NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27687485|ref|XP_237538|]
View 

PREDICTED: leucine-rich repeat-containing protein 30 [Rattus norvegicus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK15370 super family cl33128
E3 ubiquitin-protein ligase SlrP; Provisional
59-227 6.81e-13

E3 ubiquitin-protein ligase SlrP; Provisional


The actual alignment was detected with superfamily member PRK15370:

Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 68.57  E-value: 6.81e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   59 MTDIPDFLWGLLevQKLNLSHNQLRVLPPEVGRLTRivVLNLCGNCLKSLPKEvsLLQSLKVLFLNMNCLAEVPAELSLc 138
Cdd:PRK15370 253 ITELPERLPSAL--QSLDLFHNKISCLPENLPEELR--YLSVYDNSIRTLPAH--LPSGITHLNVQSNSLTALPETLPP- 325
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  139 rNLEVLSMSHNCLSQLPASFAdlARLRKLNLSNNYFAHIPLCV-FSLKELDFLHvgsNRLENIAESIQclASLQIFIAES 217
Cdd:PRK15370 326 -GLKTLEAGENALTSLPASLP--PELQVLDVSKNQITVLPETLpPTITTLDVSR---NALTNLPENLP--AALQIMQASR 397
                        170
                 ....*....|
gi 27687485  218 NNIHSFPRSL 227
Cdd:PRK15370 398 NNLVRLPESL 407
 
Name Accession Description Interval E-value
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
59-227 6.81e-13

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 68.57  E-value: 6.81e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   59 MTDIPDFLWGLLevQKLNLSHNQLRVLPPEVGRLTRivVLNLCGNCLKSLPKEvsLLQSLKVLFLNMNCLAEVPAELSLc 138
Cdd:PRK15370 253 ITELPERLPSAL--QSLDLFHNKISCLPENLPEELR--YLSVYDNSIRTLPAH--LPSGITHLNVQSNSLTALPETLPP- 325
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  139 rNLEVLSMSHNCLSQLPASFAdlARLRKLNLSNNYFAHIPLCV-FSLKELDFLHvgsNRLENIAESIQclASLQIFIAES 217
Cdd:PRK15370 326 -GLKTLEAGENALTSLPASLP--PELQVLDVSKNQITVLPETLpPTITTLDVSR---NALTNLPENLP--AALQIMQASR 397
                        170
                 ....*....|
gi 27687485  218 NNIHSFPRSL 227
Cdd:PRK15370 398 NNLVRLPESL 407
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
72-224 2.91e-12

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.14  E-value: 2.91e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  72 VQKLNLSHNQLRVLPPEVGRLT-RIVVLNLCGNCLKSLPKEVSLLQSLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNC 150
Cdd:COG4886 118 LTSLDLDNNNITDIPPLIGLLKsNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNK 197
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27687485 151 LSQLPASFADLARLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNIHSFP 224
Cdd:COG4886 198 ISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS 271
LRR_8 pfam13855
Leucine rich repeat;
117-174 3.78e-05

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 40.58  E-value: 3.78e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   117 SLKVLFLNMNCLAEVPAE-LSLCRNLEVLSMSHNCLSQL-PASFADLARLRKLNLSNNYF 174
Cdd:pfam13855   1 NLRSLDLSNNRLTVLDDGaFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSGNRL 60
 
Name Accession Description Interval E-value
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
59-227 6.81e-13

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 68.57  E-value: 6.81e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   59 MTDIPDFLWGLLevQKLNLSHNQLRVLPPEVGRLTRivVLNLCGNCLKSLPKEvsLLQSLKVLFLNMNCLAEVPAELSLc 138
Cdd:PRK15370 253 ITELPERLPSAL--QSLDLFHNKISCLPENLPEELR--YLSVYDNSIRTLPAH--LPSGITHLNVQSNSLTALPETLPP- 325
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  139 rNLEVLSMSHNCLSQLPASFAdlARLRKLNLSNNYFAHIPLCV-FSLKELDFLHvgsNRLENIAESIQclASLQIFIAES 217
Cdd:PRK15370 326 -GLKTLEAGENALTSLPASLP--PELQVLDVSKNQITVLPETLpPTITTLDVSR---NALTNLPENLP--AALQIMQASR 397
                        170
                 ....*....|
gi 27687485  218 NNIHSFPRSL 227
Cdd:PRK15370 398 NNLVRLPESL 407
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
72-224 2.91e-12

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.14  E-value: 2.91e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  72 VQKLNLSHNQLRVLPPEVGRLT-RIVVLNLCGNCLKSLPKEVSLLQSLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNC 150
Cdd:COG4886 118 LTSLDLDNNNITDIPPLIGLLKsNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNK 197
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27687485 151 LSQLPASFADLARLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNIHSFP 224
Cdd:COG4886 198 ISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS 271
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
69-232 3.00e-12

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.14  E-value: 3.00e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  69 LLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPKEVSLLQS-LKVLFLNMNCLAEVPAELSLCRNLEVLSMS 147
Cdd:COG4886  92 LLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSnLKELDLSDNKIESLPSPLRNLPNLKNLDLS 171
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485 148 HNCLSQLPASFADLARLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNIHSFPRSL 227
Cdd:COG4886 172 FNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESI 251

                ....*
gi 27687485 228 CLVTS 232
Cdd:COG4886 252 GNLSN 256
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
71-220 3.38e-12

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 66.14  E-value: 3.38e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  71 EVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPKEVSLLQSLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNC 150
Cdd:COG4886 141 NLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNS 220
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485 151 LSQLPASFADLARLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIaESIQCLASLQIFIAESNNI 220
Cdd:COG4886 221 IIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSI-SSLGSLTNLRELDLSGNSL 289
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
37-220 5.51e-11

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 62.29  E-value: 5.51e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  37 KDPRSLLKRGMRHVSFSLVTKGMTDIPDFLWGLLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPKEVSLLQ 116
Cdd:COG4886 130 DIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLS 209
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485 117 SLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNCLSQLPASFADLARLRKLNLSNNYFAHIPlCVFSLKELDFLHVGSNR 196
Cdd:COG4886 210 ALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS-SLGSLTNLRELDLSGNS 288
                       170       180
                ....*....|....*....|....*.
gi 27687485 197 LENIAESI--QCLASLQIFIAESNNI 220
Cdd:COG4886 289 LSNALPLIalLLLLLELLLNLLLTLK 314
PRK15370 PRK15370
E3 ubiquitin-protein ligase SlrP; Provisional
58-290 3.90e-10

E3 ubiquitin-protein ligase SlrP; Provisional


Pssm-ID: 185268 [Multi-domain]  Cd Length: 754  Bit Score: 60.48  E-value: 3.90e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   58 GMTDIPDFLwgLLEVQKLNLSHNQLRVLPPEVGrlTRIVVLNLCGNCLKSLPKevSLLQSLKVLFLNMNCLAEVPAELSl 137
Cdd:PRK15370 189 GLTTIPACI--PEQITTLILDNNELKSLPENLQ--GNIKTLYANSNQLTSIPA--TLPDTIQEMELSINRITELPERLP- 261
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  138 cRNLEVLSMSHNCLSQLPASFADlaRLRKLNLSNNYF----AHIPLCVFSLkeldflHVGSNRLENIAESIQclASLQIF 213
Cdd:PRK15370 262 -SALQSLDLFHNKISCLPENLPE--ELRYLSVYDNSIrtlpAHLPSGITHL------NVQSNSLTALPETLP--PGLKTL 330
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27687485  214 IAESNNIHSFPRSLclVTSLELLNLNNNDIQTLPDELyllcrlgriawNPMDKGLHISHNPLSKpLPELVEGGLEML 290
Cdd:PRK15370 331 EAGENALTSLPASL--PPELQVLDVSKNQITVLPETL-----------PPTITTLDVSRNALTN-LPENLPAALQIM 393
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
75-228 9.77e-10

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 59.09  E-value: 9.77e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   75 LNLSHNQLR-VLPPEVGRLTRIVVLNLCGNCLKS-LPKEVSLLQSLKVLFLNMNCL-AEVPAELSLCRNLEVLSMSHNCL 151
Cdd:PLN00113 145 LDLSNNMLSgEIPNDIGSFSSLKVLDLGGNVLVGkIPNSLTNLTSLEFLTLASNQLvGQIPRELGQMKSLKWIYLGYNNL 224
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  152 S-------------------------QLPASFADLARLRKLNLSNNYFA-HIPLCVFSLKELDFLHVGSNRLE-NIAESI 204
Cdd:PLN00113 225 SgeipyeiggltslnhldlvynnltgPIPSSLGNLKNLQYLFLYQNKLSgPIPPSIFSLQKLISLDLSDNSLSgEIPELV 304
                        170       180
                 ....*....|....*....|....*
gi 27687485  205 QCLASLQIFIAESNNIH-SFPRSLC 228
Cdd:PLN00113 305 IQLQNLEILHLFSNNFTgKIPVALT 329
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
62-172 9.59e-09

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 56.01  E-value: 9.59e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   62 IPDFLWGLLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLK-SLPKEVSLLQSLKVLFLNMNCLA-EVPAELSLCR 139
Cdd:PLN00113 444 INSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSgAVPRKLGSLSELMQLKLSENKLSgEIPDELSSCK 523
                         90       100       110
                 ....*....|....*....|....*....|....
gi 27687485  140 NLEVLSMSHNCLS-QLPASFADLARLRKLNLSNN 172
Cdd:PLN00113 524 KLVSLDLSHNQLSgQIPASFSEMPVLSQLDLSQN 557
PLN03150 PLN03150
hypothetical protein; Provisional
62-135 1.62e-07

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 52.13  E-value: 1.62e-07
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27687485   62 IPDFLWGLLEVQKLNLSHNQLR-VLPPEVGRLTRIVVLNLCGNCLK-SLPKEVSLLQSLKVLFLNMNCLA-EVPAEL 135
Cdd:PLN03150 434 IPNDISKLRHLQSINLSGNSIRgNIPPSLGSITSLEVLDLSYNSFNgSIPESLGQLTSLRILNLNGNSLSgRVPAAL 510
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
34-228 3.63e-07

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 51.39  E-value: 3.63e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   34 LLGKDPRSLLKRGMRHVsFSLVTKGMT-DIPDFLWGLLEVQKLNLSHNQLR-VLPPEVGRLTRIVVLNLCGNCLK-SLPK 110
Cdd:PLN00113 176 LVGKIPNSLTNLTSLEF-LTLASNQLVgQIPRELGQMKSLKWIYLGYNNLSgEIPYEIGGLTSLNHLDLVYNNLTgPIPS 254
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  111 EVSLLQSLKVLFLNMNCLA-EVPAELSLCRNLEVLSMSHNCLS-QLPASFADLARLRKLNL-SNNYFAHIPLCVFSLKEL 187
Cdd:PLN00113 255 SLGNLKNLQYLFLYQNKLSgPIPPSIFSLQKLISLDLSDNSLSgEIPELVIQLQNLEILHLfSNNFTGKIPVALTSLPRL 334
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 27687485  188 DFLHVGSNRLE-NIAESIQCLASLQIFIAESNNIHS-FPRSLC 228
Cdd:PLN00113 335 QVLQLWSNKFSgEIPKNLGKHNNLTVLDLSTNNLTGeIPEGLC 377
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
62-174 4.54e-07

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 51.00  E-value: 4.54e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   62 IPDFlWGLLEVQKLNLSHNQLR-VLPPEVGRLTRIVVLNLCGNCLKS-LPKEVSLLQSLKVLFLNMNCLA-EVPAELSLC 138
Cdd:PLN00113 468 LPDS-FGSKRLENLDLSRNQFSgAVPRKLGSLSELMQLKLSENKLSGeIPDELSSCKKLVSLDLSHNQLSgQIPASFSEM 546
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 27687485  139 RNLEVLSMSHNCLS-QLPASFADLARLRKLNLSNNYF 174
Cdd:PLN00113 547 PVLSQLDLSQNQLSgEIPKNLGNVESLVQVNISHNHL 583
PRK15387 PRK15387
E3 ubiquitin-protein ligase SspH2; Provisional
59-232 6.80e-07

E3 ubiquitin-protein ligase SspH2; Provisional


Pssm-ID: 185285 [Multi-domain]  Cd Length: 788  Bit Score: 50.16  E-value: 6.80e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   59 MTDIPDFLWGLlevQKLNLSHNQLRVLPPEVGRLTRIVVLNlcgNCLKSLPKEVSLLQSLKVlflNMNCLAEVPaelSLC 138
Cdd:PRK15387 294 LTSLPVLPPGL---QELSVSDNQLASLPALPSELCKLWAYN---NQLTSLPTLPSGLQELSV---SDNQLASLP---TLP 361
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  139 RNLEVLSMSHNCLSQLPASFADlarLRKLNLSNNYFAHIPLCVFSLKEldfLHVGSNRLENIAESIQCLASLQIFiaeSN 218
Cdd:PRK15387 362 SELYKLWAYNNRLTSLPALPSG---LKELIVSGNRLTSLPVLPSELKE---LMVSGNRLTSLPMLPSGLLSLSVY---RN 432
                        170
                 ....*....|....
gi 27687485  219 NIHSFPRSLCLVTS 232
Cdd:PRK15387 433 QLTRLPESLIHLSS 446
PLN03150 PLN03150
hypothetical protein; Provisional
108-175 2.42e-06

hypothetical protein; Provisional


Pssm-ID: 178695 [Multi-domain]  Cd Length: 623  Bit Score: 48.66  E-value: 2.42e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  108 LPKEVSLLQSLKVLFLNMNCL-AEVPAELSLCRNLEVLSMSHNCLS-QLPASFADLARLRKLNLSNNYFA 175
Cdd:PLN03150 434 IPNDISKLRHLQSINLSGNSIrGNIPPSLGSITSLEVLDLSYNSFNgSIPESLGQLTSLRILNLNGNSLS 503
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
14-283 7.64e-06

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 47.15  E-value: 7.64e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   14 DPKRFLvgkrqkfSSWDDTLLLGKDPRSLLKRGMRHVSFSLVTKGMT-DIPDFLWGLLEVQKLNLSHNQLR-VLPPEVGR 91
Cdd:PLN00113  43 DPLKYL-------SNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISgKISSAIFRLPYIQTINLSNNQLSgPIPDDIFT 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   92 LT-RIVVLNLCGNCLK-SLPKevSLLQSLKVLFLNMNCLA-EVPAELSLCRNLEVLSMSHNCLS-QLPASFADLARLRKL 167
Cdd:PLN00113 116 TSsSLRYLNLSNNNFTgSIPR--GSIPNLETLDLSNNMLSgEIPNDIGSFSSLKVLDLGGNVLVgKIPNSLTNLTSLEFL 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485  168 NL-SNNYFAHIPLCVFSLKELDFLHVGSNRLE-NIAESIQCLASLQIFIAESNNIH-SFPRSLCLVTSLELLNLNNNDIQ 244
Cdd:PLN00113 194 TLaSNQLVGQIPRELGQMKSLKWIYLGYNNLSgEIPYEIGGLTSLNHLDLVYNNLTgPIPSSLGNLKNLQYLFLYQNKLS 273
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 27687485  245 -TLPDELYLLCRLgriawnpmdKGLHISHNPLSKPLPELV 283
Cdd:PLN00113 274 gPIPPSIFSLQKL---------ISLDLSDNSLSGEIPELV 304
LRR_8 pfam13855
Leucine rich repeat;
117-174 3.78e-05

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 40.58  E-value: 3.78e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   117 SLKVLFLNMNCLAEVPAE-LSLCRNLEVLSMSHNCLSQL-PASFADLARLRKLNLSNNYF 174
Cdd:pfam13855   1 NLRSLDLSNNRLTVLDDGaFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSGNRL 60
PLN00113 PLN00113
leucine-rich repeat receptor-like protein kinase; Provisional
62-174 1.60e-04

leucine-rich repeat receptor-like protein kinase; Provisional


Pssm-ID: 215061 [Multi-domain]  Cd Length: 968  Bit Score: 42.91  E-value: 1.60e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   62 IPDFLWGLLEVQKLNLSHNQLR-VLPPEVGRLTRIVVLNLCGNCLKS-LPKEVSLLQSLKVLFLNMNCL-AEVPAELSLC 138
Cdd:PLN00113 324 IPVALTSLPRLQVLQLWSNKFSgEIPKNLGKHNNLTVLDLSTNNLTGeIPEGLCSSGNLFKLILFSNSLeGEIPKSLGAC 403
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 27687485  139 RNLEVLSMSHNCLS-QLPASFADLARLRKLNLSNNYF 174
Cdd:PLN00113 404 RSLRRVRLQDNSFSgELPSEFTKLPLVYFLDISNNNL 440
LRR_8 pfam13855
Leucine rich repeat;
140-197 2.65e-04

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 38.27  E-value: 2.65e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 27687485   140 NLEVLSMSHNCLSQL-PASFADLARLRKLNLSNNYFAHIPLCVFS-LKELDFLHVGSNRL 197
Cdd:pfam13855   1 NLRSLDLSNNRLTVLdDGAFKGLSNLKVLDLSNNLLTTLSPGAFSgLPSLRYLDLSGNRL 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH