NLRATLIPALAVPVSLLGTFAVMYAFGFSLNTLTL 386
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1155 VNLVMSCGISVEFCSHITRAFTVSMKG-SRVERAEEALAHMGSSVFSgITLTkfgGIVV---LAFAKSQIFQifYFRmYL 1230
Cdd:COG0841   387 FALVLAIGLLVDDAIVVVENIERHMRGlPPREAAEKAMGEIGGAVIA-ITLV---LIAVflpMAFMGGSTGE--LFR-QF 459
                         170       180
                  ....*....|....*....|.
gi 255652944 1231 AMVLLGAthgliflpVLLSYI 1251
Cdd:COG0841   460 AITIAVA--------MLLSLL 472
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
571-800 9.67e-10

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 62.93  E-value: 9.67e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   571 YNDTEKlqraqawEKEFINFVKNYK---NPNLTISFTAERSIEDELNResdsdvfTVVISYAIMFLYIslalghmkscrr 647
Cdd:TIGR00921  157 YNDVER-------SLERTNPPSGKFldvTGSPAINYDIEREFGKDMGT-------TMAISGILVVLVL------------ 210
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   648 LLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPfLVLAVGVDNIFILVQAYQrDERLQGETLDQQLGRV 727
Cdd:TIGR00921  211 LLDFKRWWRPLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVP-MLIGVGIDYGIQTLNRYE-EERDIGRAKGEAIVTA 288
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 255652944   728 LGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCC 800
Cdd:TIGR00921  289 VRRTGRAVLIALLTTSAGFAALALSEFPMVSEFGLGLVAGLITAYLLTLLVLPALLQSIDIGREKVKKEIIAI 361
MMPL pfam03176
MMPL family; Members of this family are putative integral membrane proteins from bacteria. ...
658-785 5.38e-09

MMPL family; Members of this family are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport.


Pssm-ID: 308676 [Multi-domain]  Cd Length: 332  Bit Score: 59.23  E-value: 5.38e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   658 IAGILIVLS---SVACSLG---VFSYI-GLPLTLIVIEVIPFLVLAVGVD-NIFiLVQAYqRDERLQGETLDQQLGRVLG 729
Cdd:pfam03176  167 VAALLPLLTvglSLGAAQGlvaILAHIlGIGLSTFALNLLVVLLIAVGTDyALF-LVSRY-REELRAGEDREEAVIRAVR 244
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 255652944   730 EVAPSMFLSSFseTVAFFLGALSV--MPAVHTFSLFAGLAVFIDFLLQITCFVSLLGL 785
Cdd:pfam03176  245 GTGKVVTAAGL--TVAIAMLALSFarLPVFAQVGPTIAIGVLVDVLAALTLLPALLAL 300
2A060605 TIGR00920
3-hydroxy-3-methylglutaryl-coenzyme A reductase; [Transport and binding proteins, ...
619-792 2.21e-06

3-hydroxy-3-methylglutaryl-coenzyme A reductase; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273339 [Multi-domain]  Cd Length: 886  Bit Score: 52.17  E-value: 2.21e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   619 SDVFTVVISYAIMFLYISLALGHMkscRRLlvDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIViEVIPFLVLAVG 698
Cdd:TIGR00920   60 SDVIVMTITRCIAVLYIYYQFCNL---RQL--GSKYILGIAGLFTIFSSFVFSTAVIHFLGSELTGLN-EALPFFLLLID 133
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   699 VDNIFILVQaYQRDERLQGETLDqQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITC 778
Cdd:TIGR00920  134 LSKASALAK-FALSSNSQDEVRD-NIARGMAILGPTITLDTVVETLVIGVGTMSGVRRLEVLCCFGCMSVLANYFVFMTF 211
                          170
                   ....*....|....*..
gi 255652944   779 F---VSLLgLDIKRQEK 792
Cdd:TIGR00920  212 FpacLSLV-LELSRSGR 227
ACR_tran pfam00873
AcrB/AcrD/AcrF family; Members of this family are integral membrane proteins. Some are ...
1079-1249 7.18e-06

AcrB/AcrD/AcrF family; Members of this family are integral membrane proteins. Some are involved in drug resistance. AcrB cooperates with a membrane fusion protein, AcrA, and an outer membrane channel TolC. The structure shows the AcrB forms a homotrimer.


Pssm-ID: 334294 [Multi-domain]  Cd Length: 1010  Bit Score: 50.37  E-value: 7.18e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1079 FPYSVFY-VFYEQYLTI---IDDTIFNLGVSLGAIFLVTMVLLGcELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSL 1154
Cdd:pfam00873  310 FPQGVKIvVPYDTTPFVrasIEEVVKTLLEAIVLVILVMFLFLQ-NFRATLIPAIAVPLSLLGTFAVMKAFGFSINTLTL 388
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1155 VNLVMSCGISV-------EFCSHITRA-----FTVSMKGSR-VERAEEALAHMGSSVFsgITLTKFGGIVvlafakSQIF 1221
Cdd:pfam00873  389 GGLVLAIGLVVddaivvvENIERVLAEeglkpLEAAYKSMGeIQGALVAIALVLSAVF--LPILFLGGVT------GRIF 460
                          170       180
                   ....*....|....*....|....*...
gi 255652944  1222 QIFYFRMYLAMvLLGATHGLIFLPVLLS 1249
Cdd:pfam00873  461 RQFAITIVLAI-LLSVLVALTLTPALCA 487
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
1087-1275 1.99e-05

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 48.84  E-value: 1.99e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1087 FYEQYLT---IIDDTIFN-----LGVSLG-AIFLVTMVLL----GCelWSAVIMCATIAMVLVNMFGVMWLWGISLNAVS 1153
Cdd:COG1033   175 GVKLYLTgdpAIRYQILReiqkdMVVLLAlAVILMVIVLYyvfrSV--RRALLPLIIVLVSVLWTLGAMGLLGIPLTITT 252
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1154 LVNLVMSCGISVEFCSH-ITRAFTVSMKGSRVERA-EEALAHMGSSVFSGITLTKFGgivVLAFAKSQIFQIFYFRMYLA 1231
Cdd:COG1033   253 SAVPPLLIGIGIDYGVHfHNRYEEERRKGRTVEEAvVEAIKHTGPAVLIAALTTAAG---FLSLLTSSIPAIKEFGILLS 329
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 255652944 1232 M-VLLGATHGLIFLPVLLSYIGpsvnkaKSCATEERYKGTERERL 1275
Cdd:COG1033   330 IgIILAFLSSLTVLPALLILIP------KGRKKREEKKDSKKGKL 368
YdfJ COG2409
Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];
621-898 1.17e-04

Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];


Pssm-ID: 225272 [Multi-domain]  Cd Length: 937  Bit Score: 46.26  E-value: 1.17e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  621 VFTVVISYAIMFLYISLALGhmkscrrllvdskVSLGIAGILIvlssvacslgvfSYIGLPLTLIVIEVIPFLVLAVGVD 700
Cdd:COG2409   204 VYRSVITAFLPLITVGLSLL-------------VAQGIVALLA------------YAFGLGVSTFALSLLVALGIGAGTD 258
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  701 -NIFIlVQAYqRDERLQGETLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQIT-- 777
Cdd:COG2409   259 yALFL-VSRY-REELREGQDREAAVGTAYRTAGKTVAFSGLTVAIALLGLSFARLPFLKTLGIAAAIGVAVAVLAALTll 336
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  778 -CFVSLLG-----LDIKRQEKNRldifccvRGAEDGTSVQAsesclfrffknsysplllkdWMRPIVIAIFVGVLSFSIA 851
Cdd:COG2409   337 pALLALLGrrgfwPDPKRASESR-------FWRRVGTLVVR--------------------RPLAILVASLAILLVLALP 389
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 255652944  852 VLNkVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGP--PVYFVLEEGHD 898
Cdd:COG2409   390 LPL-VRLGYDDRKTLPSSNPSRKGYAAADRHFGQGRlaPEIVLIESDHD 437
actII TIGR00833
Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family ...
588-785 2.61e-04

Transport protein; The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family (TC 2.A.6.5)Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. This sub-family includes the S. coelicolor ActII3 protein, which may play a role in drug resistance, and the M. tuberculosis MmpL7 protein, which catalyzes export of an outer membrane lipid, phthiocerol dimycocerosate. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 129913 [Multi-domain]  Cd Length: 910  Bit Score: 45.35  E-value: 2.61e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   588 INFVKNYKNPNLTISFTAERSIedeLNRESDSDVFTVVISYAIMFLYISLALGHmKSCRRLLVDSKVSLGIAGILI---- 663
Cdd:TIGR00833  122 VNLAGEKGQKEAQEAINAVRRI---VEQTNAPDGLTVHVTGPLATIADILESGD-KDMNRITATTGIIVLIILLLVyrsp 197
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   664 ---------VLSSVACSLGVFS------YIGLPLTLIVIEVIpfLVLAVGVDNIFILVQAYQrDERLQGETLDQQLGRVL 728
Cdd:TIGR00833  198 itmlvplvsVGFSVVVAQGIVSllgipgLIGVNAQTTVLLTA--LVIGAGTDYAVFLTGRYH-EERRKGESLEEAAAEAL 274
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 255652944   729 GEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGL 785
Cdd:TIGR00833  275 RGTGKAILGSALTVAVAFLALSLARLPSFKTLGVSCAVGVLVALLNAVTLTPALLTL 331
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
597-785 3.10e-04

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 44.83  E-value: 3.10e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   597 PNLTISFTAERSIEDELNRESDSDVFTVVISYAIMFLYISLALghmksCRRLLVdskvslGIAGILIVLSSVACSLGVFS 676
Cdd:TIGR00921  545 PGVKVGVTGLPVAFAEMHELVNEGMRRMTIAGAILVLMILLAV-----FRNPIK------AVFPLIAIGSGILWAIGLMG 613
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944   677 YIGLPLTLIVIEVIPfLVLAVGVDNIFILVQAY--QRDERLQGETLDQQLGRVlgevAPSMFLSSFseTVAFFLGAL--S 752
Cdd:TIGR00921  614 LRGIPSFLAMATTIS-IILGLGMDYSIHLAERYfeERKEHGPKEAITHTMERT----GPGILFSGL--TTAGGFLSLllS 686
                          170       180       190
                   ....*....|....*....|....*....|...
gi 255652944   753 VMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGL 785
Cdd:TIGR00921  687 HFPIMRNFGLVQGIGVLSSLTAALVVFPALLVL 719
CusA COG3696
Cu/Ag efflux pump CusA [Inorganic ion transport and metabolism];
1086-1250 4.62e-04

Cu/Ag efflux pump CusA [Inorganic ion transport and metabolism];


Pssm-ID: 226220 [Multi-domain]  Cd Length: 1027  Bit Score: 44.59  E-value: 4.62e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1086 VFYEQYlTIIDDTIFNLGVSL--GAIF--LVTMVLLGcELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSC 1161
Cdd:COG3696   321 TTYDRS-ELIDKAIDTVSKTLieGSVLviIVLALFLG-NFRSALIVIISLPLSLLIAFIVMNFFGISANLMSLGGLAIAI 398
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944 1162 GISV-------EFC-SHITRAftvsmKGSRVERAE---EALAHMGSSVFSGItltkfgGIVVLAFAKsqifqIFYF---- 1226
Cdd:COG3696   399 GAMVdaaivvvENAhRRLEEN-----QHTNATRFHviyDASKEVGRPVFFGL------LIITVVFLP-----IFTLtgve 462
                         170       180       190
                  ....*....|....*....|....*....|..
gi 255652944 1227 -RMYLAMV------LLGATH-GLIFLPVLLSY 1250
Cdd:COG3696   463 gKLFAPLAftktyaLLAALLlSITFIPALMAY 494
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
584-792 8.96e-04

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 43.45  E-value: 8.96e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  584 EKEFINFVKNYKNPNLTISFTAERSIEDELNRESDSD-VFTVVISYAIMFLYISLALghmkscRRLLVdskvslGIAGIL 662
Cdd:COG1033   533 REILRDIEKENIPTGVKVYVTGESVIYVEMNELLTSSqLISTVLGIILVFALLLIIF------RSPLK------AIIPLI 600
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  663 IVLSSVACSLGVFSYIGLPLTLIVIEVIPfLVLAVGVDNIFILVQAYqrDERLQGETLDQQLGRVLGEVAPSMFLSSFSE 742
Cdd:COG1033   601 PIAIVVGWNFGLMGLLGIPLTPATATLGA-IILGIGVDYSIHITERY--REERKKGGPKEAIETTVERTGKAILASALTT 677
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 255652944  743 TVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEK 792
Cdd:COG1033   678 AIGFLALIFSPFPIISNFGLLTVIGILLSLLASLVLLPALLVLLDGRRKR 727
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
1100-1276 2.05e-03

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 42.13  E-value: 2.05e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1100 FNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNM-FGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAF--T 1176
Cdd:TIGR00921  195 MGTTMAISGILVVLVLLLDFKRWWRPLLPLVIILFGVAWvLGIMGWLGIPLYATTLLAVPMLIGVGIDYGIQTLNRYeeE 274
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  1177 VSMKGSRVERAEEALAHMGSSVFSGITLTKFGgivVLAFAKSQIFQIFYFRMYLAM-VLLGATHGLIFLPVLLSYIGPSV 1255
Cdd:TIGR00921  275 RDIGRAKGEAIVTAVRRTGRAVLIALLTTSAG---FAALALSEFPMVSEFGLGLVAgLITAYLLTLLVLPALLQSIDIGR 351
                          170       180
                   ....*....|....*....|.
gi 255652944  1256 NKAKSCATEERYKGTERERLL 1276
Cdd:TIGR00921  352 EKVKKEIIAIGGKSSEIEEEL 372
COG4258 COG4258
Predicted exporter [General function prediction only];
659-774 2.64e-03

Predicted exporter [General function prediction only];


Pssm-ID: 226709 [Multi-domain]  Cd Length: 788  Bit Score: 41.78  E-value: 2.64e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255652944  659 AGILIVLSSVA---CSLGVFSYIGLPLTLI-VIEVIpfLVLAVGVDniFILVQAYQRDERlqgetldQQLGRVLGEVAps 734
Cdd:COG4258   671 RGLRVLLPSVLalgCGLAVLAMAGVPLNLFhLLALV--LVLGVGIN--YALFFSNAGDPR-------AEPLTTLLALA-- 737
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 255652944  735 mfLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLL 774
Cdd:COG4258   738 --LAMLTTLLTFGLLAFSATPVLSSFGITLASGIILAFVL 775
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH