NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [lcl|seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef]
View 

BRENDA::A0A140N9B6

Protein Classification

aspartate aminotransferase family protein( domain architecture ID 10793645)

aspartate aminotransferase family protein such as glutamate-1-semialdehyde 2,1-aminomutase or succinylornithine transaminase, involved in transamination or decarboxylation of various substrates

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK12381 PRK12381
bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
1-406 0e+00

bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional


:

Pssm-ID: 183486 [Multi-domain]  Cd Length: 406  Bit Score: 880.60  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:PRK12381                                    1 MSQPITRENFDEWMVPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTN 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAP 160
Cdd:PRK12381                                   81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKYAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAP 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 161 LPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK12381                                  161 LPPDIRHAAYNDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMH 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK12381                                  241 YGVTPDVLTTAKALGGGFPIGAMLTTEKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK12381                                  321 TINARYGLFSEIRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNISEEEITTGLDRFARACERF 400

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 401 VSRGSS 406
Cdd:PRK12381                                  401 VSRGSS 406
 
Name Accession Description Interval E-value
PRK12381 PRK12381
bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
1-406 0e+00

bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional


Pssm-ID: 183486 [Multi-domain]  Cd Length: 406  Bit Score: 880.60  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:PRK12381                                    1 MSQPITRENFDEWMVPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTN 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAP 160
Cdd:PRK12381                                   81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKYAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAP 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 161 LPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK12381                                  161 LPPDIRHAAYNDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMH 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK12381                                  241 YGVTPDVLTTAKALGGGFPIGAMLTTEKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK12381                                  321 TINARYGLFSEIRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNISEEEITTGLDRFARACERF 400

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 401 VSRGSS 406
Cdd:PRK12381                                  401 VSRGSS 406
arg_catab_astC TIGR03246
succinylornithine transaminase family; Members of the seed alignment for this protein family ...
5-401 0e+00

succinylornithine transaminase family; Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason. [Energy metabolism, Amino acids and amines]


Pssm-ID: 274490 [Multi-domain]  Cd Length: 397  Bit Score: 792.02  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   5 ITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVL 84
Cdd:TIGR03246                                   1 VTRQDFDEVMVPVYAPAPFIPVRGEGSRVWDQQGKEYIDFAGGIAVNALGHAHPELVKALIEQAQKLWHIGNGYTNEPVL 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  85 RLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPAD 164
Cdd:TIGR03246                                  81 RLAKKLVDATFADRVFFCNSGAEANEAALKLARKYALDRHGAHKSEIVAFKNSFHGRTLFTVSVGGQPKYSQDFAPLPGG 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 165 IRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVT 244
Cdd:TIGR03246                                 161 IKHAPYNDLAAAKALIDDKTCAVIVEPIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVT 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 245 PDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINH 324
Cdd:TIGR03246                                 241 PDILTTAKALGGGFPIGAMLTTTEIAAVLTVGTHGTTYGGNPLACAVAGKVLDLVNTPEVLAGVKQRHDWFVDRLEKINA 320
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 325 RYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFV 401
Cdd:TIGR03246                                 321 RYNVFSEIRGKGLLIGCVLTAAYAGKAKQIVNAAAEEGVMALIAGPNVVRFAPSLVISDEDIDEGLARFERAVEQFV 397
ArgD COG4992
Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and ...
1-405 0e+00

Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 227325 [Multi-domain]  Cd Length: 404  Bit Score: 626.12  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:COG4992                                     4 ELTAATIELFMKYLMPTYGRLPVVIVRGEGAYVWDQQGREYLDFAAGIAVNNLGHCHPALVEALKEQAEKLWHVSNLFYN 83
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDAT-FADRVFFCNSGAEANEAALKLARKFAHDRygsHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFA 159
Cdd:COG4992                                    84 EPQAELAEKLVELSpFADRVFFCNSGAEANEAALKLARKYTGDP---EKSKIIAFENSFHGRTLGALSATGQPKYRKGFG 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 160 PLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYM 239
Cdd:COG4992                                   161 PLLPGFRHVPFNDIEALEAAIDEDTAAVIVEPIQGEGGVIPAPPEFLKALRELCDEHGALLILDEVQTGLGRTGKLFAYE 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 240 HYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERL 319
Cdd:COG4992                                   241 HYGVEPDILTLAKALGGGFPIGAMLATEEIASAFTPGDHGSTFGGNPLACAVALAVLEVLLEEGLLENVREKGEYLLQRL 320
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 320 NTINHRYGLFSEVRGLGLLIGCVLNADYagQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEH 399
Cdd:COG4992                                   321 RELKRRYPLVKEVRGRGLMIGIELKEPY--RARDIVRALREEGVLVLPAGPNVIRFLPPLVITEEEIDEALDALERALAA 398

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 400 FVSRGS 405
Cdd:COG4992                                   399 ASARVE 404
OAT_like cd00610
Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP) ...
18-396 1.13e-151

Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.


Pssm-ID: 99735 [Multi-domain]  Cd Length: 413  Bit Score: 435.07  E-value: 1.13e-151
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGY-TNEPVLRLAKKLIDAT-- 94
Cdd:cd00610                                    15 VRPYPLVIVRAEGAYLYDVDGNRYLDFLSGIGVLNLGHNHPEVVEALKEQLAKLTHFSLGFfYNEPAVELAELLLALTpe 94
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  95 FADRVFFCNSGAEANEAALKLARKFAHdrygshKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYND-- 172
Cdd:cd00610                                    95 GLDKVFFVNSGTEAVEAALKLARAYTG------RKKIISFEGAYHGRTLGALSLTGSKKYRGGFGPLLPGVLHVPYPYry 168
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 ------INSASALID------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:cd00610                                   169 rppaelADDLEALEEaleehpEEVAAVIVEPIQGEGGVIVPPPGYLKALRELCRKHGILLIADEVQTGFGRTGKMFAFEH 248
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVM--TVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVER 318
Cdd:cd00610                                   249 FGVEPDIVTLGKGLGGGLPLGAVLGREEIMDAFpaGPGLHGGTFGGNPLACAAALAVLEVLEEEGLLENAAELGEYLRER 328
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 319 LNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ------AKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDR 392
Cdd:cd00610                                   329 LRELAEKHPLVGDVRGRGLMIGIELVKDRATKppdkelAAKIIKAALERGLLLRPSGGNVIRLLPPLIITEEEIDEGLDA 408

                                                  ....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 393 FAAA 396
Cdd:cd00610                                   409 LDEA 412
Aminotran_3 pfam00202
Aminotransferase class-III;
22-396 4.64e-149

Aminotransferase class-III;


Pssm-ID: 395148 [Multi-domain]  Cd Length: 397  Bit Score: 427.90  E-value: 4.64e-149
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHT-GNGYTNEPVLRLAKKLIDATFADRVF 100
Cdd:pfam00202                                  10 LLFITKAKGCYLTDVDGNRYLDFYSGIAVTNLGHCHPALVAAVKTQADKLSHVsFGAFTNEPALDLAEKLLKLTPGDRVF 89
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 101 FCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQ-PAYSQDFAPLPADIRHAAYND------- 172
Cdd:pfam00202                                  90 LMNSGSEANETAVKLARKWYREKGATGRTKIIAFSGAFHGRTMGALSVTGSkPKYKTGFGPFLPGFPRLPYPDpeflkeq 169
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 -----INSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDL 247
Cdd:pfam00202                                 170 rcleeLEALIAVKDDEVAAVIVEPIQGEGGVNPPSPGFLAGLRAICKKHGVLLIADEVQTGFGRTGKLFAHEHWGVPPDI 249
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 248 LTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYG 327
Cdd:pfam00202                                 250 MTFAKALTGGFPLAATLGRAEVMQAFAPGSHGGTFGGNPLACAAALATLEIIEDEDLLQNAARLGAYLKEGLEDLQKKYE 329
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 328 LFSEVRGLGLLIGCVLNADYAGQAKqISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:pfam00202                                 330 VIKDVRGKGLMIGIELKEDVTVNPP-ILLAALEAGVLILPCGDNVIRLLPPLTITDEQIDEGLEIISKA 397
 
Name Accession Description Interval E-value
PRK12381 PRK12381
bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
1-406 0e+00

bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional


Pssm-ID: 183486 [Multi-domain]  Cd Length: 406  Bit Score: 880.60  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:PRK12381                                    1 MSQPITRENFDEWMVPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTN 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAP 160
Cdd:PRK12381                                   81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKYAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPKYSQDFAP 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 161 LPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK12381                                  161 LPPDIRHAAYNDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMH 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK12381                                  241 YGVTPDVLTTAKALGGGFPIGAMLTTEKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK12381                                  321 TINARYGLFSEIRGLGLLIGCVLNAEYAGKAKQISQEAAKAGVMVLIAGPNVVRFAPALNISEEEITTGLDRFARACERF 400

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 401 VSRGSS 406
Cdd:PRK12381                                  401 VSRGSS 406
arg_catab_astC TIGR03246
succinylornithine transaminase family; Members of the seed alignment for this protein family ...
5-401 0e+00

succinylornithine transaminase family; Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason. [Energy metabolism, Amino acids and amines]


Pssm-ID: 274490 [Multi-domain]  Cd Length: 397  Bit Score: 792.02  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   5 ITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVL 84
Cdd:TIGR03246                                   1 VTRQDFDEVMVPVYAPAPFIPVRGEGSRVWDQQGKEYIDFAGGIAVNALGHAHPELVKALIEQAQKLWHIGNGYTNEPVL 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  85 RLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPAD 164
Cdd:TIGR03246                                  81 RLAKKLVDATFADRVFFCNSGAEANEAALKLARKYALDRHGAHKSEIVAFKNSFHGRTLFTVSVGGQPKYSQDFAPLPGG 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 165 IRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVT 244
Cdd:TIGR03246                                 161 IKHAPYNDLAAAKALIDDKTCAVIVEPIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVT 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 245 PDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINH 324
Cdd:TIGR03246                                 241 PDILTTAKALGGGFPIGAMLTTTEIAAVLTVGTHGTTYGGNPLACAVAGKVLDLVNTPEVLAGVKQRHDWFVDRLEKINA 320
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 325 RYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFV 401
Cdd:TIGR03246                                 321 RYNVFSEIRGKGLLIGCVLTAAYAGKAKQIVNAAAEEGVMALIAGPNVVRFAPSLVISDEDIDEGLARFERAVEQFV 397
argD PRK05093
acetylornithine/succinyldiaminopimelate transaminase;
1-402 0e+00

acetylornithine/succinyldiaminopimelate transaminase;


Pssm-ID: 179933 [Multi-domain]  Cd Length: 403  Bit Score: 746.36  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:PRK05093                                    2 EQTAVTRATFDEVMVPNYAPAEFIPVRGEGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVKALKEQGEKLWHISNVFTN 81
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAP 160
Cdd:PRK05093                                   82 EPALRLAKKLIDATFAERVFFANSGAEANEAAFKLARRYACDRHGPEKTEIIAFHNSFHGRTLFTVSVGGQPKYSDGFGP 161
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 161 LPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK05093                                  162 KPADITHVPFNDLAAVKAVIDDHTCAVVVEPIQGEGGVIPATPEFLQGLRELCDQHNALLIFDEVQTGMGRTGDLFAYMH 241
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK05093                                  242 YGVTPDILTSAKALGGGFPIGAMLTTAEIASHFKVGTHGSTYGGNPLACAVAEAVFDIINTPEVLEGVKARRQRFVDGLQ 321
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK05093                                  322 KINQKYGVFSEIRGMGLLIGAELKPQYKGRARDFLNAAAEEGVMVLVAGPDVLRFAPSLVIEEADIDEGLARFEKAVAKV 401

                                                  ..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 401 VS 402
Cdd:PRK05093                                  402 VA 403
argD TIGR00707
transaminase, acetylornithine/succinylornithine family; This family of proteins, for which ...
13-397 0e+00

transaminase, acetylornithine/succinylornithine family; This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase. However, the two very closely related members from E. coli are assigned different enzymatic activities. One is acetylornithine aminotransferase (EC 2.6.1.11), ArgD, an enzyme of arginine biosynthesis, while another is succinylornithine aminotransferase, an enzyme of the arginine succinyltransferase pathway, an ammonia-generating pathway of arginine catabolism (See MEDLINE:98361920). Members of this family may also act on ornithine, like ornithine aminotransferase (EC 2.6.1.13) (see MEDLINE:90337349) and on succinyldiaminopimelate, like N-succinyldiaminopmelate-aminotransferase (EC 2.6.1.17, DapC, an enzyme of lysine biosynthesis) (see MEDLINE:99175097)


Pssm-ID: 273228 [Multi-domain]  Cd Length: 379  Bit Score: 633.25  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  13 WMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLID 92
Cdd:TIGR00707                                   1 YMMNTYGRLPVKIVRGKGSYVYDVNGKEYLDFVAGIAVNALGHAHPKLVEALKEQAEKLWHTSNLYYTEPQEELAEKLVE 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  93 ATFADRVFFCNSGAEANEAALKLARKFAHDRyGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYND 172
Cdd:TIGR00707                                  81 HSGADRVFFCNSGAEANEAALKLARKYTGDK-GSEKKKIVAFENAFHGRTMGTLSATGQPKYQKGFEPLVPGFSYAPYND 159
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 INSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAK 252
Cdd:TIGR00707                                 160 IESLKAAIDDETAAVIVEPIQGEGGVVPASAEFLKALREICKDKDALLIFDEVQTGVGRTGKLFAYEHYGVEPDIITLAK 239
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 253 ALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGlFSEV 332
Cdd:TIGR00707                                 240 GLGGGVPIGATLAKEEVAEAFTPGDHGSTFGGNPLACAAALAVLEVIEKERLLENVKEKGDYFVERLEELGKNYG-LKEV 318
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 333 RGLGLLIGCVLNADYagqaKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAAC 397
Cdd:TIGR00707                                 319 RGKGLMLGIELEAPY----KDIVKEALEAGLLVNTAGPNVLRFLPPLIITEEEIDEAVDALEAAI 379
ArgD COG4992
Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and ...
1-405 0e+00

Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 227325 [Multi-domain]  Cd Length: 404  Bit Score: 626.12  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:COG4992                                     4 ELTAATIELFMKYLMPTYGRLPVVIVRGEGAYVWDQQGREYLDFAAGIAVNNLGHCHPALVEALKEQAEKLWHVSNLFYN 83
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDAT-FADRVFFCNSGAEANEAALKLARKFAHDRygsHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFA 159
Cdd:COG4992                                    84 EPQAELAEKLVELSpFADRVFFCNSGAEANEAALKLARKYTGDP---EKSKIIAFENSFHGRTLGALSATGQPKYRKGFG 160
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 160 PLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYM 239
Cdd:COG4992                                   161 PLLPGFRHVPFNDIEALEAAIDEDTAAVIVEPIQGEGGVIPAPPEFLKALRELCDEHGALLILDEVQTGLGRTGKLFAYE 240
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 240 HYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERL 319
Cdd:COG4992                                   241 HYGVEPDILTLAKALGGGFPIGAMLATEEIASAFTPGDHGSTFGGNPLACAVALAVLEVLLEEGLLENVREKGEYLLQRL 320
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 320 NTINHRYGLFSEVRGLGLLIGCVLNADYagQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEH 399
Cdd:COG4992                                   321 RELKRRYPLVKEVRGRGLMIGIELKEPY--RARDIVRALREEGVLVLPAGPNVIRFLPPLVITEEEIDEALDALERALAA 398

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 400 FVSRGS 405
Cdd:COG4992                                   399 ASARVE 404
PRK02627 PRK02627
acetylornithine aminotransferase; Provisional
1-400 0e+00

acetylornithine aminotransferase; Provisional


Pssm-ID: 235056 [Multi-domain]  Cd Length: 396  Bit Score: 559.75  E-value: 0e+00
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80
Cdd:PRK02627                                    1 MTSEAIIELEKKYLMNTYGRLPIAFVRGEGARLWDDDGKEYLDFLAGIAVNNLGHCHPKLVEAIQEQAAKLIHTSNLYYI 80
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  81 EPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGShKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAP 160
Cdd:PRK02627                                   81 EPQEELAEKLVELSGMDKVFFCNSGAEANEAAIKLARKYGHKKGIE-KPEIITAENSFHGRTLATLSATGQPKYQEGFEP 159
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 161 LPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK02627                                  160 LVEGFIYVPFNDIEALKAAITDKTAAVMLEPIQGEGGVNPADKEYLQALRELCDENGILLILDEVQTGMGRTGKLFAYQH 239
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK02627                                  240 YGIEPDIMTLAKGLGGGVPIGAVLAKEKVADVFTPGDHGSTFGGNPLACAAALAVIEIIEEEGLLENAAEVGEYLRAKLR 319
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADyagqAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK02627                                  320 ELLEKYPGIKEVRGLGLMIGIELDRP----AAEIVKKALEKGLLINVTGDNVLRLLPPLIISKEEIDEAVDRLEEVLKEL 395
argD PRK01278
acetylornithine transaminase protein; Provisional
14-400 9.70e-172

acetylornithine transaminase protein; Provisional


Pssm-ID: 179270 [Multi-domain]  Cd Length: 389  Bit Score: 485.11  E-value: 9.70e-172
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  14 MIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDA 93
Cdd:PRK01278                                    6 LLPVYNRADLAFERGEGVWLIDEDGERYLDFASGIAVNSLGHAHPHLVEALKEQAEKLWHVSNLYRIPEQERLAERLVEN 85
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  94 TFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDI 173
Cdd:PRK01278                                   86 SFADKVFFTNSGAEAVECAIKTARRYHYGKGHPERYRIITFEGAFHGRTLATIAAGGQEKYLEGFGPLVPGFDQVPFGDI 165
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 174 NSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKA 253
Cdd:PRK01278                                  166 EALKAAITPNTAAILIEPIQGEGGIRPAPDEFLKGLRQLCDENGLLLIFDEVQCGMGRTGKLFAHEWAGVTPDIMAVAKG 245
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 254 LGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRY-GLFSEV 332
Cdd:PRK01278                                  246 IGGGFPLGACLATEEAAKGMTPGTHGSTYGGNPLAMAVGNAVLDVILAPGFLDNVQRMGLYLKQKLEGLVDRFpDVIEEV 325
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 333 RGLGLLIGCVLNADyagqAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
Cdd:PRK01278                                  326 RGKGLLLGLKCVVP----NRDLVQALRDEGLLTVGAGDNVVRLLPPLIITEEEIDEALERLERAAESL 389
OAT_like cd00610
Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP) ...
18-396 1.13e-151

Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase, alanine-glyoxylate aminotransferase, dialkylglycine decarboxylase, 4-aminobutyrate aminotransferase, beta-alanine-pyruvate aminotransferase, adenosylmethionine-8-amino-7-oxononanoate aminotransferase, and glutamate-1-semialdehyde 2,1-aminomutase. All the enzymes belonging to this family act on basic amino acids and their derivatives are involved in transamination or decarboxylation.


Pssm-ID: 99735 [Multi-domain]  Cd Length: 413  Bit Score: 435.07  E-value: 1.13e-151
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGY-TNEPVLRLAKKLIDAT-- 94
Cdd:cd00610                                    15 VRPYPLVIVRAEGAYLYDVDGNRYLDFLSGIGVLNLGHNHPEVVEALKEQLAKLTHFSLGFfYNEPAVELAELLLALTpe 94
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  95 FADRVFFCNSGAEANEAALKLARKFAHdrygshKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYND-- 172
Cdd:cd00610                                    95 GLDKVFFVNSGTEAVEAALKLARAYTG------RKKIISFEGAYHGRTLGALSLTGSKKYRGGFGPLLPGVLHVPYPYry 168
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 ------INSASALID------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:cd00610                                   169 rppaelADDLEALEEaleehpEEVAAVIVEPIQGEGGVIVPPPGYLKALRELCRKHGILLIADEVQTGFGRTGKMFAFEH 248
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVM--TVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVER 318
Cdd:cd00610                                   249 FGVEPDIVTLGKGLGGGLPLGAVLGREEIMDAFpaGPGLHGGTFGGNPLACAAALAVLEVLEEEGLLENAAELGEYLRER 328
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 319 LNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ------AKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDR 392
Cdd:cd00610                                   329 LRELAEKHPLVGDVRGRGLMIGIELVKDRATKppdkelAAKIIKAALERGLLLRPSGGNVIRLLPPLIITEEEIDEGLDA 408

                                                  ....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 393 FAAA 396
Cdd:cd00610                                   409 LDEA 412
Aminotran_3 pfam00202
Aminotransferase class-III;
22-396 4.64e-149

Aminotransferase class-III;


Pssm-ID: 395148 [Multi-domain]  Cd Length: 397  Bit Score: 427.90  E-value: 4.64e-149
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHT-GNGYTNEPVLRLAKKLIDATFADRVF 100
Cdd:pfam00202                                  10 LLFITKAKGCYLTDVDGNRYLDFYSGIAVTNLGHCHPALVAAVKTQADKLSHVsFGAFTNEPALDLAEKLLKLTPGDRVF 89
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 101 FCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQ-PAYSQDFAPLPADIRHAAYND------- 172
Cdd:pfam00202                                  90 LMNSGSEANETAVKLARKWYREKGATGRTKIIAFSGAFHGRTMGALSVTGSkPKYKTGFGPFLPGFPRLPYPDpeflkeq 169
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 -----INSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDL 247
Cdd:pfam00202                                 170 rcleeLEALIAVKDDEVAAVIVEPIQGEGGVNPPSPGFLAGLRAICKKHGVLLIADEVQTGFGRTGKLFAHEHWGVPPDI 249
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 248 LTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYG 327
Cdd:pfam00202                                 250 MTFAKALTGGFPLAATLGRAEVMQAFAPGSHGGTFGGNPLACAAALATLEIIEDEDLLQNAARLGAYLKEGLEDLQKKYE 329
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 328 LFSEVRGLGLLIGCVLNADYAGQAKqISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:pfam00202                                 330 VIKDVRGKGLMIGIELKEDVTVNPP-ILLAALEAGVLILPCGDNVIRLLPPLTITDEQIDEGLEIISKA 397
argD PRK03244
acetylornithine transaminase;
6-396 2.96e-145

acetylornithine transaminase;


Pssm-ID: 235112 [Multi-domain]  Cd Length: 398  Bit Score: 418.16  E-value: 2.96e-145
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   6 TRENFDEWMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLR 85
Cdd:PRK03244                                   10 LLQRWQAVMMNNYGTPPLALVRGEGAVVWDVDGKEYLDLLGGIAVNALGHAHPAVVEAVTRQLATLGHVSNLFATEPQIA 89
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  86 LAKKLIDATFAD---RVFFCNSGAEANEAALKLARkfahdRYGSHKsgIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLP 162
Cdd:PRK03244                                   90 LAERLVELLGAPeggRVFFCNSGAEANEAAFKLAR-----LTGRTK--IVAAEGGFHGRTMGALALTGQPAKRAPFEPLP 162
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 163 ADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYG 242
Cdd:PRK03244                                  163 GGVEHVPYGDVDALAAAVDDDTAAVFLEPIQGEAGVVPPPAGYLAAAREITDRHGALLVLDEVQTGIGRTGAWFAHQHDG 242
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 243 VTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTI 322
Cdd:PRK03244                                  243 VTPDVVTLAKGLGGGLPIGACLAFGPAADLLTPGLHGSTFGGNPVACAAALAVLDTIASEGLLENAERLGEQLRAGIEAL 322
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 323 NHryGLFSEVRGLGLLIGCVLNADYagqAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK03244                                  323 GH--PLVDHVRGRGLLLGIVLTAPV---AKAVEAAAREAGFLVNAVAPDVIRLAPPLIITDAQVDAFVAALPAI 391
argD PRK04612
acetylornithine transaminase;
13-403 4.42e-139

acetylornithine transaminase;


Pssm-ID: 179868 [Multi-domain]  Cd Length: 408  Bit Score: 403.17  E-value: 4.42e-139
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  13 WMIPVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLID 92
Cdd:PRK04612                                   14 YYLPVYRPRQVVLERGQGSRVWDDQGREYLDLAAGIAVCGLGHNDPDLVAALTEQAGKLWHTSNVFYSAPPLKLAEELVT 93
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  93 AT-FADRVFFCNSGAEANEAALKLARKFA--HDRYGSHKSgIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAA 169
Cdd:PRK04612                                   94 ASrFAEKVFLCNSGTEANEAAIKLVRKWAssQGRPADKRV-IVTFRGSFHGRTLAAVTATAQPKYQEGYEPLPGGFRYVD 172
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 170 YNDINS-ASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248
Cdd:PRK04612                                  173 FNDVEAlEAAMAGGDVAAVMLEPIQGEGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDIV 252
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 249 TTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGL 328
Cdd:PRK04612                                  253 TLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASPQIAANVARQSAALRAGLEALNAEFGV 332
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 329 FSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSR 403
Cdd:PRK04612                                  333 FAQVRGRGLMLGAVLAPAHAGQAGAILDLAAEHGLLLLQAGPDVLRFVPALNLTDAELADGLARLRLALADYVAQ 407
argD PRK02936
acetylornithine transaminase;
16-391 1.06e-136

acetylornithine transaminase;


Pssm-ID: 179505 [Multi-domain]  Cd Length: 377  Bit Score: 395.87  E-value: 1.06e-136
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  16 PVYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATF 95
Cdd:PRK02936                                    6 PTYGRFPIDIVKGKGTKVTDNNGKTYLDFTSGIAVCNLGHCHPTVTKAVQEQLDDIWHVSNLFTNSLQEEVASLLAENSA 85
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  96 ADRVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINS 175
Cdd:PRK02936                                   86 GDLVFFCNSGAEANEAALKLARKH------TGKSKIVTFEQSFHGRTFGTMSATGQEKIKEGFGPLLPGFTHVPFNDIKA 159
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 176 ASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALG 255
Cdd:PRK02936                                  160 LKEVMNEEVAAVMLEVVQGEGGVIPADPAFLQEVQTLCKKFGALLIIDEVQTGIGRTGTLFAYEQFGLDPDIVTVAKGLG 239
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 256 GGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGL 335
Cdd:PRK02936                                  240 NGIPVGAMIGKKELGTAFGPGSHGSTFGGNPLAMAAAKEVLQVIKQPSFLEEVQEKGEYFLQKLQEELEHLECVKNIRGK 319
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 336 GLLIGCVLNADYAGQAKQISQEaakaGVMVLIAGGNVVRFAPALNVSEEEVTTGLD 391
Cdd:PRK02936                                  320 GLMIGIECTEEVAPVIEQLREE----GLLVLSAGPNVIRLLPPLVVTKEELDQAVY 371
argD PRK03715
acetylornithine transaminase protein; Provisional
26-386 6.03e-136

acetylornithine transaminase protein; Provisional


Pssm-ID: 179636 [Multi-domain]  Cd Length: 395  Bit Score: 394.44  E-value: 6.03e-136
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  26 VRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSG 105
Cdd:PRK03715                                   23 THGKGSWLYDHNGKRYLDFIQGWAVNCLGHCNPGMVEALAAQAEKLINPSPAFYNEPMAKLAGLLTQHSCFDKVFFANSG 102
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 106 AEANEAALKLARKfahdrYGS-HKSG---IVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALID 181
Cdd:PRK03715                                  103 AEANEGAIKLARK-----WGRkHKNGayeIITFDHSFHGRTLATMSASGKPGWDTIFAPQVPGFPKAELNDIASVEKLIT 177
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 182 DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVG 261
Cdd:PRK03715                                  178 DKTVAVMLEPVQGEGGVIPATREFMQQLRALTKQHGLLLIVDEVQTGCGRTGTLFAYELSGIEPDIMTLGKGIGGGVPLA 257
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 262 ALLATEECArVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLfSEVRGLGLLIGC 341
Cdd:PRK03715                                  258 ALLAKAEVA-VFEAGDQGGTYNGNPLMTAVGVAVISQLLAPGFLEGVRARGEYLKEKLLELSEERGL-EGERGEGLLRAL 335
                                                         330       340       350       360
                                                  ....*....|....*....|....*....|....*....|....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 342 VLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEV 386
Cdd:PRK03715                                  336 LLGKDIGPQIVEKARDMQPDGLLLNAPRPNLLRFMPALNVTTEEI 380
PLN00144 PLN00144
acetylornithine transaminase
26-391 3.08e-132

acetylornithine transaminase


Pssm-ID: 177748 [Multi-domain]  Cd Length: 382  Bit Score: 384.44  E-value: 3.08e-132
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  26 VRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSG 105
Cdd:PLN00144                                    2 VSGKGCKLYDVEGKEYLDMAAGIAVNALGHGDPDWVKAVAEQAGTLAHVSNVYHTIPQVELAKRLVASSFADRVFFCNSG 81
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 106 AEANEAALKLARKFAHDRYGSHK-------SGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASA 178
Cdd:PLN00144                                   82 TEANEAAIKFARKYQRVRAPDKKdpaassaTEFVSFSNSFHGRTLGALALTSKEQYRTPFEPLMPGVTFVEYGNLEAARK 161
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 179 LID-DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG 257
Cdd:PLN00144                                  162 LIQkGKTAAVFVEPVQGEGGIYPATKEFLQGLRALCDEAGALLVFDEVQCGLGRTGYLWAHEAYGVEPDIMTLAKPLAGG 241
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 258 FPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGL 337
Cdd:PLN00144                                  242 LPIGAVLVTEKVASAINPGDHGSTFAGGPLVCNAALAVLDKISKPGFLASVAKKGEYLRELLRRKLGGNPHVKEVRGVGL 321
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 338 LIGCVLNAdyagQAKQISQEAAKAGVMVLIAG-GNVVRFAPALNVSEEEVTTGLD 391
Cdd:PLN00144                                  322 LVGIQLDV----PAGPLVDACRDSGLLVLTAGkGDVVRLVPPLVISEAELEQAVE 372
GabT COG0160
4-aminobutyrate aminotransferase or related aminotransferase [Amino acid transport and ...
22-396 1.15e-128

4-aminobutyrate aminotransferase or related aminotransferase [Amino acid transport and metabolism];


Pssm-ID: 223238 [Multi-domain]  Cd Length: 447  Bit Score: 377.71  E-value: 1.15e-128
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN-EPVLRLAKKL---IDATFAD 97
Cdd:COG0160                                    39 PLVIVRAEGAYLYDVDGNEYLDFLSGIAVLNLGHNHPRVVEAVKRQLAKLNHTHTRDLYyEPYVELAEKLtalAPGSGLK 118
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGG-QPAYSQDFAPLPADIRHAAYNDINSA 176
Cdd:COG0160                                   119 KVFFGNSGAEAVEAAIKIARAY------TGRPGVIAFDGAFHGRTLGALSLTGsKPPYKAGFGPLPPGVYHVPYPNPYRC 192
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 177 SALIDDSTC-----------------------AVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:COG0160                                   193 PFGIGGEECgddaleyieralfdlevgpeevaAIIIEPIQGEGGIIVPPKGFLKALRKLCREHGILLIADEVQTGFGRTG 272
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEEcarVMT--VGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQR 311
Cdd:COG0160                                   273 KMFAFEHFGVEPDIVTLAKSLGGGLPLSAVVGRAE---IMDwpPGGHGGTFGGNPVACAAALAVLDVIEEENLLERAAEL 349
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNAD------YAGQAKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSE 383
Cdd:COG0160                                   350 GEYLRDRLEELQEKHPLIGDVRGLGLMIGVELVKDrdtkepDAELAAKIVARAFERGLLLLTCGphGNVLRILPPLTISD 429
                                                         410
                                                  ....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 384 EEVTTGLDRFAAA 396
Cdd:COG0160                                   430 EELDEGLDILEEA 442
PRK05769 PRK05769
acetyl ornithine aminotransferase family protein;
22-391 1.26e-123

acetyl ornithine aminotransferase family protein;


Pssm-ID: 235599 [Multi-domain]  Cd Length: 441  Bit Score: 364.62  E-value: 1.26e-123
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWH-TGNGYTNEPVLRLAKKLIDAT---FAD 97
Cdd:PRK05769                                   37 PLVIERGEGVWVEDVDGNVYLDFNAGIAVTNVGHAHPKVVKAVKEQAEKFLHySLTDFYYEPAVELAERLVEIApggFEK 116
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFCNSGAEANEAALKLArkfahdRYGSHKSGIVAFKNAFHGRTLFTVS-AGGQPAYSQDFAPLPADIRHAAYND---- 172
Cdd:PRK05769                                  117 KVFFTNSGTESNEAAIKIA------RYHTGRKYIIAFLGAFHGRTYGSLSlTASKPVQRKGFFPLMPGVIHVPYPNpyrn 190
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 ----------INSASALIDDST----------CAVIVEPIQGEGG-VVPASNaFLQGLRELCNRHNALLIFDEVQTGVGR 231
Cdd:PRK05769                                  191 pwgienpeecGNAVLDFIEDYLfkklvppeevAAIIVEPIQGEGGyVVPPKN-FFKELRKLADKYGILLIDDEVQTGMGR 269
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 232 TGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEEcarVMT--VGTHGTTYGGNPLASAVAGKVLELINTpEMLNGVK 309
Cdd:PRK05769                                  270 TGKMFAIEHFGVEPDIITLAKAIAGGLPLGAVIGRAE---LMFlpPGSHANTFGGNPVAAAAALATLEELEE-GLLENAQ 345
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 310 QRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNAD----YAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEE 385
Cdd:PRK05769                                  346 KLGEYLRKELKELKEKYEFIGDVRGLGLMIGVELVKDrkepDPKLRDKVLYEAFKRGLLLLGAGKSAIRIIPPLIITEEE 425

                                                  ....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 386 VTTGLD 391
Cdd:PRK05769                                  426 ADIGLE 431
PTZ00125 PTZ00125
ornithine aminotransferase-like protein; Provisional
18-392 1.29e-114

ornithine aminotransferase-like protein; Provisional


Pssm-ID: 240281 [Multi-domain]  Cd Length: 400  Bit Score: 340.50  E-value: 1.29e-114
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEpVLRLAKKLIDATFA- 96
Cdd:PTZ00125                                   10 YHPLPVVLKRGKGVFVWDVEGKKYYDFLSAYSAVNQGHCHPKILAALINQAQKLTLTSRAFYND-VLGLAEKYITDLFGy 88
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN 174
Cdd:PTZ00125                                   89 DKVLPMNSGAEAGETALKFARKWGYEVKGipENQAKIIFCNGNFSGRTIGACSASTDPKCYNNFGPFVPGFELVDYNDVE 168
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 175 SASALIDDS-TCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKA 253
Cdd:PTZ00125                                  169 ALEKLLQDPnVAAFIVEPIQGEAGVIVPDDGYLKQVYELCKKYNVLLIVDEIQTGLGRTGKLLAHDHEGVKPDIVLLGKA 248
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 254 LGGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEV 332
Cdd:PTZ00125                                  249 LSGGLyPISAVLANDDVMLVIKPGEHGSTYGGNPLACAVAVEALEVLKEEKLAENAQRLGEVFRDGLKELLKKSPWVKEI 328
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 333 RGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDR 392
Cdd:PTZ00125                                  329 RGKGLLNAIVFDHSDGVNAWDLCLKLKENGLLAKPTHDNIIRFAPPLVITKEQLDQALEI 388
PRK04260 PRK04260
acetylornithine transaminase;
18-390 3.45e-114

acetylornithine transaminase;


Pssm-ID: 179803 [Multi-domain]  Cd Length: 375  Bit Score: 338.35  E-value: 3.45e-114
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHaHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIdatfAD 97
Cdd:PRK04260                                    8 YKRAAIEFVKAEGNYLIDTDGKKYLDFSSGIGVTNLGF-HPQVQQALQKQAGLIWHSPNLYLNSLQEEVAQKLI----GD 82
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 R---VFFCNSGAEANEAALKLARKfahdryGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN 174
Cdd:PRK04260                                   83 KdylAFFCNSGAEANEAAIKIARK------ATGKQEIITFQNSFHGRTFGSMSATGQDKIKDGFGDGVPHFSYAIFNDLN 156
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 175 SASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL 254
Cdd:PRK04260                                  157 SVKALVNKNTAAVMLELVQGESGVLPADKDFVKALADYCQETGILLIVDEVQTGMGRTGKLYAFEHYGIEPDIFTLAKGL 236
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 255 GGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRG 334
Cdd:PRK04260                                  237 ANGVPVGAMLAKSSLGGAFGYGSHGSTFGGNKLSMAAASATLDIMLTAGFLEQALENGNYLQEQLQKALQDKETVTTVRG 316
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 335 LGLLIGCVLNADYAgqakQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGL 390
Cdd:PRK04260                                  317 LGYMIGIETTADLS----QLVEAARDKGLIVLTAGTNVIRLLPPLTLTKEEIEQGI 368
PRK08117 PRK08117
aspartate aminotransferase family protein;
21-391 1.75e-110

aspartate aminotransferase family protein;


Pssm-ID: 181234 [Multi-domain]  Cd Length: 433  Bit Score: 330.84  E-value: 1.75e-110
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  21 APFIPV-RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNG-YTNEPVLRLAKKLIDATFA-- 96
Cdd:PRK08117                                   24 HPNLPVvKGEGCYYYGVDGKEYLDFTSGIAVANVGHRHPKVVQAIKEQADKLMHGPSGvIYYESILKLAEELAEITPGgl 103
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARkfahdrYGSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYNDINS 175
Cdd:PRK08117                                  104 DCFFFSNSGAEAIEGALKLAK------HVTKRPYIISFTGCFHGRTLGALSVTTSKSkYRKYYQPLLGSVYQAPYPYCDR 177
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 176 ASALIDDSTC----------------------AVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:PRK08117                                  178 CPKGEDPEVCfleclrdleslfkhqvtpeevaAVIIEPVLGEGGYIVPPKSFLKKLREICDRHGILLIFDEVQTGFGRTG 257
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHD 313
Cdd:PRK08117                                  258 EWFAAQTFGVVPDIMTIAKGIASGLPLSAVVASKELMEQWPLGSHGTTFGGNPVACAAALATLEVIKEEKLLDNANEMGA 337
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 314 WFVERLNTINHRYGLFSEVRGLGLLIGCVL---NADYAGQA-KQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVT 387
Cdd:PRK08117                                  338 YALERLEVLKEKHPVIGDVRGIGLMIGIEIvdpDGEPDGDAvEKILDKCLEKGLLFYLCGnaGNVLRMIPPLTVTKEEID 417

                                                  ....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 388 TGLD 391
Cdd:PRK08117                                  418 EGLD 421
Orn_aminotrans TIGR01885
ornithine aminotransferase; This model describes the final step in the biosynthesis of ...
24-391 1.11e-102

ornithine aminotransferase; This model describes the final step in the biosynthesis of ornithine from glutamate via the non-acetylated pathway. Ornithine amino transferase takes L-glutamate 5-semialdehyde and makes it into ornithine, which is used in the urea cycle, as well as in the biosynthesis of arginine. This model includes low-GC bacteria and eukaryotic species. The genes from two species are annotated as putative acetylornithine aminotransferases - one from Porphyromonas gingivalis (OMNI|PG1271), and the other from Staphylococcus aureus (OMNI|SA0170). After homology searching using BLAST it was determined that these two sequences were most closely related to ornithine aminotransferases. This model's seed includes one characterized hit, from Bacillus subtilis (SP|P38021).


Pssm-ID: 273853 [Multi-domain]  Cd Length: 401  Bit Score: 310.03  E-value: 1.11e-102
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  24 IPV---RGEGSRLWDQQGKEYIDF-AGGIAVNAlGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRV 99
Cdd:TIGR01885                                  19 LPVvfsKAEGVHVWDVEGKRYLDFlSAYSAVNQ-GHCHPKIVKALTEQAQKLTLSSRAFYNDVFGEFAEYVTKLFGYDKV 97
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 100 FFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSAS 177
Cdd:TIGR01885                                  98 LPMNTGAEAVETAIKLARKWGYKVKGipENQAIIVSAKGNFHGRTLGAISMSTDPDSRTNFGPYVPGFKKIPYNNLEALE 177
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 178 ALIDDS---TCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL 254
Cdd:TIGR01885                                 178 EALEDHgpnVCAFIVEPIQGEAGVVVPDDGYLKKVRELCTKHNVLLIADEIQTGLGRTGKLLCVDHENVKPDIVLLGKAL 257
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 255 GGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHryGLFSEVR 333
Cdd:TIGR01885                                 258 SGGVyPVSAVLADDDVMLTIKPGEHGSTYGGNPLACAVAVAALEVLEEEKLAENAEKLGEIFRDQLKKLPK--PIITEVR 335
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 334 GLGLLIGCVLNADYAGQ-AKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLD 391
Cdd:TIGR01885                                 336 GRGLLNAIVIDESKTGRtAWDLCLKLKEKGLLAKPTHGNIIRLAPPLVITEEQLDEGLE 394
BioA COG0161
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme transport and metabolism]; ...
17-403 1.57e-95

Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme transport and metabolism];


Pssm-ID: 223239 [Multi-domain]  Cd Length: 449  Bit Score: 293.30  E-value: 1.57e-95
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  17 VYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--FWHTGnGYTNEPVLRLAKKLIDAT 94
Cdd:COG0161                                    22 DPLAEPRVIVRAEGVYLTDIDGRRYLDGMSGLWCVNHGHGRPEIAEAIKKQLDKlpHVMFG-GFTHEPAIELAEKLAELA 100
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  95 FA---DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAY----------SQDFAPL 161
Cdd:COG0161                                   101 PEgglDHVFFTDSGSEAVETALKMALQYWRARGQPQRKKFISRRNGYHGDTLGAMSVGGPVALrhafydpllpEVLHLPA 180
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 162 PADIRHAAYND--------INSASALID----DSTCAVIVEPI-QGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTG 228
Cdd:COG0161                                   181 PYAYRRGFFGEgdeefaeaADELEALILehgpETIAAFIVEPVvGGAGGMLVPPPGYLKRVREICDKYGILLIADEVATG 260
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 229 VGRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVG-----THGTTYGGNPLASAVAGKVLELINTP 302
Cdd:COG0161                                   261 FGRTGKMFACEHAGIVPDILCLAKGLTGGYlPLSAVLTSDRIYEAFSDGdagafMHGHTYSGNPLACAAALANLDILEEE 340
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 303 EMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ-------AKQISQEAAKAGVMVLiAGGNVVRF 375
Cdd:COG0161                                   341 DLLERVAEIGAYLQAGLQAALADHPLVGDVRGLGLIGAIELVADKATKtpfearvGARVRAAALERGLLIR-PLGDVIYL 419
                                                         410       420
                                                  ....*....|....*....|....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 376 APALNVSEEEVTTGLDRFAAACEHFVSR 403
Cdd:COG0161                                   420 MPPLIITREEIDELVDALREALDETLAD 447
PLN02624 PLN02624
ornithine-delta-aminotransferase
18-399 1.16e-85

ornithine-delta-aminotransferase


Pssm-ID: 215335 [Multi-domain]  Cd Length: 474  Bit Score: 268.57  E-value: 1.16e-85
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGI-AVNAlGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFA 96
Cdd:PLN02624                                   54 YHPIPVVFSRAKGSRIWDPEGKKYLDFLSAYsAVNQ-GHCHPKIIKALTEQAEKLTLSSRAFYNDKFPEFAEYLTSMFGY 132
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSG--IVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN 174
Cdd:PLN02624                                  133 DMVLPMNTGAEGVETAIKLARKWGYEKKGIPKNEaiIVSCCGCFHGRTLAAISMSCDNEATRGFGPLLPGHLKVDFGDLD 212
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 175 SASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTA 251
Cdd:PLN02624                                  213 ALEKIFEedgDRIAAFLFEPIQGEAGVVIPPDGYLKAVRELCSKHNVLMIADEIQTGLARTGKMLACDWEEVRPDVVILG 292
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 252 KALGGG-FPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRY-GLF 329
Cdd:PLN02624                                  293 KALGGGvIPVSAVLADKDVMLCIKPGEHGSTFGGNPLASAVAMAALQVVQDEKLAERSAKLGQELRDQLQKIQKQFpKLI 372
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 330 SEVRGLGLLIGCVLNADYAGQAK--QISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEH 399
Cdd:PLN02624                                  373 KEVRGRGLLNAVVLNSPKLGPVSayDVCLKLKERGLLAKPTHDTIIRLAPPLSISEDELQECSKALSDVLEH 444
rocD PRK04073
ornithine--oxo-acid transaminase; Provisional
18-392 1.49e-84

ornithine--oxo-acid transaminase; Provisional


Pssm-ID: 179736 [Multi-domain]  Cd Length: 396  Bit Score: 263.12  E-value: 1.49e-84
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYIDFAGGI-AVNAlGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFA 96
Cdd:PRK04073                                   19 YHPLPIVISEAEGVWVKDPEGNRYMDMLSAYsAVNQ-GHRHPKIIQALKDQADKVTLTSRAFHSDQLGPWYEKVAKLTGK 97
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN 174
Cdd:PRK04073                                   98 DMVLPMNTGAEAVETAIKAARRWAYDVKGvePNKAEIIACEGNFHGRTMAAVSLSSEEEYKRGFGPMLPGIKKIPYGDLE 177
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 175 SASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL 254
Cdd:PRK04073                                  178 ALKAAITPNTAAFLVEPIQGEAGINIPPEGFLKAARELCKEENVLFIADEIQTGLGRTGKLFACDWDNVTPDMYILGKAL 257
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 255 GGG-FPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRygLFSEVR 333
Cdd:PRK04073                                  258 GGGvFPISCVAANRDILGVFTPGSHGSTFGGNPLACAVSIAALEVLEEEKLPERSLELGEYFKEQLKEIDNP--MIKEVR 335
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 334 GLGLLIGCVLNadyaGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDR 392
Cdd:PRK04073                                  336 GRGLFIGVELN----EPARPYCEALKEEGLLCKETHETVIRFAPPLVITKEELDWAFEK 390
argD PRK04013
acetylornithine/acetyl-lysine aminotransferase; Provisional
26-386 2.12e-83

acetylornithine/acetyl-lysine aminotransferase; Provisional


Pssm-ID: 101376 [Multi-domain]  Cd Length: 364  Bit Score: 259.08  E-value: 2.12e-83
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  26 VRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSG 105
Cdd:PRK04013                                   11 VRGEGIYVWDSQGRRYLDLIAGIGVNVLGHNHPEWVEEMSEQLEKLVVAGPMFEHEEKEEMLEELSKWVNYEYVYMGNSG 90
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 106 AEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTC 185
Cdd:PRK04013                                   91 TEAVEAALKFARLY------TGRKEIIAMTNAFHGRTMGALSATWKPKYREDFEPLVPGFKHIPFNDVEAAKEAITKETA 164
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 186 AVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVgRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLA 265
Cdd:PRK04013                                  165 AVIFEPIQGEGGIVPAKEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYKVEPDIVTMGKGIGNGVPVSLTLT 243
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 266 TEECARvmtvGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWF-VERLNTinhryglfseVRGLGLLIGCVLN 344
Cdd:PRK04013                                  244 NFDVER----GKHGSTFGGNPLACKAVAVTLRILRRERLVEKAGEKFIEIkGERVVT----------TRGRGLMIGIVLK 309
                                                         330       340       350       360
                                                  ....*....|....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 345 ADYAGQAKQISQEaakaGVMVLIAGGNVVRFAPALNVSEEEV 386
Cdd:PRK04013                                  310 KPVGKYVEELQNR----GYLVHTAGQRVIRLLPPLIISKDTM 347
PRK11522 PRK11522
putrescine--2-oxoglutarate aminotransferase; Provisional
3-398 5.49e-83

putrescine--2-oxoglutarate aminotransferase; Provisional


Pssm-ID: 183175 [Multi-domain]  Cd Length: 459  Bit Score: 261.21  E-value: 5.49e-83
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   3 QPITRE---NFDEWMIP--------VYASAPFIPV--RGEG-SRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQA 68
Cdd:PRK11522                                   32 KALNREvieYFKEHVNPgfleyrksVTAGGDYGAVewQAGGlNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQL 111
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  69 SKfwhtGNGYTNEPV--LR--LAKKLIDATFAD--RVFFCNSGAEANEAALKLARKFAHDRYgshKSGIVAFKNAFHGRT 142
Cdd:PRK11522                                  112 AK----QPLHSQELLdpLRamLAKTLAALTPGKlkYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKS 184
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 143 LFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN------SASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRH 216
Cdd:PRK11522                                  185 LGALSATAKSTFRKPFMPLLPGFRHVPFGNIEamrtalSECKKTGDDVAAVILEPIQGEGGVILPPEGYLTAVRKLCDEF 264
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 217 NALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG-FPVGALLATEECARVMTVG--THGTTYGGNPLASAVAG 293
Cdd:PRK11522                                  265 GALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGvMPIGATIATEEVFSVLFDNpfLHTTTFGGNPLACAAAL 344
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 294 KVLELI---NTPEMlngVKQRHDWFVERLNTINHRY-GLFSEVRGLGLLIGCVLNADYAGQAkqISQEAAKAGVMVliAG 369
Cdd:PRK11522                                  345 ATINVLleqNLPAQ---AEQKGDYLLDGFRQLAREYpDLVQEARGKGMLMAIEFVDNEIGYN--FASEMFRQRVLV--AG 417
                                                         410       420       430
                                                  ....*....|....*....|....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 370 ----GNVVRFAPALNVSEEEVTTGLDRFAAACE 398
Cdd:PRK11522                                  418 tlnnAKTIRIEPPLTLTIEQCEQVLKAARKALA 450
PRK06777 PRK06777
4-aminobutyrate--2-oxoglutarate transaminase;
23-396 1.68e-81

4-aminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 180690 [Multi-domain]  Cd Length: 421  Bit Score: 256.28  E-value: 1.68e-81
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  23 FIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGngYTNEPV---LRLAKKL-----IDAT 94
Cdd:PRK06777                                   24 FYAERAENATLWDVEGREYIDFAAGIAVLNTGHRHPKVVAAVRQQLDQFTHTA--YQIVPYasyVTLAERInalapIDGP 101
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  95 fADRVFFcNSGAEANEAALKLARkfAHDRygshKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYND- 172
Cdd:PRK06777                                  102 -AKTAFF-TTGAEAVENAVKIAR--AYTG----RPGVIAFGGAFHGRTLLTMALTGKVApYKVGFGPFPGSIFHALYPNe 173
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 ---INSASALID-----------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAY 238
Cdd:PRK06777                                  174 lhgVSVEEALSSverlfkadiapDQVAAILLEPIQGEGGFNVAPPEFMSALRTLCDEHGILLIADEVQTGFARTGKLFAM 253
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 239 MHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVER 318
Cdd:PRK06777                                  254 EYYDVKPDLITMAKSLGGGMPISAVVGRAEVMDAPAPGGLGGTYAGNPLAVAAALAVLDVIAEEKLCQRALILGAHLVEV 333
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 319 LNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ-----AKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGLD 391
Cdd:PRK06777                                  334 LEKAKASCPAIVDIRARGSMVAVEFNDPQTGKpspefTRQYQRQALEEGLLLLSCGvhGNVIRFLYPLTIPDAQFSKALN 413

                                                  ....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 392 RFAAA 396
Cdd:PRK06777                                  414 ILTRL 418
rocD PRK00854
ornithine--oxo-acid transaminase; Reviewed
18-395 1.92e-81

ornithine--oxo-acid transaminase; Reviewed


Pssm-ID: 234848 [Multi-domain]  Cd Length: 401  Bit Score: 255.48  E-value: 1.92e-81
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPFIPVRGEGSRLWDQQGKEYID-FAGGIAVNAlGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFA 96
Cdd:PRK00854                                   20 YKPLDVVLTRGEGVWVWDTDGNRYLDcLSAYSAVNQ-GHCHPKILAAMVEQAGRLTLTSRAFRNDQLAPLYEELAALTGS 98
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDIN 174
Cdd:PRK00854                                   99 HKVLPMNSGAEAVETAIKAVRKWGYEVKGvpEGQAEIIVCADNFHGRTLSIVGFSTDPDARGGFGPFTPGFRVVPFGDAE 178
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 175 SASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL 254
Cdd:PRK00854                                  179 ALEAAITPNTVAFLVEPIQGEAGVIIPPAGYFTRVRELCTANNVTLILDEIQTGLGRTGKLLAEEHEGIEADVTLIGKAL 258
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 255 GGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTInhRYGLFSEVR 333
Cdd:PRK00854                                  259 SGGFyPVSAVLSNSEVLGVLKPGQHGSTFGGNPLACAVARAALKVLTEEGMIENAAEMGAYFLEGLRSI--RSNIVREVR 336
                                                         330       340       350       360       370       380
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 334 GLGLLIGCVLNADyAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAA 395
Cdd:PRK00854                                  337 GRGLMLAVELEPE-AGGARQYCEALKERGLLAKDTHDHTIRLAPPLVITREQVDWALEQIAK 397
PRK07495 PRK07495
4-aminobutyrate--2-oxoglutarate transaminase;
27-391 1.02e-80

4-aminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 236032 [Multi-domain]  Cd Length: 425  Bit Score: 254.29  E-value: 1.02e-80
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  27 RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN-EPVLRLAKKLIDAT---FADRVFFC 102
Cdd:PRK07495                                   28 RAENAEIWDKEGRRYIDFAAGIAVVNTGHRHPRVIAAVKAQLDRFTHTCHQVVPyENYVRLAERLNALVpgdFAKKTIFV 107
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 103 NSGAEANEAALKLARKfahdryGSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAY----NDINSAS 177
Cdd:PRK07495                                  108 TTGAEAVENAVKIARA------ATGRSAVIAFGGGFHGRTFMGMSLTGKVVpYKVGFGAMMPDVYHVPFpvelHGVSVEQ 181
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 178 AL----------IDDS-TCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPD 246
Cdd:PRK07495                                  182 SLaaldklfkadVDPQrVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEVQTGFARTGKLFAMEHHEVAAD 261
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 247 LLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRY 326
Cdd:PRK07495                                  262 LTTMAKGLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIEEEDLCERANQLGNRLKQRLASLRETV 341
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 327 GLFSEVRGLGLLIGCVLN-----ADYAGQAKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGLD 391
Cdd:PRK07495                                  342 PEIADIRGPGFMNAVEFNdadsgLPSAEFANRVRLKALEKGLILLTCGvhGNVIRFLAPITIQDDVFAEALD 413
PRK08088 PRK08088
4-aminobutyrate--2-oxoglutarate transaminase;
22-391 4.26e-79

4-aminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 236149 [Multi-domain]  Cd Length: 425  Bit Score: 250.10  E-value: 4.26e-79
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGN---GYtnEPVLRLAKKL---IDATF 95
Cdd:PRK08088                                   24 PIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFqvlAY--EPYLELCEKMnqkVPGDF 101
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  96 ADRVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYN--- 171
Cdd:PRK08088                                  102 AKKTLLVTTGSEAVENAVKIARAA------TKRSGVIAFTGAYHGRTHYTLALTGKVNpYSAGMGLMPGHVYRALYPcpl 175
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 172 ---DINSASALID---------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYM 239
Cdd:PRK08088                                  176 hgvSEDDAIASIErifkndaapEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQTGAGRTGTLFAME 255
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 240 HYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERL 319
Cdd:PRK08088                                  256 QMGVAADLTTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLKVFEQENLLQKANALGEKLKDGL 335
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 320 NTINHRYGLFSEVRGLGLLIGCVL---------NADYAGqakQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTT 388
Cdd:PRK08088                                  336 LAIAEKHPEIGDVRGLGAMIAIELfedgdhskpNAKLTA---QIVARARDKGLILLSCGpyYNVLRILVPLTIEDAQIRQ 412

                                                  ...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 389 GLD 391
Cdd:PRK08088                                  413 GLE 415
PRK06918 PRK06918
4-aminobutyrate aminotransferase; Reviewed
1-398 4.97e-78

4-aminobutyrate aminotransferase; Reviewed


Pssm-ID: 235885 [Multi-domain]  Cd Length: 451  Bit Score: 248.19  E-value: 4.97e-78
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   1 MSQPITRENFDEWM------IP--VYASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFW 72
Cdd:PRK06918                                    8 VNEQIPGPKAASLLerrqniVPkgVSNGIPTFAQSANGALVTDVDGNQYIDFAGAIGTINVGHSHPKVKEALHKQVDQYI 87
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  73 HTG-NGYTNEPVLRLAKKLIDAT---FADRVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSA 148
Cdd:PRK06918                                   88 HTGfNVMMYEPYIELAEKLAALApgsFDKKVLFLNSGAEAVENAVKIARKY------TKRQGIISFSRGFHGRTLMTMTM 161
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 149 GGQ-PAYSQDFAPL---------------PADIRHAAYND--INS-----ASALIDDSTCAVIVEPIQGEGGVVPASNAF 205
Cdd:PRK06918                                  162 TSKvKPYKFGFGPFapevykapfpyeyrrPEGLTEEQYDDfmIEEfknffISEVAPETIAAVVMEPVQGEGGFIVPSKKF 241
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 206 LQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGN 285
Cdd:PRK06918                                  242 VQEVRNICSEHGILFVADEIQTGFARTGKYFAIEHFDVVPDLITVSKSLGAGVPISGVIGRKEIMDESAPGELGGTYAGS 321
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 286 PLASAVAGKVLELINTpEMLNGVKQRHDWFVE-RLNTINHRYGLFSEVRGLGLLIGCVL-------NADYAGQAKqISQE 357
Cdd:PRK06918                                  322 PLGCAAALAVLDIIEK-ENLNDRAIELGKVVMnRFEEMKNKYNCIGDVRGLGAMCAFELvqdrktkEPDKTLTAN-ICKE 399
                                                         410       420       430       440
                                                  ....*....|....*....|....*....|....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 358 AAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGLDRFAAACE 398
Cdd:PRK06918                                  400 ANKRGLLLLSAGtyGNVIRVLMPLVITDEQLEEGLTIIEESLQ 442
GABAtrnsam TIGR00700
4-aminobutyrate aminotransferase, prokaryotic type; This enzyme is a class III ...
22-396 2.07e-75

4-aminobutyrate aminotransferase, prokaryotic type; This enzyme is a class III pyridoxal-phosphate-dependent aminotransferase. This model describes known bacterial examples of the enzyme. The best archaeal matches are presumed but not trusted to have the equivalent function. The degree of sequence difference between this set and known eukaryotic (mitochondrial) examples is greater than the distance to some proteins known to have different functions, and so separate models are built for prokaryotic and eukaryotic sets. E. coli has two isozymes. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase. [Central intermediary metabolism, Other]


Pssm-ID: 129783 [Multi-domain]  Cd Length: 420  Bit Score: 240.55  E-value: 2.07e-75
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTG-NGYTNEPVLRLAKKL---IDATFAD 97
Cdd:TIGR00700                                  16 PVFAARAEGAILEDVDGNRLIDFASGIAVLNIGHSHPRVVDAVRTQVAEFTHTCfMVTPYEGYVALAEKLnriAPGSGPK 95
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYN-DINS 175
Cdd:TIGR00700                                  96 KSVFFNSGAEAVENAVKIARSY------TGRPGVVAFDHGFHGRTNMTMALTAKVMpYKSGFGPFAPEVYRAPLPyPYRD 169
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 176 ASALIDDST--------------------CAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGEL 235
Cdd:TIGR00700                                 170 GLLDKQLSTdgelaaaraifvidvgannvAALVIEPVQGEGGFIVPAKGFVPALLDWCREHGIVFIADEVQTGFARTGAM 249
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 236 YAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWF 315
Cdd:TIGR00700                                 250 FACEHEGPEPDLITTAKSLADGLPLSGVTGRAEIMDAPAPGGLGGTYAGNPLACAAALAVLAIIESEGLIERARQIGRLV 329
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 316 VERLNTINHRYGLFSEVRGLGLLIGCVLNADY-----AGQAKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTT 388
Cdd:TIGR00700                                 330 TDRLTTLKAVDPRIGDVRGLGAMIAVELVDPGttepdAGLAERIATAAHAAGLLLLTCGmfGNIIRFLPPLTIGDELLSE 409

                                                  ....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 389 GLDRFAAA 396
Cdd:TIGR00700                                 410 GLDILCAI 417
PRK08360 PRK08360
aspartate aminotransferase family protein;
21-398 3.07e-74

aspartate aminotransferase family protein;


Pssm-ID: 181401 [Multi-domain]  Cd Length: 443  Bit Score: 238.13  E-value: 3.07e-74
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  21 APFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTG--NGYTNEPVLrLAKKLIDATFAD- 97
Cdd:PRK08360                                   23 YPLVPVKAENAKVWDIEGNEYIDFLSDAAVQNVGHNNPRVVKAIKEQTDKLIHYTpiYGFPVEPLL-LAEKLIEIAPGDn 101
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 -RVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGG-QPAYSQDFAPLPaDIRHAAYNDINS 175
Cdd:PRK08360                                  102 pKVSFGLSGSDANDGAIKFARAY------TKRRKILSYLRSYYGSTYGAMSLTGlDFPVRALVGELS-DVHYIPYPDCYR 174
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 176 ASALIDDSTC----------------------AVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:PRK08360                                  175 CPFGKEPGSCkmecveyikekfegevyaegvaALFAEPIQGDAGMIVPPEDYFKKLKKILDEHGILLVVDEVQSGLGRTG 254
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHD 313
Cdd:PRK08360                                  255 KWFAIEHFGVEPDIITLGKPLGGGLPISATIGRAEIMDSLPPLAHAFTLSGNPVASAAALAVIEEIEEKNLLKRAEKLGN 334
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 314 WFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAG------QAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVT 387
Cdd:PRK08360                                  335 YTKKRLEEMKKKHELIGDVRGIGLMIGVDLVKDRETkerayeEAAKVVWRAWELGLIVTFFSGNVLRIQPPLTIEKEVLD 414
                                                         410
                                                  ....*....|.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 388 TGLDRFAAACE 398
Cdd:PRK08360                                  415 EGLDILEEAIE 425
PRK07483 PRK07483
aspartate aminotransferase family protein;
20-396 2.99e-73

aspartate aminotransferase family protein;


Pssm-ID: 236027 [Multi-domain]  Cd Length: 443  Bit Score: 235.62  E-value: 2.99e-73
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  20 SAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--FWHTGnGYTNEPVLRLAKKLIDATFA- 96
Cdd:PRK07483                                   11 ATLPVAVAGEGIYLIDATGKRYLDASGGAAVSCLGHSHPRVIAAIHAQIDRlaYAHTS-FFTTEPAEALADRLVAAAPAg 89
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 -DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHA----AYN 171
Cdd:PRK07483                                   90 lEHVYFVSGGSEAVEAALKLARQYFVEIGQPQRRHFIARRQSYHGNTLGALAIGGNAWRREPFAPLLIEAHHVspcyAYR 169
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 172 D-----------INSASALID-------DSTCAVIVEPIQGE-GGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRT 232
Cdd:PRK07483                                  170 EqragesdeaygQRLADELEAkilelgpDTVAAFVAETVVGAtAGAVPPVPGYFKRIREVCDRYGVLLILDEVMCGMGRT 249
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 233 GELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGT----HGTTYGGNPLASAVAGKVLELINTPEMLNG 307
Cdd:PRK07483                                  250 GTLFACEEDGVAPDLVTIAKGLGAGYqPIGAVLASDRIYDAIADGSgffqHGHTYLGHATACAAALAVQRVIAEDGLLAN 329
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 308 VKQRHDWFVERLNTI--NHRYglFSEVRGLGLLIGCVLNADYAGQA---------KQISQEAAKAGVMVLIAGGNV---- 372
Cdd:PRK07483                                  330 VRARGEQLRARLRERlgQHPH--VGDIRGRGLFVGVELVADRATKApfdpalklhARIKREAMARGLMVYPMGGTIdgvr 407
                                                         410       420
                                                  ....*....|....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 373 ---VRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK07483                                  408 gdhVLLAPPFIITAAQIDEIVERLGDA 434
PRK06058 PRK06058
4-aminobutyrate--2-oxoglutarate transaminase;
15-396 9.92e-73

4-aminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 235685 [Multi-domain]  Cd Length: 443  Bit Score: 234.15  E-value: 9.92e-73
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  15 IPVYAsapfipVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN-EPVLRLAKKLIDA 93
Cdd:PRK06058                                   38 LPVYV------ARAGGGIVEDVDGNRLIDLGSGIAVTSVGNSAPRVVEAVREQVARFTHTCFMVTPyEGYVAVAEQLNRL 111
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  94 TFAD---RVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVS--AGGQPaYSQDFAPLPADIRHA 168
Cdd:PRK06058                                  112 TPGDhekRSALFNSGAEAVENAVKIARSY------TGRQAVVVFDHAYHGRTNLTMAltAKSMP-YKSGFGPFAPEVYRA 184
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 169 --AY---------NDINSASA----LID-----DSTCAVIVEPIQGEGG-VVPASnAFLQGLRELCNRHNALLIFDEVQT 227
Cdd:PRK06058                                  185 pmSYpyrdpkglaTDGEEAAAraitVIEkqvgaDNLAAVIIEPIQGEGGfIVPAE-GFLPALLEWCRENGVVFIADEVQT 263
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 228 GVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNG 307
Cdd:PRK06058                                  264 GFARTGAWFACEHEGIVPDLITTAKGIAGGLPLSAVTGRAEIMDAPHPGGLGGTYGGNPVACAAALAAIETIEEDDLVAR 343
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 308 VKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ-----AKQISQEAAKAGVMVLIAG--GNVVRFAPALN 380
Cdd:PRK06058                                  344 ARQIEALMTDRLRALAAEDDRIGDVRGRGAMIAIELVKPGTTEpdaelTKALAAAAHAAGVIVLTCGtyGNVIRLLPPLV 423
                                                         410
                                                  ....*....|....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 381 VSEEEVTTGLDRFAAA 396
Cdd:PRK06058                                  424 IGDELLREGLDVLEAA 439
PRK05964 PRK05964
adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
21-398 1.80e-72

adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional


Pssm-ID: 235656 [Multi-domain]  Cd Length: 423  Bit Score: 232.79  E-value: 1.80e-72
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  21 APFIPV-RGEGSRLWDQQGKEYIDfagGIA---VNALGHAHPELREALNEQASKFWHT--GnGYTNEPVLRLAKKLIDAT 94
Cdd:PRK05964                                   23 PPPIPIvRAEGAYLYLADGRELID---AISswwVATHGHNHPYIDQAIREQLDRLDHVifA-GFTHEPAERLAQRLVALT 98
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  95 FA--DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAY---------SQDFAPLPA 163
Cdd:PRK05964                                   99 PGglDHVFFSDSGSVAVEVALKMALQYWRNRGEPGRSRFLSLRGGYHGDTIGTMSVGDRGGMhalytpllfEQVTAPFPP 178
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 164 DIRHAAYNDI-NSASALIDDSTCAVIVEP-IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHY 241
Cdd:PRK05964                                  179 DGYEQATLDAlEALLEKHAGEIAAFIVEPlVQGAGGMLFYDPRYLAELRRICDRHGVLLIFDEIATGFGRTGTLFACEQA 258
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 242 GVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGT------HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDW 314
Cdd:PRK05964                                  259 GVSPDIMCLSKGLTGGYlPLAATLCTAEIFEAFYSDDrakafmHSPSYTANPLACAAANASLDLFEDEPVLERVAALSAG 338
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 315 FVERLNTINHRYGlFSEVRGLGlLIGCV--LNADYAGQAKQISQEAAKAGVMV--LiagGNVVRFAPALNVSEEEvttgL 390
Cdd:PRK05964                                  339 LAEGLEPFRDLPG-VADVRVLG-AIGAVelDRPVLERDGPALRAFALERGVLLrpL---GNTIYLMPPYIITAEE----L 409

                                                  ....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 391 DR-FAAACE 398
Cdd:PRK05964                                  410 DRiTDAIVE 418
PRK09264 PRK09264
diaminobutyrate--2-oxoglutarate transaminase;
27-406 4.44e-71

diaminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 236437 [Multi-domain]  Cd Length: 425  Bit Score: 229.29  E-value: 4.44e-71
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  27 RGEGSRLWDQQGKEYIDF-AGGIAVNaLGHAHPELREALNE--QASKFWHTGNGYTNepvlrlAKKLIDATFAD------ 97
Cdd:PRK09264                                   27 KAKGSWLYDEDGKEYIDFfAGAGALN-YGHNNPVLKQALIDylQRDGITHGLDMHTT------AKREFLETFEEtilkpr 99
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 ----RVFFCN-SGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYN- 171
Cdd:PRK09264                                  100 gldyKVQFTGpTGTNAVEAALKLARKV------TGRTNIVAFTNGFHGMTLGSLAVTGNSHKRQGAGVPLNNVTRMPYDg 173
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 172 ----DINSAS---ALIDDST------CAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAY 238
Cdd:PRK09264                                  174 yfggDVDTLAyleKLLEDSSsgvdlpAAVIVETVQGEGGINVASAEWLQRLAKLCRKHDILLIVDDIQAGCGRTGTFFSF 253
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 239 MHYGVTPDLLTTAKALGG-GFPVGALLATEECaRVMTVGTHGTTYGGNPLASAVAGKVLELI-NTPEMLNGVKQRHDWFV 316
Cdd:PRK09264                                  254 ERAGITPDIVTLSKSISGyGLPMALVLIKPEL-DVWKPGEHNGTFRGNNLAFVTATAALEEYwSDDAFEKEVKAKGELVR 332
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 317 ERLNTINHRY-GLFSEVRGLGLLIGcvLNADYAGQAKQISQEAAKAGVMVLIAGGN--VVRFAPALNVSEEEVTTGLDRF 393
Cdd:PRK09264                                  333 ERLEEIAAKYpGLGAEVRGRGMMQG--IDFGDGELAGKIAAEAFENGLIIETSGPEdeVVKLLPPLTIDEEELEEGLDIL 410
                                                         410
                                                  ....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 394 AAACEHFVSRGSS 406
Cdd:PRK09264                                  411 EEAVAEVLAEEES 423
PRK09792 PRK09792
4-aminobutyrate transaminase; Provisional
23-390 2.35e-70

4-aminobutyrate transaminase; Provisional


Pssm-ID: 182078 [Multi-domain]  Cd Length: 421  Bit Score: 227.61  E-value: 2.35e-70
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  23 FIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN-EPVLRLAKKLIDAT----FAD 97
Cdd:PRK09792                                   24 FFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPyESYVTLAEKINALApvsgQAK 103
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFcNSGAEANEAALKLARkfAHdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAY----ND 172
Cdd:PRK09792                                  104 TAFF-TTGAEAVENAVKIAR--AH----TGRPGVIAFSGGFHGRTYMTMALTGKVApYKIGFGPFPGSVYHVPYpsdlHG 176
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 INSASALI-----------DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHY 241
Cdd:PRK09792                                  177 ISTQDSLDaierlfksdieAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHY 256
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 242 GVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNT 321
Cdd:PRK09792                                  257 ADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLID 336
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 322 INHRYGLFSEVRGLGLLIGCVLN-----ADYAGQAKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGL 390
Cdd:PRK09792                                  337 AKESVPAIAAVRGLGSMIAAEFNdpqtgEPSAAIAQKIQQRALAQGLLLLTCGayGNVIRFLYPLTIPDAQFDAAM 412
PRK07481 PRK07481
hypothetical protein; Provisional
22-396 4.14e-68

hypothetical protein; Provisional


Pssm-ID: 168967 [Multi-domain]  Cd Length: 449  Bit Score: 222.24  E-value: 4.14e-68
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGI-AVNaLGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLIDATFAD- 97
Cdd:PRK07481                                   25 PIIIVRGDGVYVYDIDGKKLLDGVGGLwNVN-VGHNREEVKEAIVRQLDEleYYSTFDGTTHPRAIELSYELIDMFAPEg 103
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 --RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRH--AAY--- 170
Cdd:PRK07481                                  104 mrRVFFSSGGSDSVETALKLARQYWKVRGQPERTKFISLKQGYHGTHFGGASVNGNTVFRRNYEPLLPGCFHveTPWlyr 183
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 171 NDINS----------ASALID-------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:PRK07481                                  184 NPFTEqdpeelaricARLLEReiafqgpDTIAAFIAEPVQGAGGVIVPPANFWPLVREVCDRHGILLIADEVVTGFGRTG 263
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYAYMHYGVTPDLLTTAKALGGG-FPVGALLATEECARVMTVGT-------HGTTYGGNPLASAVAGKVLELI---NTP 302
Cdd:PRK07481                                  264 SWFGSRGWGVKPDIMCLAKGITSGyVPLGATMVNARIADAFEANAdfggaimHGYTYSGHPVACAAALATLDIVvreDLP 343
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 303 EmlNGVKqRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYA---------GQAKQISQEAAKAGVMVLIAGGNVV 373
Cdd:PRK07481                                  344 A--NAAK-RGAYLLEGLQPLKERFELVGDVRGKGLMLALDLVADKAtrepidpskGYANAVADVARENGVLVRPSGTKII 420
                                                         410       420
                                                  ....*....|....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 374 rFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK07481                                  421 -LSPPLVIQREDVDRIVDALDAG 442
PRK06082 PRK06082
aspartate aminotransferase family protein;
29-398 7.99e-68

aspartate aminotransferase family protein;


Pssm-ID: 180390 [Multi-domain]  Cd Length: 459  Bit Score: 221.90  E-value: 7.99e-68
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  29 EGSRLWDQQGKEYIDFAGGiAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFAD--RVFFCNSGA 106
Cdd:PRK06082                                   62 EGIYIEDVDGKKYMDFHGN-NVHQLGYGHPHVIEKVKEQMAKLPFSPRRFTNETAIECAEKLTEIAGGElnRVLFAPGGT 140
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 107 EANEAALKLARKFAhdryGSHKsgIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRH-AAYNDINSASALIDDS-- 183
Cdd:PRK06082                                  141 SAIGMALKLARHIT----GNFK--VVSLWDSFHGASLDAISVGGEACFRQGMGPLMAGVERiPPAVSYRGAFPDADGSdv 214
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 184 ---------------TCAVIVEPIQGEGGVVPaSNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLL 248
Cdd:PRK06082                                  215 hyadyleyviekeggIGAFIAEAVRNTDVQVP-SKAYWKRVREICDKHNVLLIIDEIPNGMGRTGEWFTHQAYGIEPDIL 293
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 249 TTAKALGGG-FPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYG 327
Cdd:PRK06082                                  294 CIGKGLGGGlVPIAAMITKDKYNTAAQISLGHYTHEKSPLGCAAALATIEVIEQEGLLEKVKADSQFMRERLLEMKAKYP 373
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 328 LFSEVRGLGLLIGCVLNADYagQAKQISQEAAKA--------GVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACE 398
Cdd:PRK06082                                  374 LIGDVRGIGLLWGVELVTDR--HTKERAYDEAEAvlyrclnnGLSFKVSQGNVIQLSPPLIITREELTQALAILEEAIA 450
PRK07678 PRK07678
aminotransferase; Validated
14-386 2.60e-67

aminotransferase; Validated


Pssm-ID: 181078 [Multi-domain]  Cd Length: 451  Bit Score: 220.27  E-value: 2.60e-67
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  14 MIPVYASAPFIPVRGEGSRLWDQQGKEYID-FAGGIAVNaLGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLID 92
Cdd:PRK07678                                   22 MKPYNPNATMVVAKAEGAWVTDIQGNRYLDgMSGLWCVN-VGYGRKELAEAAYEQLKTLSYFPLTQSHEPAIKLAEKLNE 100
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  93 ATFAD-RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPL---------- 161
Cdd:PRK07678                                  101 WLGGEyVIFFSNSGSEANETAFKIARQYHAQKGEPHRYKFISRYRAYHGNSMGALAATGQAQRKYKYEPLapgflhvppp 180
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 162 -----PADIRHAAYnDINSASAL-------IDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGV 229
Cdd:PRK07678                                  181 dcyrmPGIESEDIY-DLECVKEIdrvmtweLSETIAAVIMEPIITGGGVLMPPQDYMKAVKEICQKHGALLISDEVICGF 259
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 230 GRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTvGT-------HGTTYGGNPLASAVAGKVLELINT 301
Cdd:PRK07678                                  260 GRTGKAFGFMNYGVKPDIITMAKGITSAYlPLSATAVKKEIYEAFK-GKgeyehfrHVNTFGGNPAACALALKNLEIMEN 338
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 302 PEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQA-------KQISQEAAKAGVMV-----LIAG 369
Cdd:PRK07678                                  339 ENLIERSAQLGELLLEQLKEELGEHPLVGDIRGKGLLVGIELVNDKETKEpadndkvASVVAACKEKGLIIgkngdTVAG 418
                                                         410
                                                  ....*....|....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 370 G-NVVRFAPALNVSEEEV 386
Cdd:PRK07678                                  419 YnNVLTLSPPLVISSEEI 436
HemL COG0001
Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];
21-336 6.96e-66

Glutamate-1-semialdehyde aminotransferase [Coenzyme transport and metabolism];


Pssm-ID: 223080 [Multi-domain]  Cd Length: 432  Bit Score: 215.91  E-value: 6.96e-66
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  21 APFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNgyTNEPVLRLAKKLIDAT-FADRV 99
Cdd:COG0001                                    35 YPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLSFGA--PTELEVELAELLIERVpSIEKV 112
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 100 FFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRT-LFTVSAGGQPAY--SQDFAPLPADI----RHAAYND 172
Cdd:COG0001                                   113 RFVNSGTEATMSAIRLARAY------TGRDKIIKFEGCYHGHSdSLLVKAGSGAATlgSPSSPGVPADVakhtLVLPYND 186
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 INSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTG--VGRTGelyAYMHYGVTPDL 247
Cdd:COG0001                                   187 LEALEEAFEeygDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGfrVALGG---AQGYYGVEPDL 263
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 248 LTTAKALGGGFPVGALLATEECA-RVMTVGT--HGTTYGGNPLASAVAGKVLELINTPEMLNG-VKQRHDWFVERLNTIN 323
Cdd:COG0001                                   264 TTLGKIIGGGLPIGAFGGRAEIMeQLAPLGPvyQAGTLSGNPLAMAAGLATLEELMTEEGVYErLDALGERLAEGLRAAA 343
                                                         330
                                                  ....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 324 HRYGLFSEVRGLG 336
Cdd:COG0001                                   344 ERHGIPLTVNRVG 356
PRK08593 PRK08593
aspartate aminotransferase family protein;
28-391 2.68e-65

aspartate aminotransferase family protein;


Pssm-ID: 181493 [Multi-domain]  Cd Length: 445  Bit Score: 214.95  E-value: 2.68e-65
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  28 GEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGY-TNEPVLRLAKKLID---ATFADRVFFCN 103
Cdd:PRK08593                                   31 GYGATLTDVDGKTYIDLLASASSQNVGHAPPRVVEAIKAQADKFIHYTPAYmYHEPLVRLAKKLCElapGDFEKRVTFGL 110
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 104 SGAEANEAALKLARKFAHDRYgshksgIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYNDINS------- 175
Cdd:PRK08593                                  111 SGSDANDGIIKFARAYTGRPY------IISFTNAYHGSTYGSLSMSGISLnMRRKYGPLLPGFVHIPFPDKYRgmyeepd 184
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 176 ---------------ASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMH 240
Cdd:PRK08593                                  185 anfveeylaplkemfEKYLPADEVACIVIETIQGDGGLLEPVPGYFEALYKFCREHGILFAVDDIQQGLGRTGKWSSISH 264
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 241 YGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLN 320
Cdd:PRK08593                                  265 FNITPDLMSFGKSLAGGMPMSAIVGRKEIMESLEAPAHLFTTGANPVSCAAALATIDMIEDESLLQRSAEKGEYARKRFD 344
                                                         330       340       350       360       370       380       390
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 321 TINHRYGLFSEVRGLGLLIGCVLNADYagQAKQISQEAA--------KAGVMVLIAGGNVVRFAPALNVSEEEVTTGLD 391
Cdd:PRK08593                                  345 QWVSKYNFVGDVRGYGLSIGIDIVSDK--KLKTRDNEAAlkicnycfEHGVVIIAVAGNVLRFQPPLVITYEQLDTALN 421
PRK06105 PRK06105
aminotransferase; Provisional
22-396 2.13e-64

aminotransferase; Provisional


Pssm-ID: 180401 [Multi-domain]  Cd Length: 460  Bit Score: 212.94  E-value: 2.13e-64
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLIDATFAD-- 97
Cdd:PRK06105                                   31 PLVIERGEGIYVYDDAGKRYIEGMAGLWSVALGFSEQRLVEAAARQMKKlpFYHTFSHKSHGPVIDLAEKLVAMAPVPms 110
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFApLPAD-IRHAA----YND 172
Cdd:PRK06105                                  111 KVFFTNSGSEANDTVVKLVWYYNNALGRPEKKKIISRQRGYHGVTIASASLTGLPNNHRSFD-LPLDrILHTGcphyYRF 189
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 --------------INSASALI----DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGE 234
Cdd:PRK06105                                  190 glpgeseeafatrlANELEALIlaegPDTIAAFIGEPVMGAGGVIVPPKTYWEKIQAVLRKYDILLVADEVICGFGRTGN 269
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 235 LYAYMHYGVTPDLLTTAKALGGG-FPVGALLATEECARVM-----TVGT--HGTTYGGNPLASAVAGKVLELINTPEMLN 306
Cdd:PRK06105                                  270 MFGCETFGIKPDILVMSKQLSSSyQPLSAVLMNEKVYDPIadesgKIGTfgHGFTASGHPVAAAVALENLAIIEERDLVG 349
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 307 GVKQRHDWFVERLNTI-NHRygLFSEVRGLGLLIGCVLNADYA--------GQAKQISQEAAKAGVMVLIAGGNVVRFAP 377
Cdd:PRK06105                                  350 NAAERGARLQARLRALaDHP--LVGEVRGVGLIAAVELVADKAtktpfeppGKVGARANAAAHEHGVISRAMGDTLAFCP 427
                                                         410
                                                  ....*....|....*....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 378 ALNVSEEEVTTGLDRFAAA 396
Cdd:PRK06105                                  428 PLIITAAQVDEMVDRFGRA 446
PRK06541 PRK06541
aspartate aminotransferase family protein;
18-348 7.67e-62

aspartate aminotransferase family protein;


Pssm-ID: 235823 [Multi-domain]  Cd Length: 460  Bit Score: 206.38  E-value: 7.67e-62
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  18 YASAPF-IPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF-----WhtgnGYTNEPVLRLAKKLi 91
Cdd:PRK06541                                   30 YIDAPVpVIVRGEGCYIWDDRGKRYLDGLAGLFVVQVGHGRAELAEAAAKQAGTLaffplW----SYAHPPAIELAERL- 104
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  92 dATFA----DRVFFCNSGAEANEAALKLARKFaHDRYGSH-KSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIR 166
Cdd:PRK06541                                  105 -AALApgdlNRVFFTTGGSEAVESAWKLAKQY-FKLTGKPgKHKVISRAIAYHGTTQGALAITGLPAFKAPFEPLVPGGF 182
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 167 HAAYNDINSASALID----------------------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDE 224
Cdd:PRK06541                                  183 RVPNTNFYRAPELGDdpeafgrwaadrieeaiefegpDTVAAVFLEPVQNAGGCFPPPPGYFERVREICDRYDVLLVSDE 262
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 225 VQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEecaRVM-------TVGTHGTTYGGNPLASAVAGKVL 296
Cdd:PRK06541                                  263 VICAFGRLGEMFGCERFGYVPDIITCAKGITSGYsPLGAMIASD---RLFepfldgpTMFLHGYTFGGHPVSAAVALANL 339
                                                         330       340       350       360       370
                                                  ....*....|....*....|....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 297 ELINTPEMLNGVKQRHDWFVERLNTInHRYGLFSEVRGLGLLIGCVLNADYA 348
Cdd:PRK06541                                  340 DIFEREGLLDHVRDNEPAFRATLEKL-LDLPIVGDVRGDGYFYGIELVKDKA 390
PRK06917 PRK06917
aspartate aminotransferase family protein;
28-406 1.45e-60

aspartate aminotransferase family protein;


Pssm-ID: 235884 [Multi-domain]  Cd Length: 447  Bit Score: 202.65  E-value: 1.45e-60
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  28 GEGSRLWDQQGKEYIDFAGGiAVNA-LGHAHPELREALNEQASK--FWHTGNgYTNEPVLRLAKKLIDATFADR--VFFC 102
Cdd:PRK06917                                   20 GKGVYLYDQNGNKYFDGSSG-AVTAgIGHGVKEIADAIKEQAEEvsFVYRSQ-FTSEPAEKLAKKLSDLSPGDLnwSFFV 97
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 103 NSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPAD------------------ 164
Cdd:PRK06917                                   98 NSGSEANETAMKIAIQHFQERGIQGKHKILSRWMSYHGITMGALSMSGHPLRRQRFVSLLEDyptisapycyrcpvqkvy 177
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 165 --IRHAAYNDINSASALIDDS-TCAVIVEPIQGEGG--VVPASNAFlQGLRELCNRHNALLIFDEVQTGVGRTGELYAYM 239
Cdd:PRK06917                                  178 ptCQLACATELETAIERIGAEhIAAFIAEPIIGAAGaaVVPPKGYY-KVIKEICDHYDILFIADEVMTGLGRTGAMFAME 256
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 240 HYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGTH----GTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDW 314
Cdd:PRK06917                                  257 HWGVEPDIMTLGKGLGAGYtPIAATVVSDRVMEPILRGSRsimsGHTLSANPLSAATALAVLEYMEKHNLPEKAAEKGEY 336
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 315 FVERLNTINHRYGLFSEVRGLGLLIGCVLNAD---------YAGQAKQISQEAAKAGVMVLIA-------GGNVVRFAPA 378
Cdd:PRK06917                                  337 LIKGLQKVQQQSTIIGDVRGKGLLIGVEFVADkktkqpfskSQAVASELISVAAKNGLLLYPAvagqdgkEGDAVIIAPP 416
                                                         410       420
                                                  ....*....|....*....|....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 379 LNVSEEEVTTGLDRFAAACEHFVSRGSS 406
Cdd:PRK06917                                  417 MTITYSELDELLSIFAKSVEEMMQKGGH 444
PRK06062 PRK06062
hypothetical protein; Provisional
22-396 6.71e-59

hypothetical protein; Provisional


Pssm-ID: 235687 [Multi-domain]  Cd Length: 451  Bit Score: 198.33  E-value: 6.71e-59
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIaVNA-LGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFAD--R 98
Cdd:PRK06062                                   36 PMVIAGAEGSYVWDYEGRRYLDFSSQL-VNTnIGHQHPKVVAAIQEQAARLCTVAPAHANDARSEAARLIAERAPGDlsK 114
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  99 VFFCNSGAEANEAALKLARKFAhdryGSHKsgIVAFKNAFHGRTLFTVSAGGQP----------AYSQDFAPLPADIR-H 167
Cdd:PRK06062                                  115 VFFTNGGADANEHAVRMARLHT----GRPK--VLSAYRSYHGGTGSAINLTGDPrrwpndtgraGVVHFFGPFLYRSEfH 188
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 168 AAYNDINSASALID----------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYA 237
Cdd:PRK06062                                  189 ATTEEEECERALAHlervielegpSTIAAILLESVPGTAGILVPPPGYLAGVRELCDRHGIVLIADEVMAGFGRTGKWFA 268
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 238 YMHYGVTPDLLTTAKALGGGF-PVGALLATEECARvmTVGTH----GTTYGGNPLASAVAGKVLELINTPEML-NGVKQR 311
Cdd:PRK06062                                  269 IEHFGVVPDLITFAKGVNSGYvPLGGVAISEAIAA--TFADRpypgGLTYSGHPLACAAAVATINAMEEEGIVeNAARIG 346
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 312 HDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNAD---------YAGQAK---QISQEAAKAGVMVLIAgGNVVRFAPAL 379
Cdd:PRK06062                                  347 AEVLGPGLRELAERHPSVGEVRGLGVFWALELVADretreplapYGASSAamaAVKAACKERGLLPFVN-GNRIHVVPPC 425
                                                         410
                                                  ....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 380 NVSEEEVTTGLDRFAAA 396
Cdd:PRK06062                                  426 TVTEDEVREGLAILDAA 442
PRK06938 PRK06938
diaminobutyrate--2-oxoglutarate aminotransferase; Provisional
24-396 2.19e-58

diaminobutyrate--2-oxoglutarate aminotransferase; Provisional


Pssm-ID: 235892 [Multi-domain]  Cd Length: 464  Bit Score: 197.17  E-value: 2.19e-58
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  24 IPV---RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQ-ASKF-WHTGNGYTnePVlrlAKKLIDATFAD- 97
Cdd:PRK06938                                   45 IPLalkRARGIYVEDVEGRQFIDCLAGAGTLALGHNHPVVIEAIQQVlADELpLHTLDLTT--PV---KDQFVQDLFASl 119
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 --------RVFFCN-SGAEANEAALKLARKfahdryGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQ---------DFA 159
Cdd:PRK06938                                  120 peafareaKIQFCGpTGTDAVEAALKLVKT------ATGRSTVLSFQGGYHGMSQGALSLMGNLGPKKplgallpgvQFL 193
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 160 PLPADIR------HAAYNDINSA--SALIDD------STCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEV 225
Cdd:PRK06938                                  194 PYPYDYRcpfglgGEAGVRANLHylENLLDDpesgvvLPAAVILEVVQGEGGVIPAPIEWLRGLRRITEEAGIPLIVDEI 273
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 226 QTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARvMTVGTHGTTYGGNPLASAVAGKVLELINTPEML 305
Cdd:PRK06938                                  274 QSGFGRTGKMFAFEHAGIIPDVVVLSKAIGGSLPLAVVVYREWLDT-WQPGAHAGTFRGNQMAMAAGSATLRYIKEHRLA 352
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 306 NGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVL-----NADYAGQ-------AKQISQEAAKAGVMVLIAG--GN 371
Cdd:PRK06938                                  353 EHAAAMGERLREHLRQLQRDYPQLGDVRGRGLMLGVEIvdpqgEPDALGHppangelASLIQRECLRRGLILELGGrhGS 432
                                                         410       420
                                                  ....*....|....*....|....*
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 372 VVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK06938                                  433 VVRFLPPLIITAEQIDEVAEIFAEA 457
PRK00062 PRK00062
glutamate-1-semialdehyde 2,1-aminomutase;
16-303 2.92e-58

glutamate-1-semialdehyde 2,1-aminomutase;


Pssm-ID: 234607 [Multi-domain]  Cd Length: 426  Bit Score: 195.67  E-value: 2.92e-58
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  16 PVYASAPFIpVRGEGSRLWDQQGKEYIDFAGG----IavnaLGHAHPELREALNEQASKFWHTGNGYTNEpvLRLAKKLI 91
Cdd:PRK00062                                   28 SVGGTPRFI-ERAKGAYLYDVDGNEYIDYVGSwgpmI----LGHAHPEVVEAVIEAAEKGLSFGAPTELE--VELAELVI 100
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  92 DAT-FADRVFFCNSGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGR---TLftVSAG------GQPaysqDFAPL 161
Cdd:PRK00062                                  101 ELVpSIEMVRMVNSGTEATMSAIRLARGY------TGRDKIIKFEGCYHGHadsLL--VKAGsgaatlGLP----DSPGV 168
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 162 PADI-RH---AAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTG--VGRT 232
Cdd:PRK00062                                  169 PEDFaKHtltAPYNDLEAVEELFEeygDEIAAVIVEPVAGNMGVVPPKPGFLEGLRELCDEHGALLIFDEVMTGfrVALG 248
                                                         250       260       270       280       290       300       310
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 233 GelyAYMHYGVTPDLLTTAKALGGGFPVGALLATEEcarVMT----VGT--HGTTYGGNPLASAvAG-KVLELINTPE 303
Cdd:PRK00062                                  249 G---AQGYYGVTPDLTTLGKIIGGGLPVGAFGGRRE---IMEqlapLGPvyQAGTLSGNPLAMA-AGlATLKLLKEPG 319
PRK06931 PRK06931
diaminobutyrate--2-oxoglutarate transaminase;
22-396 1.97e-57

diaminobutyrate--2-oxoglutarate transaminase;


Pssm-ID: 235889 [Multi-domain]  Cd Length: 459  Bit Score: 194.59  E-value: 1.97e-57
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREAL-NEQASKF-WHTgngytnepvLRLAKKLIDAtFADRV 99
Cdd:PRK06931                                   41 PLAIAKAQGVWVTDVEGNQYLDCLAGAGTLALGHNHPDVLQSIqDVLTSGLpLHT---------LDLTTPLKDA-FSEYL 110
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 100 F-------------FCN-SGAEANEAALKLARKFahdrygSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQ--------- 156
Cdd:PRK06931                                  111 LsllpgqgkeyclqFTGpSGADAVEAAIKLAKTY------TGRSNVISFSGGYHGMTHGALAVTGNLSPKNavnglmpgv 184
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 157 DFAPLP------------ADIRHAAY------NDINSASALiddsTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNA 218
Cdd:PRK06931                                  185 QFMPYPheyrcplgiggeAGVKALTYyfenfiEDVESGVRK----PAAVILEAIQGEGGVNPAPVEWLQKIREVTQKHGI 260
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 219 LLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVgALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLEL 298
Cdd:PRK06931                                  261 LLIVDEVQAGFARTGKMFAFEHAGIEPDIIVMSKAVGGGLPL-AVLGIKKEFDAWQPGGHTGTFRGNQLAMATGLTTLKI 339
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 299 INTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVL-----NADYAGQ-------AKQISQEAAKAGVMVL 366
Cdd:PRK06931                                  340 LKEENLAQNAAERGEWLKAQLAELQKRYPCIGNVRGRGLMIGIEIvderqPADAMGSypadgelAAAIQKACFENGLLLE 419
                                                         410       420       430
                                                  ....*....|....*....|....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 367 IAG--GNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK06931                                  420 RGGrnGNVVRLLPPLLITQAECEEFIDRFEQA 451
PRK07480 PRK07480
putative aminotransferase; Validated
24-386 1.36e-56

putative aminotransferase; Validated


Pssm-ID: 180994 [Multi-domain]  Cd Length: 456  Bit Score: 192.42  E-value: 1.36e-56
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  24 IPVRGEGSRLWDQQGKEYID-FAGGIAVNaLGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLIDATFAD--R 98
Cdd:PRK07480                                   35 VITRAEGVYLWDSEGNKILDgMAGLWCVN-VGYGRKELADAAARQMRElpYYNTFFKTTHPPAIELAAKLAEVAPPGfnH 113
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  99 VFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPaDIRHAA----YND- 172
Cdd:PRK07480                                  114 VFFTNSGSEANDTVLRMVRHYWALKGKPQKKVIISRKNGYHGSTVAGASLGGMKYmHEQGDLPIP-GIVHIDqpywFGEg 192
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 173 ---------INSASAL---ID----DSTCAVIVEPIQGEGGVV--PASnaFLQGLRELCNRHNALLIFDEVQTGVGRTGE 234
Cdd:PRK07480                                  193 gdmtpeefgLAAARQLeakILelgaDNVAAFIGEPIQGAGGVIipPAT--YWPEIQRICRKYDILLVADEVICGFGRTGE 270
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 235 LYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVG----THGTTYGGNPLASAVAGKVLELIntpEMLNGVK 309
Cdd:PRK07480                                  271 WFGSQHFGIKPDLMTIAKGLTSGYiPMGAVGVGDRVAEVLIEEggefNHGFTYSGHPVAAAVALANLRIL---RDEGIVE 347
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 310 QRHD----WFVERLNTI-NHRygLFSEVRGLGLLIGCVLNADYAGQAKQisqeAAKAGVMVL-----IAGGNVVR----- 374
Cdd:PRK07480                                  348 RVRDdtgpYLQKRLRELaDHP--LVGEVRGVGLVGAIELVKDKATRERF----EAGGGVGTIcrdhcFANGLIMRavgdr 421
                                                         410
                                                  ....*....|....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 375 --FAPALNVSEEEV 386
Cdd:PRK07480                                  422 miISPPLVITHAEI 435
PRK05639 PRK05639
acetyl ornithine aminotransferase family protein;
22-391 4.53e-55

acetyl ornithine aminotransferase family protein;


Pssm-ID: 168145 [Multi-domain]  Cd Length: 457  Bit Score: 188.22  E-value: 4.53e-55
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYT-NEPVLRLAKKLIDATFAD--R 98
Cdd:PRK05639                                   36 PLVPKRGFGALIEDVDGNVFIDFLAGAAAASTGYSHPKLVKAVQEQVALIQHSMIGYThSERAIRVAEKLAEISPIEnpK 115
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  99 VFFCNSGAEANEAALKLArkfahdRYGSHKSGIVAFKNAFHGRTLFTVS-AGGQPAYSQDFAPLPADIRHAAY------- 170
Cdd:PRK05639                                  116 VLFGLSGSDAVDMAIKVS------KFSTRRPWILAFIGAYHGQTLGATSvAAFQSSQKRGFSPLMPNVVWIPYpnpyrnp 189
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 171 ---NDINSASALID-----------------DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVG 230
Cdd:PRK05639                                  190 wgiNGYEEPDELINrfldylenyvfshvvppDEVAALFAEPIQGDAGIVVPPENFFKELKKLLDEHGILLVMDEVQTGIG 269
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 231 RTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARvMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQ 310
Cdd:PRK05639                                  270 RTGKWFASEWFEVKPDLIIFGKGVASGMGLSGVIGRKELMD-LTSGSALLTPAANPVISAAAEATLEIIEEENLLKNALK 348
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 311 RHDWFVERLNTINHRYGLFSEVRGLGLLIGCVL-------NADYAGqakQISQEAAKAGVMVLIAG--GNVVRFAPALNV 381
Cdd:PRK05639                                  349 VGEFIKKRLLEMKESFEVIGDVRGKGLMIGVEIvkengkpDPELTG---KICWRAFELGLILPSYGmfGNVIRITPPLVI 425
                                                         410
                                                  ....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 382 SEEEVTTGLD 391
Cdd:PRK05639                                  426 TKEIAEKGLE 435
PRK09221 PRK09221
beta alanine--pyruvate transaminase; Provisional
13-396 7.31e-55

beta alanine--pyruvate transaminase; Provisional


Pssm-ID: 181707 [Multi-domain]  Cd Length: 445  Bit Score: 187.37  E-value: 7.31e-55
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  13 WMiPVYA-----SAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--------FWHTGngyt 79
Cdd:PRK09221                                   19 WM-PFTAnrqfkAAPRLLVSAEGMYYTDADGRKILDGTAGLWCCNAGHGRPEIVEAVARQAATldyapafqMGHPL---- 93
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  80 nepVLRLAKKLIDATFA--DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQD 157
Cdd:PRK09221                                   94 ---AFELAERLAELAPGglDHVFFTNSGSESVDTALKIALAYHRARGQGTRTRLIGRERGYHGVGFGGISVGGIVNNRKM 170
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 158 FAP-------LPA--DIRHAAY------------NDINSASALIDDST-CAVIVEPIQGEGGVVPASNAFLQGLRELCNR 215
Cdd:PRK09221                                  171 FGGllpgvdhLPHtlDLPENAFskgqpehgaelaDDLERLVALHDASTiAAVIVEPMAGSAGVLVPPKGYLQRLREICDK 250
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 216 HNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL-GGGFPVGALLATEECARVMTVG-------THGTTYGGNPL 287
Cdd:PRK09221                                  251 HGILLIFDEVITGFGRLGAAFAAERFGVTPDIITFAKGLtNGAIPMGAVIASDEIYDAFMQGpeyaiefFHGYTYSAHPV 330
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 288 ASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINhryGL--FSEVRGLGLLIGCVLNADYAGQAK---QISQEAAKAG 362
Cdd:PRK09221                                  331 ACAAGLATLDIYREEDLFERAAELAPYFEDAVHSLK---GLphVIDIRNIGLVAGIELAPRPGAPGArgyEAFMKCFEKG 407
                                                         410       420       430
                                                  ....*....|....*....|....*....|....
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 363 VMVLIaGGNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK09221                                  408 LLVRY-TGDTIALSPPLIIEKAQIDELVDALGDA 440
PRK13360 PRK13360
omega amino acid--pyruvate transaminase; Provisional
3-396 4.45e-54

omega amino acid--pyruvate transaminase; Provisional


Pssm-ID: 183999 [Multi-domain]  Cd Length: 442  Bit Score: 185.33  E-value: 4.45e-54
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef   3 QPITRENFdeWMiPVYAS-----APFIPVRGEGSRLWDQQGKEYID-FAGGIAVNAlGHAHPELREALNEQASKFWHTGN 76
Cdd:PRK13360                                    8 TPNDLSAF--WM-PFTANrqfkkAPRLLVAAKGMYYTTHDGRRVLDgTAGLWCVNA-GHGRPEIVEAVRAQAGELDYAPA 83
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  77 GYTNEP-VLRLAKKLIDATFAD--RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPA 153
Cdd:PRK13360                                   84 FQMGHPkAFELANRIAEIAPGGlnHVFFTNSGSESVDTALKIALAYHRARGEGSRTRLIGRERGYHGVGFGGISVGGIVP 163
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 154 YSQDFAPLPADIRH---------AAY------------NDINSASALIDDST-CAVIVEPIQGEGGVVPASNAFLQGLRE 211
Cdd:PRK13360                                  164 NRKAFGALLPGVDHlphtldlarNAFskgqpehgaelaDELERLVTLHDASTiAAVIVEPVAGSTGVLIPPKGYLQRLRE 243
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 212 LCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKAL-GGGFPVGALLATEECARVMTVGT-------HGTTYG 283
Cdd:PRK13360                                  244 ICDKHGILLIFDEVITGFGRLGAPFAAQYFGVTPDLLTCAKGLtNGAIPMGAVFVSSEIHDAFMQGPeagieffHGYTYS 323
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 284 GNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFsEVRGLGlLIGCVLNADYAGQAKQISQEAA---- 359
Cdd:PRK13360                                  324 GHPLACAAALATLDLYEREGLLTRAARLAPYWEDALHSLRDAPHVI-DIRNLG-LVGAVELAPRDGKPGKRAYEVFlkcf 401
                                                         410       420       430
                                                  ....*....|....*....|....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 360 KAGVMVLiAGGNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK13360                                  402 EKGLMIR-YTGDILALSPPLIIEEAQIDELFDILAQA 437
PRK07030 PRK07030
adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
22-387 8.09e-54

adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional


Pssm-ID: 180800 [Multi-domain]  Cd Length: 466  Bit Score: 185.33  E-value: 8.09e-54
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPV-RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTG-NGYTNEPVLRLAKKLIDATFA--D 97
Cdd:PRK07030                                   29 PLIPIrRGEGVWLEDFEGKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVIlAGFSHEPVIELSERLVKITPPglS 108
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  98 RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADI------------ 165
Cdd:PRK07030                                  109 RCFYADNGSSAIEVALKMSFHYWRNRGKPRKKRFVTLTNSYHGETLAAMSVGDVALFTETYKPLLLDTikvpspdcylrp 188
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 166 ------RHA--AYNDINSASALIDDSTCAVIVEP-IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELY 236
Cdd:PRK07030                                  189 egmsweEHSrrMFAHMEQTLAEHHDEIAAVIVEPlIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMF 268
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 237 AYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARV-------MTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGV 308
Cdd:PRK07030                                  269 ACEQAGIRPDFLCLSKALTGGYlPLAAVLTTDTVYQAfyddyptLRAFLHSHSYTGNPLACAAALATLDIFEQDNVIENN 348
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 309 K---QRHDWFVERLNTINHryglFSEVRGLGLLIGCVLNADYAGQAK---------QISQEAAKAGVMvLIAGGNVVRFA 376
Cdd:PRK07030                                  349 RalaRRMAEATAHLADHPH----VAEVRQTGMILAIEMVQDKASKTPypwqerrglKVYQHALERGAL-LRPLGSVVYFL 423
                                                         410
                                                  ....*....|.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 377 PALNVSEEEVT 387
Cdd:PRK07030                                  424 PPYVITPEQID 434
PLN02760 PLN02760
4-aminobutyrate:pyruvate transaminase
22-396 1.18e-53

4-aminobutyrate:pyruvate transaminase


Pssm-ID: 215405 [Multi-domain]  Cd Length: 504  Bit Score: 185.79  E-value: 1.18e-53
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLID---ATFA 96
Cdd:PLN02760                                   72 PLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVAAATEQLNKlpFYHSFWNRTTKPSLDLAKELLEmftARKM 151
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFaPLPA------DIRHAAY 170
Cdd:PLN02760                                  152 GKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARSKSYHGSTLISASLSGLPALHQKF-DLPApfvlhtDCPHYWR 230
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 171 NDI-------------NSASALI----DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:PLN02760                                  231 FHLpgeteeefstrlaDNLENLIlkegPETIAAFIAEPVMGAGGVIPPPATYFEKIQAVLKKYDILFIADEVICAFGRLG 310
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVM-----TVGT--HGTTYGGNPLASAVAGKVLELI---NTP 302
Cdd:PLN02760                                  311 TMFGCDKYNIKPDLVSLAKALSSAYmPIGAVLVSPEISDVIhsqsnKLGSfaHGFTYSGHPVSCAVALEALKIYkerNIP 390
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 303 EMLNGVKQRhdwFVERLNTINHRyGLFSEVRGLGLLIGCVLNADYA---------GQAKQISQEAAKAGVMVLIAGGNVV 373
Cdd:PLN02760                                  391 EHVNKIAPR---FQDGIKAFSGS-PIIGEIRGTGLILGTEFVDNKSpndpfpaewGVGAYFGAECKKRGMLVRVAGDNIM 466
                                                         410       420
                                                  ....*....|....*....|...
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 374 rFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PLN02760                                  467 -MSPPLIITPEEVDELISIYGKA 488
PRK07036 PRK07036
aminotransferase;
19-386 4.52e-53

aminotransferase;


Pssm-ID: 235913 [Multi-domain]  Cd Length: 466  Bit Score: 183.35  E-value: 4.52e-53
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  19 ASAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLIDATFA 96
Cdd:PRK07036                                   31 KEGSLVIVEAEGIYVTDADGRRYLDGIGGMWCVNVGYGREEMADAIADQARRlpYYTPFGDMTNAPAAELAAKLAELAPG 110
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  97 D--RVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRH------- 167
Cdd:PRK07036                                  111 DlnHVFLTTGGSTAVDSALRFVHYYFNVRGRPAKKHIITRGDAYHGSTYLTASLTGKAADRTEFDYASDLVHHlsspnpy 190
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 168 --------AAYND--INSASALID----DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTG 233
Cdd:PRK07036                                  191 rrpagmseAAFCDflVDEFEDKILslgaDNIAAFIAEPILGSGGVIVPPPGYHARMREICRRYDILYISDEVVTGFGRLG 270
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 234 ELYA-YMHYGVTPDLLTTAKALGGG-FPVGALLATEECARVMT-------VGTHGTTYGGNPLASAVAGKVLELINTPEM 304
Cdd:PRK07036                                  271 HFFAsEAVFGIQPDIITFAKGLTSGyQPLGAVIISERLLDVISgpnakgnVFTHGFTYSGHPVACAAALKNIEIMEREGL 350
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 305 LNGVKQRHDWFVERLNTINHrYGLFSEVRGLGLL--IGCVLNADYAGQ-------AKQISQEAAKAGVMVL-IAGGNVVr 374
Cdd:PRK07036                                  351 CEHVREVGPYFEERLASLRE-LPLVGDVRGDHLMacVECVADKGSKALlpediaiGQRIDRHCQERGLLVRpLEHLCVL- 428
                                                         410
                                                  ....*....|..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 375 fAPALNVSEEEV 386
Cdd:PRK07036                                  429 -SPPLIITRAQI 439
PRK07482 PRK07482
hypothetical protein; Provisional
19-396 2.08e-52

hypothetical protein; Provisional


Pssm-ID: 236026 [Multi-domain]  Cd Length: 461  Bit Score: 181.36  E-value: 2.08e-52
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  19 ASAPFIPVRGEGSRLWDQQGKEYID-FAGGIAVNaLGHAHPELREALNEQASK--FWHTGNGYTNEPVLRLAKKLIDATF 95
Cdd:PRK07482                                   30 ELPGRIVEGGEGIRITDAQGRRYIDaFAGLYCVN-VGYGRTEVAEAIAEQAKElaYYHTYVGHGTEASITLSKRIIDRAP 108
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  96 A--DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFaPLPAD-IRHA---- 168
Cdd:PRK07482                                  109 AgmSKVYYGLSGSDANETQIKLVWYYNNVLGRPEKKKIISRWRGYHGSGVVTGSLTGLSLFHQHF-DLPIArVLHTeaph 187
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 169 ----AYNDINSAS----------ALI----DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVG 230
Cdd:PRK07482                                  188 yyrrADAGMSEEQfsaycadeleELIlaegPDTIAAFIAEPVLGTGGIVPPPAGYWPAIQAVLKKYDILLIADEVVTGFG 267
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 231 RTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGT-------HGTTYGGNPLASAVAGKVLELINTP 302
Cdd:PRK07482                                  268 RLGSMFGSDHYGIEPDLITVAKGLTSAYaPLSGSIVGEKVWDVLEQGSdehgaigHGWTYSGHPICAAAALANLDILERE 347
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 303 EMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAK---------QISQEAAKAGVmvlIA----G 369
Cdd:PRK07482                                  348 NLVGNAAEVGAYFRARLRAAFGDHPLVGEVRGVGMLAAVEFVADRDDRTPfdpalkigpQVSAAALERGV---IArampH 424
                                                         410       420
                                                  ....*....|....*....|....*..
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 370 GNVVRFAPALNVSEEEVTTGLDRFAAA 396
Cdd:PRK07482                                  425 GDILGFAPPLVLTRAEADEIVAIAKDA 451
PRK05965 PRK05965
hypothetical protein; Provisional
28-386 1.36e-48

hypothetical protein; Provisional


Pssm-ID: 180330 [Multi-domain]  Cd Length: 459  Bit Score: 171.00  E-value: 1.36e-48
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  28 GEGSRLWDQQGKEYID-FAGGIAVNAlGHAHPELREALNEQASKF-WHTGN-GYTNEPVLRLAKKLIDATFAD--RVFFC 102
Cdd:PRK05965                                   35 AKGATLTDASGHQLLDaFAGLWCVNV-GYGQESIVEAAAEQMRELpYATGYfHFGSEPAIRLAAKLAERAPGSlnHVYFT 113
                                                          90       100       110       120       130       140       150       160
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 103 NSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTlfTVSAG-----------GQPAYSQDFAPLPADIRHAAYN 171
Cdd:PRK05965                                  114 LGGSDAVDSAVRFIRHYWNATGRPSKKQFISLERGYHGSS--SVGAGltalpafhrgfDLPLPWQHKIPSPYPYRNPVGD 191
                                                         170       180       190       200       210       220       230       240
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 172 DinsASALIDDSTCAV---------------IVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELY 236
Cdd:PRK05965                                  192 D---PQAIIAASVAALrakvaelgadnvaafFCEPIQGSGGVIVPPKGWLKAMREACRELGILFVADEVITGFGRTGPLF 268
                                                         250       260       270       280       290       300       310       320
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 237 AYMHYGVTPDLLTTAKALGGGF-PVGALLATEE--------CARVMTVGtHGTTYGGNPLASAVAGKVLELINTPEML-N 306
Cdd:PRK05965                                  269 ACEAEGVVPDLMTVAKGLTSGYvPMGAVLMSDHvyqgiadgAGAAAPVG-HGYTYSAHPVSAAVGLEVLRLYHEGGLLaN 347
                                                         330       340       350       360       370       380       390       400
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 307 GVKQ--RHDWFVERLntINHRygLFSEVRGLGLLIGCVLNAD---------YAGQAKQISQEAAKAGVMVLIAGGNVVRF 375
Cdd:PRK05965                                  348 GQKAgpRFAAGLDAL--RAHP--LVGDVRGRGLLGALELVADkatktpfdaALDPADRIFDRAYANGLVFRAFGDGVLGF 423
                                                         410
                                                  ....*....|.
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef 376 APALNVSEEEV 386
Cdd:PRK05965                                  424 APALCCTEGEF 434
PRK07986 PRK07986
adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated
54-342 5.95e-43

adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated


Pssm-ID: 181189 [Multi-domain]  Cd Length: 428  Bit Score: 155.22  E-value: 5.95e-43
                                                          10        20        30        40        50        60        70        80
                                                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
seqsig_MSQPI_34e9442f1191033e5040c00fd68efdef  54 GHAHPELREALNEQASKFWHTG-NGYTNEPVLRLAKKLIDATFA--DRVFFCNSGAEANEAALKLARKFAHDRy