NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|11265361|gb|T48355|]
View 

transitional endoplasmic reticulum ATPase - Arabidopsis thaliana

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CDC48 super family cl36852
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
62-801 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


The actual alignment was detected with superfamily member TIGR01243:

Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 781.01  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    62 RLVVDEAINDD--NSVVSLHPTTMEKLQLFRGDTILIKGKKRKdTVCIALADETCEEPK--IRMNKVVRSNLRVRLGDVI 137
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVWPLRPDDEGRgiIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   138 SVHQCpDVKYGKRVHILPvddTVEGVTGNLFDAYLKPYFLEayRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDT 217
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   218 EIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 297
Cdd:TIGR01243 156 EVEIREKPVREEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   298 TGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKSRAHV 377
Cdd:TIGR01243 236 AGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGRV 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   378 IVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQ 457
Cdd:TIGR01243 316 IVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   458 CIREKMDV--IDLEDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEH 535
Cdd:TIGR01243 396 ALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKH 475
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   536 PEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDEL 615
Cdd:TIGR01243 476 PEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDEI 555
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   616 DSIATQRGNSAGDAggAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKA 695
Cdd:TIGR01243 556 DAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFKI 633
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   696 CLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIRENIeKDIENERRrsqnpEAMEEDMVDDEVSEIRaaHFEE 775
Cdd:TIGR01243 634 HTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESI-GSPAKEKL-----EVGEEEFLKDLKVEMR--HFLE 705
                         730       740
                  ....*....|....*....|....*.
gi 11265361   776 SMKYARRSVSDADIRKYQAFAQTLQQ 801
Cdd:TIGR01243 706 ALKKVKPSVSKEDMLRYERLAKELKR 731
 
Name Accession Description Interval E-value
CDC48 TIGR01243
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
62-801 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 781.01  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    62 RLVVDEAINDD--NSVVSLHPTTMEKLQLFRGDTILIKGKKRKdTVCIALADETCEEPK--IRMNKVVRSNLRVRLGDVI 137
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVWPLRPDDEGRgiIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   138 SVHQCpDVKYGKRVHILPvddTVEGVTGNLFDAYLKPYFLEayRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDT 217
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   218 EIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 297
Cdd:TIGR01243 156 EVEIREKPVREEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   298 TGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKSRAHV 377
Cdd:TIGR01243 236 AGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGRV 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   378 IVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQ 457
Cdd:TIGR01243 316 IVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   458 CIREKMDV--IDLEDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEH 535
Cdd:TIGR01243 396 ALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKH 475
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   536 PEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDEL 615
Cdd:TIGR01243 476 PEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDEI 555
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   616 DSIATQRGNSAGDAggAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKA 695
Cdd:TIGR01243 556 DAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFKI 633
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   696 CLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIRENIeKDIENERRrsqnpEAMEEDMVDDEVSEIRaaHFEE 775
Cdd:TIGR01243 634 HTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESI-GSPAKEKL-----EVGEEEFLKDLKVEMR--HFLE 705
                         730       740
                  ....*....|....*....|....*.
gi 11265361   776 SMKYARRSVSDADIRKYQAFAQTLQQ 801
Cdd:TIGR01243 706 ALKKVKPSVSKEDMLRYERLAKELKR 731
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
257-785 0e+00

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 554.43  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 257 ELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANEtGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSI 336
Cdd:COG0464   1 ELPLKEPELFKKLGIEPPKGVLLHGPPGTGKTLLARALANE-GAEFLSINGPEILSKYVGESELRLRELFEEAEKLAPSI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 337 IFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKsRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEV 416
Cdd:COG0464  80 IFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLK-RGQVIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 417 LRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDvidleddsidaEILNSMAVSNEHFHTALGNSN 496
Cdd:COG0464 159 LQIHTRLMFLGPPGTGKTLAARTVGKSGADLGALAKEAALRELRRAID-----------LVGEYIGVTEDDFEEALKKVL 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 497 PSalRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFI 576
Cdd:COG0464 228 PS--RGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFI 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 577 SVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSagdAGGAADRVLNQLLTEMDGMNAKKTVFII 656
Cdd:COG0464 306 SVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPS---EDGSGRRVVGQLLTELDGIEKAEGVLVI 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 657 GATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKS--PVAKDVDVTALAKYTQGFSGADITEICQRACKYA 734
Cdd:COG0464 383 AATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKkpPLAEDVDLEELAEITEGYSGADIAALVREAALEA 462
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|.
gi 11265361 735 IRENIEKDIENErrrsqnpeameedmvddevseiraaHFEESMKYARRSVS 785
Cdd:COG0464 463 LREARRREVTLD-------------------------DFLDALKKIKPSVT 488
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
236-470 2.62e-96

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 305.99  E-value: 2.62e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  236 EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLA 315
Cdd:PRK03992 127 NVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFI 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  316 GESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR--EKTNGEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPA 392
Cdd:PRK03992 207 GEGARLVRELFELAREKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAEMDGFDPRGNVKIIAATNRIDILDPA 286
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361  393 LRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 470
Cdd:PRK03992 287 ILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEAGMFAIRDDRTEVTMED 364
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
277-407 1.51e-54

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 333757 [Multi-domain]  Cd Length: 130  Bit Score: 184.33  E-value: 1.51e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEV 356
Cdd:pfam00004   1 LLLYGPPGTGKTTLAKAVAKELGAPFLEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSRGSGGDSE 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 11265361   357 ERRIVSQLLTLMDGLKSRAH-VIVMGATNRPNSIDPALRRfgRFDREIDIGV 407
Cdd:pfam00004  81 SRRVVNQLLTELDGFTSSLSkVIVIAATNRPDKLDPALLR--RFDRRIEFPL 130
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
243-406 1.43e-31

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 120.33  E-value: 1.43e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 243 GGVRKQMAQIRELVELPlrhpqlfksigvkPPKGILLYGPPGSGKTLIARAVANET---GAFFFCINGPEIMSKLAGESE 319
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 320 ---SNLRKAFEEAEKNAPSIIFIDEIDSIAPkrektngEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRF 396
Cdd:cd00009  68 fghFLVRLLFELAEKAKPGVLFIDEIDSLSR-------GAQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDRALY 140
                       170
                ....*....|
gi 11265361 397 GRFDREIDIG 406
Cdd:cd00009 141 DRLDIRIVIP 150
CDC48_N smart01073
Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel ...
63-142 5.07e-21

Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain.


Pssm-ID: 215012 [Multi-domain]  Cd Length: 82  Bit Score: 87.66  E-value: 5.07e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361     63 LVVDEAINDD---NSVVSLHPTTMEKLQLFRGDTILIKGKKRkdTVCIALADETCEEPK-IRMNKVVRSNLRVRLGDVIS 138
Cdd:smart01073   1 LRVAEAPSDEdvgRGIARLSPEDMDELGLFPGDYVLITGKRR--TVAIVWPAYPEDPGGiIRIDGVQRKNAGVSIGDTVT 78

                   ....
gi 11265361    139 VHQC 142
Cdd:smart01073  79 VRKA 82
 
Name Accession Description Interval E-value
CDC48 TIGR01243
AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two ...
62-801 0e+00

AAA family ATPase, CDC48 subfamily; This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.


Pssm-ID: 273521 [Multi-domain]  Cd Length: 733  Bit Score: 781.01  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    62 RLVVDEAINDD--NSVVSLHPTTMEKLQLFRGDTILIKGKKRKdTVCIALADETCEEPK--IRMNKVVRSNLRVRLGDVI 137
Cdd:TIGR01243   3 ELRVAEAYPRDvgRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVWPLRPDDEGRgiIRMDGYLRANAGVTIGDTV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   138 SVHQCpDVKYGKRVHILPvddTVEGVTGNLFDAYLKPYFLEayRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDT 217
Cdd:TIGR01243  82 TVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEAT 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   218 EIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 297
Cdd:TIGR01243 156 EVEIREKPVREEIERKVPKVTYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANE 235
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   298 TGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKSRAHV 377
Cdd:TIGR01243 236 AGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGRV 315
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   378 IVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQ 457
Cdd:TIGR01243 316 IVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMA 395
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   458 CIREKMDV--IDLEDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEH 535
Cdd:TIGR01243 396 ALRRFIREgkINFEAEEIPAEVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKH 475
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   536 PEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDEL 615
Cdd:TIGR01243 476 PEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKARQAAPAIIFFDEI 555
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   616 DSIATQRGNSAGDAggAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKA 695
Cdd:TIGR01243 556 DAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFKI 633
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   696 CLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIRENIeKDIENERRrsqnpEAMEEDMVDDEVSEIRaaHFEE 775
Cdd:TIGR01243 634 HTRSMPLAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESI-GSPAKEKL-----EVGEEEFLKDLKVEMR--HFLE 705
                         730       740
                  ....*....|....*....|....*.
gi 11265361   776 SMKYARRSVSDADIRKYQAFAQTLQQ 801
Cdd:TIGR01243 706 ALKKVKPSVSKEDMLRYERLAKELKR 731
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
257-785 0e+00

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 554.43  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 257 ELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANEtGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSI 336
Cdd:COG0464   1 ELPLKEPELFKKLGIEPPKGVLLHGPPGTGKTLLARALANE-GAEFLSINGPEILSKYVGESELRLRELFEEAEKLAPSI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 337 IFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKsRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEV 416
Cdd:COG0464  80 IFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLK-RGQVIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 417 LRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDvidleddsidaEILNSMAVSNEHFHTALGNSN 496
Cdd:COG0464 159 LQIHTRLMFLGPPGTGKTLAARTVGKSGADLGALAKEAALRELRRAID-----------LVGEYIGVTEDDFEEALKKVL 227
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 497 PSalRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFI 576
Cdd:COG0464 228 PS--RGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLAKAVALESRSRFI 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 577 SVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSagdAGGAADRVLNQLLTEMDGMNAKKTVFII 656
Cdd:COG0464 306 SVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPS---EDGSGRRVVGQLLTELDGIEKAEGVLVI 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 657 GATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKS--PVAKDVDVTALAKYTQGFSGADITEICQRACKYA 734
Cdd:COG0464 383 AATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKkpPLAEDVDLEELAEITEGYSGADIAALVREAALEA 462
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|.
gi 11265361 735 IRENIEKDIENErrrsqnpeameedmvddevseiraaHFEESMKYARRSVS 785
Cdd:COG0464 463 LREARRREVTLD-------------------------DFLDALKKIKPSVT 488
RPT1 COG1222
ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein ...
229-470 2.90e-97

ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224143 [Multi-domain]  Cd Length: 406  Bit Score: 309.20  E-value: 2.90e-97
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 229 EDEERLDeVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGP 308
Cdd:COG1222 141 EVEEKPD-VTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGS 219
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 309 EIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR--EKTNGEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNR 385
Cdd:COG1222 220 ELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRfdSGTSGDREvQRTMLELLNQLDGFDPRGNVKVIMATNR 299
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 386 PNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDV 465
Cdd:COG1222 300 PDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIRERRDE 379

                ....*
gi 11265361 466 IDLED 470
Cdd:COG1222 380 VTMED 384
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
236-470 2.62e-96

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 305.99  E-value: 2.62e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  236 EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLA 315
Cdd:PRK03992 127 NVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFI 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  316 GESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR--EKTNGEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPA 392
Cdd:PRK03992 207 GEGARLVRELFELAREKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAEMDGFDPRGNVKIIAATNRIDILDPA 286
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361  393 LRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 470
Cdd:PRK03992 287 ILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEAGMFAIRDDRTEVTMED 364
PRK03992 PRK03992
proteasome-activating nucleotidase; Provisional
504-756 2.04e-94

proteasome-activating nucleotidase; Provisional


Pssm-ID: 179699 [Multi-domain]  Cd Length: 389  Bit Score: 300.98  E-value: 2.04e-94
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  504 VVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:PRK03992 122 VIESPNVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSEL 201
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  584 LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSA--GDAggAADRVLNQLLTEMDGMNAKKTVFIIGATNR 661
Cdd:PRK03992 202 VQKFIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGtsGDR--EVQRTLMQLLAEMDGFDPRGNVKIIAATNR 279
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  662 PDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIREN--- 738
Cdd:PRK03992 280 IDILDPAILRPGRFDRIIEVPLPDEEGRLEILKIHTRKMNLADDVDLEELAELTEGASGADLKAICTEAGMFAIRDDrte 359
                        250       260
                 ....*....|....*....|....*...
gi 11265361  739 ---------IEKDI-ENERRRSQNPEAM 756
Cdd:PRK03992 360 vtmedflkaIEKVMgKEEKDSMEEPGVM 387
RPT1 COG1222
ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein ...
497-738 1.42e-92

ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224143 [Multi-domain]  Cd Length: 406  Bit Score: 296.87  E-value: 1.42e-92
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 497 PSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFI 576
Cdd:COG1222 135 PRVSVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFI 214
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 577 SVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKTVFII 656
Cdd:COG1222 215 RVVGSELVQKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVI 294
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 657 GATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIR 736
Cdd:COG1222 295 MATNRPDILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRKMNLADDVDLELLARLTEGFSGADLKAICTEAGMFAIR 374

                ..
gi 11265361 737 EN 738
Cdd:COG1222 375 ER 376
26Sp45 TIGR01242
26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an ...
229-470 1.72e-89

26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an internal


Pssm-ID: 130309 [Multi-domain]  Cd Length: 364  Bit Score: 287.47  E-value: 1.72e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   229 EDEERlDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGP 308
Cdd:TIGR01242 112 EVEER-PNVSYEDIGGLEEQIREIREAVELPLKHPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGS 190
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   309 EIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR--EKTNGEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNR 385
Cdd:TIGR01242 191 ELVRKYIGEGARLVREIFELAKEKAPSIIFIDEIDAIAAKRtdSGTSGDREvQRTLMQLLAELDGFDPRGNVKVIAATNR 270
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   386 PNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDV 465
Cdd:TIGR01242 271 PDILDPALLRPGRFDRIIEVPLPDFEGRLEILKIHTRKMKLAEDVDLEAIAKMTEGASGADLKAICTEAGMFAIREERDY 350

                  ....*
gi 11265361   466 IDLED 470
Cdd:TIGR01242 351 VTMDD 355
26Sp45 TIGR01242
26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an ...
493-737 2.28e-85

26S proteasome subunit P45 family; Many proteins may score above the trusted cutoff because an internal


Pssm-ID: 130309 [Multi-domain]  Cd Length: 364  Bit Score: 276.29  E-value: 2.28e-85
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   493 GNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 572
Cdd:TIGR01242 102 TSKDPLVKGMEVEERPNVSYEDIGGLEEQIREIREAVELPLKHPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHETN 181
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   573 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKT 652
Cdd:TIGR01242 182 ATFIRVVGSELVRKYIGEGARLVREIFELAKEKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAELDGFDPRGN 261
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   653 VFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACK 732
Cdd:TIGR01242 262 VKVIAATNRPDILDPALLRPGRFDRIIEVPLPDFEGRLEILKIHTRKMKLAEDVDLEAIAKMTEGASGADLKAICTEAGM 341

                  ....*
gi 11265361   733 YAIRE 737
Cdd:TIGR01242 342 FAIRE 346
SpoVK COG0464
AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle ...
212-475 2.49e-85

AAA+-type ATPase, SpoVK/Ycf46/Vps4 family [Cell wall/membrane/envelope biogenesis, Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms];


Pssm-ID: 223540 [Multi-domain]  Cd Length: 494  Bit Score: 280.56  E-value: 2.49e-85
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 212 VVAPDTEIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIA 291
Cdd:COG0464 214 VTEDDFEEALKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLYGPPGTGKTLLA 293
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 292 RAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGL 371
Cdd:COG0464 294 KAVALESRSRFISVKGSELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDGSGRRVVGQLLTELDGI 373
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 372 KSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMK--LAEDVDLERISKDTHGYVGADLAA 449
Cdd:COG0464 374 EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKppLAEDVDLEELAEITEGYSGADIAA 453
                       250       260
                ....*....|....*....|....*.
gi 11265361 450 LCTEAALQCIREKMDVIDLEDDSIDA 475
Cdd:COG0464 454 LVREAALEALREARRREVTLDDFLDA 479
FtsH_fam TIGR01241
ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct ...
237-470 3.98e-75

ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273520 [Multi-domain]  Cd Length: 495  Bit Score: 253.36  E-value: 3.98e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   237 VGYDDVGGVRKQMAQIRELVELpLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAG 316
Cdd:TIGR01241  52 VTFKDVAGIDEAKEELMEIVDF-LKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVG 130
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   317 ESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREK----TNGEVERRIvSQLLTLMDGLKSRAHVIVMGATNRPNSIDPA 392
Cdd:TIGR01241 131 VGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAglggGNDEREQTL-NQLLVEMDGFGTNTGVIVIAATNRPDVLDPA 209
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361   393 LRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 470
Cdd:TIGR01241 210 LLRPGRFDRQVVVDLPDIKGREEILKVHAKNKKLAPDVDLKAVARRTPGFSGADLANLLNEAALLAARKNKTEITMND 287
FtsH_fam TIGR01241
ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct ...
506-749 1.09e-71

ATP-dependent metalloprotease FtsH; HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273520 [Multi-domain]  Cd Length: 495  Bit Score: 244.12  E-value: 1.09e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   506 EVPNVSWEDIGGLENVKRELQETVQYpVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT 585
Cdd:TIGR01241  48 EKPKVTFKDVAGIDEAKEELMEIVDF-LKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVE 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   586 MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDII 665
Cdd:TIGR01241 127 MFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFGTNTGVIVIAATNRPDVL 206
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   666 DSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIREN----IEK 741
Cdd:TIGR01241 207 DPALLRPGRFDRQVVVDLPDIKGREEILKVHAKNKKLAPDVDLKAVARRTPGFSGADLANLLNEAALLAARKNkteiTMN 286

                  ....*...
gi 11265361   742 DIENERRR 749
Cdd:TIGR01241 287 DIEEAIDR 294
PTZ00361 PTZ00361
26 proteosome regulatory subunit 4-like protein; Provisional
239-470 1.26e-71

26 proteosome regulatory subunit 4-like protein; Provisional


Pssm-ID: 185575 [Multi-domain]  Cd Length: 438  Bit Score: 241.98  E-value: 1.26e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  239 YDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGES 318
Cdd:PTZ00361 182 YADIGGLEQQIQEIKEAVELPLTHPELYDDIGIKPPKGVILYGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDG 261
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  319 ESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTN--GEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRR 395
Cdd:PTZ00361 262 PKLVRELFRVAEENAPSIVFIDEIDAIGTKRYDATsgGEKEiQRTMLELLNQLDGFDSRGDVKVIMATNRIESLDPALIR 341
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 11265361  396 FGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 470
Cdd:PTZ00361 342 PGRIDRKIEFPNPDEKTKRRIFEIHTSKMTLAEDVDLEEFIMAKDELSGADIKAICTEAGLLALRERRMKVTQAD 416
PTZ00454 PTZ00454
26S protease regulatory subunit 6B-like protein; Provisional
506-749 3.23e-70

26S protease regulatory subunit 6B-like protein; Provisional


Pssm-ID: 240423 [Multi-domain]  Cd Length: 398  Bit Score: 236.97  E-value: 3.23e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  506 EVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT 585
Cdd:PTZ00454 138 EKPDVTYSDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTATFIRVVGSEFVQ 217
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  586 MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDII 665
Cdd:PTZ00454 218 KYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTL 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  666 DSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIREN----IEK 741
Cdd:PTZ00454 298 DPALLRPGRLDRKIEFPLPDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPEKISAADIAAICQEAGMQAVRKNryviLPK 377

                 ....*...
gi 11265361  742 DIENERRR 749
Cdd:PTZ00454 378 DFEKGYKT 385
ftsH CHL00176
cell division protein; Validated
510-746 2.89e-69

cell division protein; Validated


Pssm-ID: 214386 [Multi-domain]  Cd Length: 638  Bit Score: 241.11  E-value: 2.89e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  510 VSWEDIGGLENVKRELQETVQYpVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFG 589
Cdd:CHL00176 180 ITFRDIAGIEEAKEEFEEVVSF-LKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEMFVG 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  590 ESEANVREIFDKARQSAPCVLFFDELDSIATQRGnsAGDAGGAADR--VLNQLLTEMDGMNAKKTVFIIGATNRPDIIDS 667
Cdd:CHL00176 259 VGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRG--AGIGGGNDEReqTLNQLLTEMDGFKGNKGVIVIAATNRVDILDA 336
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 11265361  668 ALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIRENIEKDIENE 746
Cdd:CHL00176 337 ALLRPGRFDRQITVSLPDREGRLDILKVHARNKKLSPDVSLELIARRTPGFSGADLANLLNEAAILTARRKKATITMKE 415
PTZ00454 PTZ00454
26S protease regulatory subunit 6B-like protein; Provisional
231-470 8.74e-66

26S protease regulatory subunit 6B-like protein; Provisional


Pssm-ID: 240423 [Multi-domain]  Cd Length: 398  Bit Score: 225.03  E-value: 8.74e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  231 EERLDeVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEI 310
Cdd:PTZ00454 137 SEKPD-VTYSDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTATFIRVVGSEF 215
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  311 MSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR--EKTNGEVE-RRIVSQLLTLMDGLKSRAHVIVMGATNRPN 387
Cdd:PTZ00454 216 VQKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRfdAQTGADREvQRILLELLNQMDGFDQTTNVKVIMATNRAD 295
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  388 SIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVID 467
Cdd:PTZ00454 296 TLDPALLRPGRLDRKIEFPLPDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPEKISAADIAAICQEAGMQAVRKNRYVIL 375

                 ...
gi 11265361  468 LED 470
Cdd:PTZ00454 376 PKD 378
HflB COG0465
ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];
237-470 3.94e-64

ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223541 [Multi-domain]  Cd Length: 596  Bit Score: 226.05  E-value: 3.94e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 237 VGYDDVGGVRKQMAQIRELVElPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGP---EIMSK 313
Cdd:COG0465 147 VTFADVAGVDEAKEELSELVD-FLKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSdfvEMFVG 225
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 314 LaGESESnlRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNG--EVERRIV-SQLLTLMDGLKSRAHVIVMGATNRPNSID 390
Cdd:COG0465 226 V-GASRV--RDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGggNDEREQTlNQLLVEMDGFGGNEGVIVIAATNRPDVLD 302
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 391 PALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 470
Cdd:COG0465 303 PALLRPGRFDRQILVELPDIKGREQILKVHAKNKPLAEDVDLKKIARGTPGFSGADLANLLNEAALLAARRNKKEITMRD 382
ftsH CHL00176
cell division protein; Validated
237-474 3.07e-63

cell division protein; Validated


Pssm-ID: 214386 [Multi-domain]  Cd Length: 638  Bit Score: 224.54  E-value: 3.07e-63
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  237 VGYDDVGGVRKQMAQIRELVELpLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAG 316
Cdd:CHL00176 180 ITFRDIAGIEEAKEEFEEVVSF-LKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEMFVG 258
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  317 ESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREK----TNGEVERrIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPA 392
Cdd:CHL00176 259 VGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAgiggGNDEREQ-TLNQLLTEMDGFKGNKGVIVIAATNRVDILDAA 337
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  393 LRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLE--D 470
Cdd:CHL00176 338 LLRPGRFDRQITVSLPDREGRLDILKVHARNKKLSPDVSLELIARRTPGFSGADLANLLNEAAILTARRKKATITMKeiD 417

                 ....
gi 11265361  471 DSID 474
Cdd:CHL00176 418 TAID 421
hflB PRK10733
ATP-dependent metalloprotease; Reviewed
491-788 1.20e-61

ATP-dependent metalloprotease; Reviewed


Pssm-ID: 182683 [Multi-domain]  Cd Length: 644  Bit Score: 220.29  E-value: 1.20e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  491 ALGNSNPSALRETVVEVpnvSWEDIGGLENVKRELQETVQYpVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANE 570
Cdd:PRK10733 133 SFGKSKARMLTEDQIKT---TFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGE 208
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  571 CQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGnsAGDAGGAADR--VLNQLLTEMDGMN 648
Cdd:PRK10733 209 AKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRG--AGLGGGHDEReqTLNQMLVEMDGFE 286
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  649 AKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQ 728
Cdd:PRK10733 287 GNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVN 366
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 11265361  729 RACKYAIREN--IEKDIENERRRSQNPEAME-EDMVDDEVSEIRAAHFEESMKYARRSVSDAD 788
Cdd:PRK10733 367 EAALFAARGNkrVVSMVEFEKAKDKIMMGAErRSMVMTEAQKESTAYHEAGHAIIGRLVPEHD 429
HflB COG0465
ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];
508-738 4.31e-60

ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223541 [Multi-domain]  Cd Length: 596  Bit Score: 214.49  E-value: 4.31e-60
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 508 PNVSWEDIGGLENVKRELQETVQYpVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMW 587
Cdd:COG0465 145 VKVTFADVAGVDEAKEELSELVDF-LKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMF 223
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 588 FGESEANVREIFDKARQSAPCVLFFDELDSIATQRGnsAGDAGGAADR--VLNQLLTEMDGMNAKKTVFIIGATNRPDII 665
Cdd:COG0465 224 VGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRG--AGLGGGNDEReqTLNQLLVEMDGFGGNEGVIVIAATNRPDVL 301
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 11265361 666 DSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIREN 738
Cdd:COG0465 302 DPALLRPGRFDRQILVELPDIKGREQILKVHAKNKPLAEDVDLKKIARGTPGFSGADLANLLNEAALLAARRN 374
PTZ00361 PTZ00361
26 proteosome regulatory subunit 4-like protein; Provisional
504-737 9.07e-60

26 proteosome regulatory subunit 4-like protein; Provisional


Pssm-ID: 185575 [Multi-domain]  Cd Length: 438  Bit Score: 209.63  E-value: 9.07e-60
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  504 VVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:PTZ00361 174 VDKAPLESYADIGGLEQQIQEIKEAVELPLTHPELYDDIGIKPPKGVILYGPPGTGKTLLAKAVANETSATFLRVVGSEL 253
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  584 LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSagDAGGAAD--RVLNQLLTEMDGMNAKKTVFIIGATNR 661
Cdd:PTZ00361 254 IQKYLGDGPKLVRELFRVAEENAPSIVFIDEIDAIGTKRYDA--TSGGEKEiqRTMLELLNQLDGFDSRGDVKVIMATNR 331
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 11265361  662 PDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIRE 737
Cdd:PTZ00361 332 IESLDPALIRPGRIDRKIEFPNPDEKTKRRIFEIHTSKMTLAEDVDLEEFIMAKDELSGADIKAICTEAGLLALRE 407
pup_AAA TIGR03689
proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some ...
506-741 4.02e-57

proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity. [Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 200312 [Multi-domain]  Cd Length: 512  Bit Score: 204.17  E-value: 4.02e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   506 EVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANE-CQ---------ANF 575
Cdd:TIGR03689 175 EVPDVTYADIGGLGSQIEQIRDAVELPFLHPELYREYGLKPPKGVLLYGPPGCGKTLIAKAVANSlAArigaegggkSYF 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   576 ISVKGPELLTMWFGESEANVREIFDKARQSA----PCVLFFDELDSIATQRGnsAGDAGGAADRVLNQLLTEMDGMNAKK 651
Cdd:TIGR03689 255 LNIKGPELLNKYVGETERQIRLIFQRAREKAsegrPVIVFFDEMDSLFRTRG--SGVSSDVETTVVPQLLAEIDGVESLD 332
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   652 TVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKS-PVAKD---------VDVTAL------AKYT 715
Cdd:TIGR03689 333 NVIVIGASNREDMIDPAILRPGRLDVKIRIERPDAEAAADIFAKYLTDDlPLPEDlaahdgdreATAAALiqrvvdALYA 412
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 11265361   716 QG-----------------------FSGADITEICQRACKYAIRENIEK 741
Cdd:TIGR03689 413 RSeanryvevtyangstevlyfadfVSGAMLANIVDRAKKRAIKDHITG 461
pup_AAA TIGR03689
proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some ...
224-450 4.48e-57

proteasome ATPase; In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity. [Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 200312 [Multi-domain]  Cd Length: 512  Bit Score: 204.17  E-value: 4.48e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   224 EPVKREDEERL-----DEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANET 298
Cdd:TIGR03689 161 EAIPRTEVEDLvleevPDVTYADIGGLGSQIEQIRDAVELPFLHPELYREYGLKPPKGVLLYGPPGCGKTLIAKAVANSL 240
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   299 G----------AFFFCINGPEIMSKLAGESESNLRKAFEEAEKNA----PSIIFIDEIDSIApkREKTNG---EVERRIV 361
Cdd:TIGR03689 241 AarigaegggkSYFLNIKGPELLNKYVGETERQIRLIFQRAREKAsegrPVIVFFDEMDSLF--RTRGSGvssDVETTVV 318
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   362 SQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHtknmkLAEDVDLERISKDTHG 441
Cdd:TIGR03689 319 PQLLAEIDGVESLDNVIVIGASNREDMIDPAILRPGRLDVKIRIERPDAEAAADIFAKY-----LTDDLPLPEDLAAHDG 393

                  ....*....
gi 11265361   442 YVGADLAAL 450
Cdd:TIGR03689 394 DREATAAAL 402
hflB PRK10733
ATP-dependent metalloprotease; Reviewed
239-468 6.87e-56

ATP-dependent metalloprotease; Reviewed


Pssm-ID: 182683 [Multi-domain]  Cd Length: 644  Bit Score: 203.73  E-value: 6.87e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  239 YDDVGGVRKQMAQIRELVELpLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGES 318
Cdd:PRK10733 151 FADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVG 229
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  319 ESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKT--NGEVER-RIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRR 395
Cdd:PRK10733 230 ASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGlgGGHDEReQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLR 309
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 11265361  396 FGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDL 468
Cdd:PRK10733 310 PGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSM 382
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
277-407 1.51e-54

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 333757 [Multi-domain]  Cd Length: 130  Bit Score: 184.33  E-value: 1.51e-54
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEV 356
Cdd:pfam00004   1 LLLYGPPGTGKTTLAKAVAKELGAPFLEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSRGSGGDSE 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 11265361   357 ERRIVSQLLTLMDGLKSRAH-VIVMGATNRPNSIDPALRRfgRFDREIDIGV 407
Cdd:pfam00004  81 SRRVVNQLLTELDGFTSSLSkVIVIAATNRPDKLDPALLR--RFDRRIEFPL 130
COG1223 COG1223
Predicted ATPase, AAA+ superfamily [General function prediction only];
506-751 1.58e-54

Predicted ATPase, AAA+ superfamily [General function prediction only];


Pssm-ID: 224144 [Multi-domain]  Cd Length: 368  Bit Score: 192.72  E-value: 1.58e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 506 EVPNVSWEDIGGLENVKRELQETVQYpVEHPEKFEKFGmspSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT 585
Cdd:COG1223 114 IISDITLDDVIGQEEAKRKCRLIMEY-LENPERFGDWA---PKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIG 189
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 586 MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSagDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDII 665
Cdd:COG1223 190 EHVGDGARRIHELYERARKAAPCIVFIDELDAIALDRRYQ--ELRGDVSEIVNALLTELDGIKENEGVVTIAATNRPELL 267
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 666 DSALlrPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITE-ICQRACKYAIRE------- 737
Cdd:COG1223 268 DPAI--RSRFEEEIEFKLPNDEERLEILEYYAKKFPLPVDADLRYLAAKTKGMSGRDIKEkVLKTALHRAIAEdrekver 345
                       250
                ....*....|....*
gi 11265361 738 -NIEKDIENERRRSQ 751
Cdd:COG1223 346 eDIEKALKKERKRRA 360
COG1223 COG1223
Predicted ATPase, AAA+ superfamily [General function prediction only];
167-470 2.27e-54

Predicted ATPase, AAA+ superfamily [General function prediction only];


Pssm-ID: 224144 [Multi-domain]  Cd Length: 368  Bit Score: 192.33  E-value: 2.27e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 167 LFDAYLKPYFlEAYRpVRKGDLFLVRGGMRSVEFKVIETDPAEyCVVAPDTEIFCEGEPVKREDEERLDeVGYDDVGGVR 246
Cdd:COG1223  52 VFNIYARDQW-LGEV-VREGDYLFDTRMFPDYAFKVIRVVPSG-GGIITSTTIFVLETPREEDREIISD-ITLDDVIGQE 127
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 247 KQMAQIRELVELpLRHPQLFksiGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAF 326
Cdd:COG1223 128 EAKRKCRLIMEY-LENPERF---GDWAPKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIGEHVGDGARRIHELY 203
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 327 EEAEKNAPSIIFIDEIDSIAPKRE--KTNGEVErRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRrfGRFDREID 404
Cdd:COG1223 204 ERARKAAPCIVFIDELDAIALDRRyqELRGDVS-EIVNALLTELDGIKENEGVVTIAATNRPELLDPAIR--SRFEEEIE 280
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 11265361 405 IGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAAL-QCIREKMDVIDLED 470
Cdd:COG1223 281 FKLPNDEERLEILEYYAKKFPLPVDADLRYLAAKTKGMSGRDIKEKVLKTALhRAIAEDREKVERED 347
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
550-683 1.03e-53

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 333757 [Multi-domain]  Cd Length: 130  Bit Score: 182.02  E-value: 1.03e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   550 VLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGnsaGDA 629
Cdd:pfam00004   1 LLLYGPPGTGKTTLAKAVAKELGAPFLEISGSELLSKYVGESEKRLRELFEAAKKLAPCVIFIDEIDALAGSRG---SGG 77
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 11265361   630 GGAADRVLNQLLTEMDGM-NAKKTVFIIGATNRPDIIDSALLRpgRLDQLIYIPL 683
Cdd:pfam00004  78 DSESRRVVNQLLTELDGFtSSLSKVIVIAATNRPDKLDPALLR--RFDRRIEFPL 130
ycf46 CHL00195
Ycf46; Provisional
508-740 5.94e-33

Ycf46; Provisional


Pssm-ID: 177094 [Multi-domain]  Cd Length: 489  Bit Score: 133.61  E-value: 5.94e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  508 PNVSWEDIGGLENVKRELQetvQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMW 587
Cdd:CHL00195 223 VNEKISDIGGLDNLKDWLK---KRSTSFSKQASNYGLPTPRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGI 299
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  588 FGESEANVREIFDKARQSAPCVLFFDELDSiATQRGNSAGDaGGAADRVLNQLLTEMDgmNAKKTVFIIGATNRPDIIDS 667
Cdd:CHL00195 300 VGESESRMRQMIRIAEALSPCILWIDEIDK-AFSNSESKGD-SGTTNRVLATFITWLS--EKKSPVFVVATANNIDLLPL 375
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 11265361  668 ALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKS-PVA-KDVDVTALAKYTQGFSGADITEICQRACKYAIRENIE 740
Cdd:CHL00195 376 EILRKGRFDEIFFLDLPSLEEREKIFKIHLQKFrPKSwKKYDIKKLSKLSNKFSGAEIEQSIIEAMYIAFYEKRE 450
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
243-406 1.43e-31

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 120.33  E-value: 1.43e-31
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 243 GGVRKQMAQIRELVELPlrhpqlfksigvkPPKGILLYGPPGSGKTLIARAVANET---GAFFFCINGPEIMSKLAGESE 319
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 320 ---SNLRKAFEEAEKNAPSIIFIDEIDSIAPkrektngEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRF 396
Cdd:cd00009  68 fghFLVRLLFELAEKAKPGVLFIDEIDSLSR-------GAQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDRALY 140
                       170
                ....*....|
gi 11265361 397 GRFDREIDIG 406
Cdd:cd00009 141 DRLDIRIVIP 150
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
516-683 2.30e-30

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707 [Multi-domain]  Cd Length: 151  Bit Score: 116.86  E-value: 2.30e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 516 GGLENVKRELQETVQYPvehpekfekfgmsPSKGVLFYGPPGCGKTLLAKAIANEC---QANFISVKGPELLTMWFGESE 592
Cdd:cd00009   1 VGQEEAIEALREALELP-------------PPKNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASDLLEGLVVAEL 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 593 AN---VREIFDKARQSAPCVLFFDELDSIatqrgnsagdAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSAL 669
Cdd:cd00009  68 FGhflVRLLFELAEKAKPGVLFIDEIDSL----------SRGAQNALLRVLETLNDLRIDRENVRVIGATNRPLLGDLDR 137
                       170
                ....*....|....
gi 11265361 670 LRPGRLDQLIYIPL 683
Cdd:cd00009 138 ALYDRLDIRIVIPL 151
CDC48_N pfam02359
Cell division protein 48 (CDC48), N-terminal domain; This domain has a double psi-beta barrel ...
62-143 1.79e-24

Cell division protein 48 (CDC48), N-terminal domain; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases pfam00004 is a substrate 185-residue recognition domain.


Pssm-ID: 334908  Cd Length: 84  Bit Score: 97.65  E-value: 1.79e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    62 RLVVDEAINDD--NSVVSLHPTTMEKLQLFRGDTILIKGKKRkdTVCIALADETCEEPK--IRMNKVVRSNLRVRLGDVI 137
Cdd:pfam02359   1 RLRVAEAPDRDvgRGIARLDPEDMEELGLFPGDIVEIKGKRK--TVAIVWSAYPEDEGPgiIRMDGVTRKNAGVSIGDTV 78

                  ....*.
gi 11265361   138 SVHQCP 143
Cdd:pfam02359  79 TVRKAE 84
CDC48_N smart01073
Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel ...
63-142 5.07e-21

Cell division protein 48 (CDC48) N-terminal domain; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain.


Pssm-ID: 215012 [Multi-domain]  Cd Length: 82  Bit Score: 87.66  E-value: 5.07e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361     63 LVVDEAINDD---NSVVSLHPTTMEKLQLFRGDTILIKGKKRkdTVCIALADETCEEPK-IRMNKVVRSNLRVRLGDVIS 138
Cdd:smart01073   1 LRVAEAPSDEdvgRGIARLSPEDMDELGLFPGDYVLITGKRR--TVAIVWPAYPEDPGGiIRIDGVQRKNAGVSIGDTVT 78

                   ....
gi 11265361    139 VHQC 142
Cdd:smart01073  79 VRKA 82
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
546-685 1.63e-20

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 88.58  E-value: 1.63e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    546 PSKGVLFYGPPGCGKTLLAKAIANECQANFISVK-----------------GPELLTMWFGESEANVREIFDKARQSAPC 608
Cdd:smart00382   1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVIyidgedileevldqlllIIVGGKKASGSGELRLRLALALARKLKPD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 11265361    609 VLFFDELDSIAtqrgnsagDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPgRLDQLIYIPLPD 685
Cdd:smart00382  81 VLILDEITSLL--------DAEQEALLLLLEELRLLLLLKSEKNLTVILTTNDEKDLGPALLRR-RFDRRIVLLLIL 148
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
273-409 2.56e-20

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 88.20  E-value: 2.56e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361    273 PPKGILLYGPPGSGKTLIARAVANE---TGAFFFCINGPEIMS--------------KLAGESESNLRKAFEEAEKNAPS 335
Cdd:smart00382   1 PGEVILIVGPPGSGKTTLARALARElgpPGGGVIYIDGEDILEevldqllliivggkKASGSGELRLRLALALARKLKPD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 11265361    336 IIFIDEIDSIAPKREKtngevERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFgRFDREIDIGVPD 409
Cdd:smart00382  81 VLILDEITSLLDAEQE-----ALLLLLEELRLLLLLKSEKNLTVILTTNDEKDLGPALLRR-RFDRRIVLLLIL 148
ycf46 CHL00195
Ycf46; Provisional
270-462 3.21e-17

Ycf46; Provisional


Pssm-ID: 177094 [Multi-domain]  Cd Length: 489  Bit Score: 85.46  E-value: 3.21e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  270 GVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEID-SIAPK 348
Cdd:CHL00195 255 GLPTPRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGIVGESESRMRQMIRIAEALSPCILWIDEIDkAFSNS 334
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  349 REKTNGEVERRIVSQLLTLMDGLKSRahVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNM--KL 426
Cdd:CHL00195 335 ESKGDSGTTNRVLATFITWLSEKKSP--VFVVATANNIDLLPLEILRKGRFDEIFFLDLPSLEEREKIFKIHLQKFrpKS 412
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 11265361  427 AEDVDLERISKDTHGYVGADLAALCTEAALQCIREK 462
Cdd:CHL00195 413 WKKYDIKKLSKLSNKFSGAEIEQSIIEAMYIAFYEK 448
CDC48_2 smart01072
Cell division protein 48 (CDC48) domain 2; This domain has a double psi-beta barrel fold and ...
168-228 3.14e-12

Cell division protein 48 (CDC48) domain 2; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain.


Pssm-ID: 215011  Cd Length: 64  Bit Score: 61.85  E-value: 3.14e-12
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 11265361    168 FDAYLKPYFLEayRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKR 228
Cdd:smart01072   6 FAEYVKRKLLG--RPVTKGDTIVVPFLGKALPFVVVSTEPSGPVIVTDDTEIEILEKPVEE 64
PRK13342 PRK13342
recombination factor protein RarA; Reviewed
277-342 5.29e-12

recombination factor protein RarA; Reviewed


Pssm-ID: 237355 [Multi-domain]  Cd Length: 413  Bit Score: 68.57  E-value: 5.29e-12
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  277 ILLYGPPGSGKTLIARAVANETGAFFFCINGpeIMSKLAgesesNLRKAFEEAEKNAPS----IIFIDEI 342
Cdd:PRK13342  39 MILWGPPGTGKTTLARIIAGATDAPFEALSA--VTSGVK-----DLREVIEEARQRRSAgrrtILFIDEI 101
CDC48_2 pfam02933
Cell division protein 48 (CDC48), domain 2; This domain has a double psi-beta barrel fold and ...
168-227 1.84e-10

Cell division protein 48 (CDC48), domain 2; This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C-terminus. The VAT-N domain found in AAA ATPases pfam00004 is a substrate 185-residue recognition domain.


Pssm-ID: 335159  Cd Length: 63  Bit Score: 56.78  E-value: 1.84e-10
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   168 FDAYLKPYFLEayRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVK 227
Cdd:pfam02933   5 ELAYVKRNLEG--RPVSKGDTIVVEFLGQPIDLVVVSTEPSGPVVVTETTEIEIGEKPVE 62
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
517-778 5.59e-10

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking]


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 62.55  E-value: 5.59e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   517 GLENVKRE---LQETVQYPVEHPEKfekfGMS---PSKGVLFYGPPGCGKTLLAKAIANE-C------QANFISVKGPEL 583
Cdd:TIGR03922 280 GLERVKRQvaaLKSSTAMALARAER----GLPvaqTSNHMLFAGPPGTGKTTIARVVAKIyCglgvlrKPLVREVSRADL 355
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   584 LTMWFGESEANVREIFDKARQSapcVLFFDELDSIaTQRGNSAGDAGGAAdrVLNQLLTEMDgmNAKKTVFIIGATNRPD 663
Cdd:TIGR03922 356 IGQYIGESEAKTNEIIDSALGG---VLFLDEAYTL-VETGYGQKDPFGLE--AIDTLLARME--NDRDRLVVIGAGYRKD 427
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   664 iIDSAL-----LRpGRLDQLIYIP--LPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQ--GFSGADITEICQRACKYA 734
Cdd:TIGR03922 428 -LDKFLevnegLR-SRFTRVIEFPsySPDELVEIARRMATERDSVLDDAAADALLEAATTlaQDTTPDANGDLRRGLDIA 505
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*....
gi 11265361   735 -----IRENIEKDiENERRRSQNPEAMEEDMVDDEVSEIRAAHFEESMK 778
Cdd:TIGR03922 506 gngrfVRNVVERA-EEERDFRLDHSDRLDAVTVDDLMEITADDVARAVA 553
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
229-435 1.70e-09

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc. [Protein fate, Protein and peptide secretion and trafficking]


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 61.01  E-value: 1.70e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   229 EDEERLDE-VGyddVGGVRKQMAQIRELVELPLRHPQLfksiGVKPP---KGILLYGPPGSGKTLIARAVANetgafFFC 304
Cdd:TIGR03922 270 EAEAELAEqIG---LERVKRQVAALKSSTAMALARAER----GLPVAqtsNHMLFAGPPGTGKTTIARVVAK-----IYC 337
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   305 ----INGPEIM----SKLAGESESNLRKAFEEA-EKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKSRA 375
Cdd:TIGR03922 338 glgvLRKPLVRevsrADLIGQYIGESEAKTNEIiDSALGGVLFLDEAYTLVETGYGQKDPFGLEAIDTLLARMENDRDRL 417
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 11265361   376 HVIVMG---ATNRPNSIDPALRRfgRFDREIDIG--VPDEIGRLEVlRIHTKNMKLAEDVDLERI 435
Cdd:TIGR03922 418 VVIGAGyrkDLDKFLEVNEGLRS--RFTRVIEFPsySPDELVEIAR-RMATERDSVLDDAAADAL 479
RarA COG2256
Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, ...
279-342 2.75e-09

Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, recombination and repair];


Pssm-ID: 225165 [Multi-domain]  Cd Length: 436  Bit Score: 59.94  E-value: 2.75e-09
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361 279 LYGPPGSGKTLIARAVANETGAFFFCINGpeIMSKLAgesesNLRKAFEEAEKNAPS----IIFIDEI 342
Cdd:COG2256  53 LWGPPGTGKTTLARLIAGTTNAAFEALSA--VTSGVK-----DLREIIEEARKNRLLgrrtILFLDEI 113
PRK13342 PRK13342
recombination factor protein RarA; Reviewed
550-614 4.15e-09

recombination factor protein RarA; Reviewed


Pssm-ID: 237355 [Multi-domain]  Cd Length: 413  Bit Score: 59.33  E-value: 4.15e-09
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 11265361  550 VLFYGPPGCGKTLLAKAIANECQANFI-------SVKgpelltmwfgeseaNVREIFDKARQSA----PCVLFFDE 614
Cdd:PRK13342  39 MILWGPPGTGKTTLARIIAGATDAPFEalsavtsGVK--------------DLREVIEEARQRRsagrRTILFIDE 100
PRK13341 PRK13341
recombination factor protein RarA/unknown domain fusion protein; Reviewed
278-342 7.08e-08

recombination factor protein RarA/unknown domain fusion protein; Reviewed


Pssm-ID: 237354 [Multi-domain]  Cd Length: 725  Bit Score: 55.83  E-value: 7.08e-08
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  278 LLYGPPGSGKTLIARAVANETGAFFFCINgpeimSKLAGESEsnLRKAFEEAEK-----NAPSIIFIDEI 342
Cdd:PRK13341  56 ILYGPPGVGKTTLARIIANHTRAHFSSLN-----AVLAGVKD--LRAEVDRAKErlerhGKRTILFIDEV 118
AAA_5 pfam07728
AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not ...
276-399 3.06e-07

AAA domain (dynein-related subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 336785 [Multi-domain]  Cd Length: 135  Bit Score: 49.97  E-value: 3.06e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   276 GILLYGPPGSGKTLIARAVANET-GAFFFCINGP------------EIMSKLAGESESNLRKAFEEAEknapsIIFIDEI 342
Cdd:pfam07728   1 GVLLVGPPGTGKSTLARRLAAALcNRPVFYVQLTrdtteedlfgrrDIANGTTEWVDGPLVRAAREGE-----IAVLDEI 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 11265361   343 DSIAPK-REKTNGEVERRIvsqlLTLMDG----LKSRAHVIVMGATNRP----NSIDPALRRfgRF 399
Cdd:pfam07728  76 NRANPDvLNSLLSLLDERR----LLLPDGgelvKAPPNGFRLIATMNPLprglNELSPALRS--RF 135
MoxR COG0714
MoxR-like ATPase [General function prediction only];
277-440 4.07e-07

MoxR-like ATPase [General function prediction only];


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 52.82  E-value: 4.07e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 277 ILLYGPPGSGKTLIARAVANETGAFFFCING-PEIM-SKLAGESESNLRKAFEEAEK--------NAPSIIFIDEIDSIA 346
Cdd:COG0714  46 VLLEGPPGVGKTLLARALARALGLPFVRIQCtPDLLpSDLLGTYAYAALLLEPGEFRfvpgplfaAVRVILLLDEINRAP 125
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 347 PKREKT-NGEVERRIVSqlLTLMDGLKSRAHVIVMGATNRPNSID-----PALRRfgRFDREIDIGVPDEIG-RLEVLRI 419
Cdd:COG0714 126 PEVQNAlLEALEERQVT--VPGLTTIRLPPPFIVIATQNPGEYEGtyplpEALLD--RFLLRIYVDYPDSEEeERIILAR 201
                       170       180
                ....*....|....*....|.
gi 11265361 420 HTKNMKLAEDVDLERISKDTH 440
Cdd:COG0714 202 VGGVDELDLESLVKPVLSDEE 222
RarA COG2256
Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, ...
552-717 4.22e-07

Replication-associated recombination protein RarA (DNA-dependent ATPase) [Replication, recombination and repair];


Pssm-ID: 225165 [Multi-domain]  Cd Length: 436  Bit Score: 53.01  E-value: 4.22e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 552 FYGPPGCGKTLLAKAIANECQANFIsvkgpELLTMWFGESEanVREIFDKARQSAPC----VLFFDEldsiaTQRGNSAG 627
Cdd:COG2256  53 LWGPPGTGKTTLARLIAGTTNAAFE-----ALSAVTSGVKD--LREIIEEARKNRLLgrrtILFLDE-----IHRFNKAQ 120
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 628 -DAggaadrvlnqLLTEMDgmnaKKTVFIIGAT--NRPDIIDSALLRPGRLDQLiyIPLPDEDSRLNIFKACL------- 697
Cdd:COG2256 121 qDA----------LLPHVE----NGTIILIGATteNPSFELNPALLSRARVFEL--KPLSSEDIKKLLKRALLdeerglg 184
                       170       180
                ....*....|....*....|
gi 11265361 698 RKSPVAKDVDVTALAKYTQG 717
Cdd:COG2256 185 GQIIVLDEEALDYLVRLSNG 204
ruvB PRK00080
Holliday junction DNA helicase RuvB; Reviewed
277-397 6.66e-07

Holliday junction DNA helicase RuvB; Reviewed


Pssm-ID: 234619 [Multi-domain]  Cd Length: 328  Bit Score: 52.06  E-value: 6.66e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSK--LAGeSESNLrkafeeaEKNapSIIFIDEIDSIAPKREktng 354
Cdd:PRK00080  54 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPALEKPgdLAA-ILTNL-------EEG--DVLFIDEIHRLSPVVE---- 119
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361  355 EV------ERRIvsqllTLMDGLKSRAHVIVM--------GATNRPNSIDPALR-RFG 397
Cdd:PRK00080 120 EIlypameDFRL-----DIMIGKGPAARSIRLdlppftliGATTRAGLLTSPLRdRFG 172
RuvB COG2255
Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, ...
277-397 1.06e-06

Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, recombination and repair];


Pssm-ID: 225164 [Multi-domain]  Cd Length: 332  Bit Score: 51.40  E-value: 1.06e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEImsklagESESNLRKAFEEAEKNapSIIFIDEIDSIAPKrektngeV 356
Cdd:COG2255  55 VLLFGPPGLGKTTLAHIIANELGVNLKITSGPAL------EKPGDLAAILTNLEEG--DVLFIDEIHRLSPA-------V 119
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....
gi 11265361 357 ERRIVSQL----LTLMDGLKSRAHVIVM--------GATNRPNSIDPALR-RFG 397
Cdd:COG2255 120 EEVLYPAMedfrLDIIIGKGPAARSIRLdlppftliGATTRAGMLTNPLRdRFG 173
ruvB TIGR00635
Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions ...
277-414 1.10e-06

Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129721 [Multi-domain]  Cd Length: 305  Bit Score: 51.15  E-value: 1.10e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEIM--SKLAGeSESNLRKAfeeaeknapSIIFIDEIDSIAPKREktng 354
Cdd:TIGR00635  33 LLLYGPPGLGKTTLAHIIANEMGVNLKITSGPALEkpGDLAA-ILTNLEEG---------DVLFIDEIHRLSPAVE---- 98
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 11265361   355 EVerrivsqLLTLMD----------GLKSR------AHVIVMGATNRPNSIDPALR-RFGrFDREIDIGVPDEIGRL 414
Cdd:TIGR00635  99 EL-------LYPAMEdfrldivigkGPSARsvrldlPPFTLVGATTRAGMLTSPLRdRFG-IILRLEFYTVEELAEI 167
ruvB PRK00080
Holliday junction DNA helicase RuvB; Reviewed
550-583 1.15e-06

Holliday junction DNA helicase RuvB; Reviewed


Pssm-ID: 234619 [Multi-domain]  Cd Length: 328  Bit Score: 51.28  E-value: 1.15e-06
                         10        20        30
                 ....*....|....*....|....*....|....
gi 11265361  550 VLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:PRK00080  54 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAL 87
44 PHA02544
clamp loader, small subunit; Provisional
258-416 1.97e-06

clamp loader, small subunit; Provisional


Pssm-ID: 222866 [Multi-domain]  Cd Length: 316  Bit Score: 50.37  E-value: 1.97e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  258 LPLRHPQLFKSIgVKP---PKGILLYGPPGSGKTLIARAVANETGAFFFCINGpeimSKLAGESESNLRKAFEEA--EKN 332
Cdd:PHA02544  25 LPAADKETFKSI-VKKgriPNMLLHSPSPGTGKTTVAKALCNEVGAEVLFVNG----SDCRIDFVRNRLTRFASTvsLTG 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  333 APSIIFIDEIDsiapkREKTnGEVERrivsQLLTLMDGLKSRAHVIVmgATNRPNSIDPALRrfGRFdREIDIGVPDEIG 412
Cdd:PHA02544 100 GGKVIIIDEFD-----RLGL-ADAQR----HLRSFMEAYSKNCSFII--TANNKNGIIEPLR--SRC-RVIDFGVPTKEE 164

                 ....
gi 11265361  413 RLEV 416
Cdd:PHA02544 165 QIEM 168
ClpA COG0542
ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein ...
278-616 2.20e-06

ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223616 [Multi-domain]  Cd Length: 786  Bit Score: 51.13  E-value: 2.20e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 278 LLYGPPGSGKTLI----ARAVANEtgafffciNGPEIMS----------------KLAGESESNLRKAFEEAEKNAPSII 337
Cdd:COG0542 195 VLVGEPGVGKTAIveglAQRIVNG--------DVPESLKdkriysldlgslvagaKYRGEFEERLKAVLKEVEKSKNVIL 266
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 338 FIDEIDSI--APKREKTNGEverriVSQLL--TLmdglkSRAHVIVMGATN----RPN-SIDPAL-RRFgrfdREIDIGV 407
Cdd:COG0542 267 FIDEIHTIvgAGATEGGAMD-----AANLLkpAL-----ARGELRCIGATTldeyRKYiEKDAALeRRF----QKVLVDE 332
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 408 PDEIGRLEVLR-IHTK-----NMKLAEDVdLERISKDTHGYV--------------------------GADLAALCTEAA 455
Cdd:COG0542 333 PSVEDTIAILRgLKERyeahhGVRITDEA-LVAAVTLSDRYIpdrflpdkaidlldeagarvrleidkPEELDELERELA 411
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 456 lQCIREKMDVIDLEDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEV-------P--NVSWEDIGGLENVKRELQ 526
Cdd:COG0542 412 -QLEIEKEALEREQDEKEKKLIDEIIKLKEGRIPELEKELEAEVDEDDIAEVvarwtgiPvaKLLEDEKEKLLNLERRLK 490
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 527 ETVqypVEHPE---------KFEKFGMS-PSKGV---LFYGPPGCGKTLLAKAIANEcqanfisVKGPELLTMWFGESEA 593
Cdd:COG0542 491 KRV---IGQDEaveavsdaiRRARAGLGdPNRPIgsfLFLGPTGVGKTELAKALAEA-------LFGDEQALIRIDMSEY 560
                       410       420       430       440
                ....*....|....*....|....*....|....*....|...
gi 11265361 594 NVREIFDKA--------------------RQSAPCVLFFDELD 616
Cdd:COG0542 561 MEKHSVSRLigappgyvgyeeggqlteavRRKPYSVILLDEIE 603
RuvB_N pfam05496
Holliday junction DNA helicase ruvB N-terminus; The RuvB protein makes up part of the RuvABC ...
550-583 3.63e-06

Holliday junction DNA helicase ruvB N-terminus; The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.


Pssm-ID: 310239 [Multi-domain]  Cd Length: 234  Bit Score: 48.64  E-value: 3.63e-06
                          10        20        30
                  ....*....|....*....|....*....|....
gi 11265361   550 VLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:pfam05496  53 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAI 86
DnaA COG0593
Chromosomal replication initiation ATPase DnaA [Replication, recombination and repair];
277-438 3.68e-06

Chromosomal replication initiation ATPase DnaA [Replication, recombination and repair];


Pssm-ID: 223666 [Multi-domain]  Cd Length: 408  Bit Score: 49.98  E-value: 3.68e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 277 ILLYGPPGSGKTLIARAVANETGAF-----FFCINGPEIMSKLAGESESNLRKAFEeaEKNAPSIIFIDEIDSIAPKREK 351
Cdd:COG0593 116 LFIYGGVGLGKTHLLQAIGNEALANgpnarVVYLTSEDFTNDFVKALRDNEMEKFK--EKYSLDLLLIDDIQFLAGKERT 193
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 352 tngEVErrivsqLLTLMDGLKSRAHVIVMGATNRP---NSIDPALRRfgRFDR--EIDIGVPDEIGRLEVLRIH--TKNM 424
Cdd:COG0593 194 ---QEE------FFHTFNALLENGKQIVLTSDRPPkelNGLEDRLRS--RLEWglVVEIEPPDDETRLAILRKKaeDRGI 262
                       170
                ....*....|....*..
gi 11265361 425 KLAEDVD---LERISKD 438
Cdd:COG0593 263 EIPDEVLeflAKRLDRN 279
RuvB COG2255
Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, ...
550-583 6.68e-06

Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit [Replication, recombination and repair];


Pssm-ID: 225164 [Multi-domain]  Cd Length: 332  Bit Score: 48.71  E-value: 6.68e-06
                        10        20        30
                ....*....|....*....|....*....|....
gi 11265361 550 VLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:COG2255  55 VLLFGPPGLGKTTLAHIIANELGVNLKITSGPAL 88
AAA_2 pfam07724
AAA domain (Cdc48 subfamily); This Pfam entry includes some of the AAA proteins not detected ...
274-347 6.77e-06

AAA domain (Cdc48 subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 336783 [Multi-domain]  Cd Length: 168  Bit Score: 46.81  E-value: 6.77e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   274 PKG-ILLYGPPGSGKTLIARAVANETGAF---FFCINGPEIM-----SKLAGESESNLRKA-----FEEAEKNAPSIIFI 339
Cdd:pfam07724   2 PIGsFLFLGPTGVGKTELAKALAELLFGDeraLIRIDMSEYMeehsvSRLIGAPPGYVGYEeggqlTEAVRRKPYSIVLI 81

                  ....*...
gi 11265361   340 DEIDSIAP 347
Cdd:pfam07724  82 DEIEKAHP 89
ruvB TIGR00635
Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions ...
511-583 9.17e-06

Holliday junction DNA helicase, RuvB subunit; All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129721 [Multi-domain]  Cd Length: 305  Bit Score: 48.07  E-value: 9.17e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 11265361   511 SWEDIGGLENVKRELQETVQYPVEHPEKFEKfgmspskgVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583
Cdd:TIGR00635   2 LLAEFIGQEKVKEQLQLFIEAAKMRQEALDH--------LLLYGPPGLGKTTLAHIIANEMGVNLKITSGPAL 66
DnaC COG1484
DNA replication protein DnaC [Replication, recombination and repair];
234-342 1.12e-05

DNA replication protein DnaC [Replication, recombination and repair];


Pssm-ID: 224401 [Multi-domain]  Cd Length: 254  Bit Score: 47.40  E-value: 1.12e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 234 LDEVGYDDVGGV-RKQMAQIRELVELPLRHpqlfksigvkppKGILLYGPPGSGKTLIARAVANE---TGAFFFCINGPE 309
Cdd:COG1484  76 FEEFDFEFQPGIdKKALEDLASLVEFFERG------------ENLVLLGPPGVGKTHLAIAIGNEllkAGISVLFITAPD 143
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 11265361 310 IMSKLA-----GESESNLRKAFeeaeKNAPSIIfIDEI 342
Cdd:COG1484 144 LLSKLKaafdeGRLEEKLLREL----KKVDLLI-IDDI 176
PRK04195 PRK04195
replication factor C large subunit; Provisional
513-570 1.73e-05

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 47.99  E-value: 1.73e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 11265361  513 EDIGGLENVKRELQETVqypvehpEKFEKfgMSPSKGVLFYGPPGCGKTLLAKAIANE 570
Cdd:PRK04195  14 SDVVGNEKAKEQLREWI-------ESWLK--GKPKKALLLYGPPGVGKTSLAHALAND 62
PRK04195 PRK04195
replication factor C large subunit; Provisional
272-348 2.27e-05

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 47.61  E-value: 2.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  272 KPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGP-----EIMSKLAGESeSNLRKAFEEAEKnapsIIFIDEIDSIA 346
Cdd:PRK04195  37 KPKKALLLYGPPGVGKTSLAHALANDYGWEVIELNASdqrtaDVIERVAGEA-ATSGSLFGARRK----LILLDEVDGIH 111

                 ..
gi 11265361  347 PK 348
Cdd:PRK04195 112 GN 113
PRK13341 PRK13341
recombination factor protein RarA/unknown domain fusion protein; Reviewed
551-687 2.98e-05

recombination factor protein RarA/unknown domain fusion protein; Reviewed


Pssm-ID: 237354 [Multi-domain]  Cd Length: 725  Bit Score: 47.36  E-value: 2.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361  551 LFYGPPGCGKTLLAKAIANECQANFISvkgpeLLTMWFGESEanVREIFDKARQSAP-----CVLFFDELdsiatQRGNS 625
Cdd:PRK13341  56 ILYGPPGVGKTTLARIIANHTRAHFSS-----LNAVLAGVKD--LRAEVDRAKERLErhgkrTILFIDEV-----HRFNK 123
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 11265361  626 A-GDAggaadrvlnqLLTEMDgmnaKKTVFIIGAT--NRPDIIDSALLRPGRLDQLiyIPLPDED 687
Cdd:PRK13341 124 AqQDA----------LLPWVE----NGTITLIGATteNPYFEVNKALVSRSRLFRL--KSLSDED 172
TIP49 COG1224
DNA helicase TIP49, TBP-interacting protein [Transcription];
275-367 3.14e-05

DNA helicase TIP49, TBP-interacting protein [Transcription];


Pssm-ID: 224145 [Multi-domain]  Cd Length: 450  Bit Score: 46.96  E-value: 3.14e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 275 KGILLYGPPGSGKTLIARAVANETGA--FFFCINGPEIMSKLAGESES---NLRKAF-----EEAEknapsiIFIDEIDS 344
Cdd:COG1224  66 RGILIVGPPGTGKTALAMGIARELGEdvPFVAISGSEIYSLEVKKTEAltqALRRAIgvrikETRE------VYEGEVVE 139
                        90       100
                ....*....|....*....|....
gi 11265361 345 IAPKREKTN-GEVERRIVSQLLTL 367
Cdd:COG1224 140 LEIRRARNPlNPYGKVPSGAIITL 163
MoxR COG0714
MoxR-like ATPase [General function prediction only];
550-725 4.45e-05

MoxR-like ATPase [General function prediction only];


Pssm-ID: 223786 [Multi-domain]  Cd Length: 329  Bit Score: 46.27  E-value: 4.45e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 550 VLFYGPPGCGKTLLAKAIANECQANFISVKG-PELL-TMWFGESEANVREIFDKAR--------QSAPCVLFFDELDSia 619
Cdd:COG0714  46 VLLEGPPGVGKTLLARALARALGLPFVRIQCtPDLLpSDLLGTYAYAALLLEPGEFrfvpgplfAAVRVILLLDEINR-- 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 620 tqrgnsagdaggAADRVLNQLLTEMD----------GMNAKKTVFIIGATNRPDIIDS-----ALLRpgRLDQLIYIPLP 684
Cdd:COG0714 124 ------------APPEVQNALLEALEerqvtvpgltTIRLPPPFIVIATQNPGEYEGTyplpeALLD--RFLLRIYVDYP 189
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 11265361 685 DED-------SRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITE 725
Cdd:COG0714 190 DSEeeeriilARVGGVDELDLESLVKPVLSDEELLRLQKEVKKVPVSD 237
clpX TIGR00382
endopeptidase Clp ATP-binding regulatory subunit (clpX); A member of the ATP-dependent ...
277-370 4.61e-05

endopeptidase Clp ATP-binding regulatory subunit (clpX); A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]


Pssm-ID: 273047 [Multi-domain]  Cd Length: 413  Bit Score: 46.30  E-value: 4.61e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANE-------------TGAFFFCINGPEIMSKLAGESESNLrkafEEAEKnapSIIFIDEID 343
Cdd:TIGR00382 119 ILLIGPTGSGKTLLAQTLARIlnvpfaiadattlTEAGYVGEDVENILLKLLQAADYDV----EKAQK---GIIYIDEID 191
                          90       100       110
                  ....*....|....*....|....*....|..
gi 11265361   344 SIAPKREktNGEVERRI----VSQ-LLTLMDG 370
Cdd:TIGR00382 192 KISRKSE--NPSITRDVsgegVQQaLLKIIEG 221
DnaC COG1484
DNA replication protein DnaC [Replication, recombination and repair];
548-615 6.17e-05

DNA replication protein DnaC [Replication, recombination and repair];


Pssm-ID: 224401 [Multi-domain]  Cd Length: 254  Bit Score: 45.47  E-value: 6.17e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 11265361 548 KGVLFYGPPGCGKTLLAKAIANECQANFISV---KGPELLTMW-FGESEANVREIFDKARQSAPcVLFFDEL 615
Cdd:COG1484 106 ENLVLLGPPGVGKTHLAIAIGNELLKAGISVlfiTAPDLLSKLkAAFDEGRLEEKLLRELKKVD-LLIIDDI 176
TIP49 pfam06068
TIP49 C-terminus; This family consists of the C-terminal region of several eukaryotic and ...
234-325 8.26e-05

TIP49 C-terminus; This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities.TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases.


Pssm-ID: 283678 [Multi-domain]  Cd Length: 395  Bit Score: 45.76  E-value: 8.26e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   234 LDEVG---YDDVGGV-----RKQMAQIRELVELplrhpqlfKSIGvkpPKGILLYGPPGSGKTLIARAVANETGAF--FF 303
Cdd:pfam06068  13 LDEDGearYVSGGLVgqekaREAAGVIVELIKE--------GKIA---GRAVLLAGPPGTGKTALAIAISKELGEDtpFC 81
                          90       100
                  ....*....|....*....|....*
gi 11265361   304 CINGPEIMSKLAGESES---NLRKA 325
Cdd:pfam06068  82 PISGSEVYSLEMKKTEAltqAFRKA 106
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
246-380 1.71e-04

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 338625 [Multi-domain]  Cd Length: 167  Bit Score: 42.90  E-value: 1.71e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   246 RKQMAQIRELVElPLRHPQlfksigvkpPKGILLYGPPGSGKTLIARAV---ANETGAFFFCINGPEIMSKLA---GESE 319
Cdd:pfam13191   5 EEELEQLLDLLD-RVRSGR---------PPLVLLTGEAGTGKTSLLRELlraLEEDGVYVLRGKCDENLSPSAlleALTR 74
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 11265361   320 SNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLMDGLKSRAHVIVM 380
Cdd:pfam13191  75 EGLLRQLLDELESSLLEAWRDRILEELAPVPELAGDLAERLLDLLLRLLDLLARDERPLVL 135
RuvB_N pfam05496
Holliday junction DNA helicase ruvB N-terminus; The RuvB protein makes up part of the RuvABC ...
277-347 2.04e-04

Holliday junction DNA helicase ruvB N-terminus; The RuvB protein makes up part of the RuvABC revolvasome which catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalyzed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.


Pssm-ID: 310239 [Multi-domain]  Cd Length: 234  Bit Score: 43.63  E-value: 2.04e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 11265361   277 ILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSK--LAGeSESNLRKAfeeaeknapSIIFIDEIDSIAP 347
Cdd:pfam05496  53 VLLYGPPGLGKTTLANIIANEMGVNIRITSGPAIERAgdLAA-ILTNLEPG---------DVLFIDEIHRLNR 115
AAA_2 pfam07724
AAA domain (Cdc48 subfamily); This Pfam entry includes some of the AAA proteins not detected ...
550-619 2.45e-04

AAA domain (Cdc48 subfamily); This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.


Pssm-ID: 336783 [Multi-domain]  Cd Length: 168  Bit Score: 42.18  E-value: 2.45e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   550 VLFYGPPGCGKTLLAKAIANE---CQANFISVKGPELL-----TMWFGESEANVR-----EIFDKARQSAPCVLFFDELD 616
Cdd:pfam07724   6 FLFLGPTGVGKTELAKALAELlfgDERALIRIDMSEYMeehsvSRLIGAPPGYVGyeeggQLTEAVRRKPYSIVLIDEIE 85

                  ...
gi 11265361   617 SIA 619
Cdd:pfam07724  86 KAH 88
PRK08116 PRK08116
hypothetical protein; Validated
547-579 3.50e-04

hypothetical protein; Validated


Pssm-ID: 236153 [Multi-domain]  Cd Length: 268  Bit Score: 43.09  E-value: 3.50e-04
                         10        20        30
                 ....*....|....*....|....*....|...
gi 11265361  547 SKGVLFYGPPGCGKTLLAKAIANECQANFISVK 579
Cdd:PRK08116 114 NVGLLLWGSVGTGKTYLAACIANELIEKGVPVI 146
Vps4_C pfam09336
Vps4 C terminal oligomerization domain; This domain is found at the C terminal of ATPase ...
753-797 3.83e-04

Vps4 C terminal oligomerization domain; This domain is found at the C terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerization.


Pssm-ID: 337367  Cd Length: 61  Bit Score: 39.01  E-value: 3.83e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 11265361   753 PEAMEEDMVD---DEVSE--IRAAHFEESMKYARRSVSDADIRKYQAFAQ 797
Cdd:pfam09336   9 PGAIEMTWMDipsDKLLEppVTMKDFLKALKNSRPTVSKEDLEKHEEFTK 58
PRK08116 PRK08116
hypothetical protein; Validated
276-342 9.61e-04

hypothetical protein; Validated


Pssm-ID: 236153 [Multi-domain]  Cd Length: 268  Bit Score: 41.54  E-value: 9.61e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 11265361  276 GILLYGPPGSGKTLIARAVAN---ETGAFFFCINGPEIMSKLAgeSESNLRKAFEEAE-----KNAPSIIfIDEI 342
Cdd:PRK08116 116 GLLLWGSVGTGKTYLAACIANeliEKGVPVIFVNFPQLLNRIK--STYKSSGKEDENEiirslVNADLLI-LDDL 187
spore_V_K TIGR02881
stage V sporulation protein K; Members of this protein family are the stage V sporulation ...
517-623 1.02e-03

stage V sporulation protein K; Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination]


Pssm-ID: 163057 [Multi-domain]  Cd Length: 261  Bit Score: 41.63  E-value: 1.02e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   517 GLENVKRELQETVQYPVEHpEKFEKFGMSPSKGVL---FYGPPGCGKTLLAKAIAN-------ECQANFISVKGPELLTM 586
Cdd:TIGR02881  10 GLDEVKALIKEIYAWIQIN-EKRKEEGLKTSKQVLhmiFKGNPGTGKTTVARILGKlfkemnvLSKGHLIEVERADLVGE 88
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 11265361   587 WFGESEANVREIFDKARQSapcVLFFDELDSIAtqRG 623
Cdd:TIGR02881  89 YIGHTAQKTREVIKKALGG---VLFIDEAYSLA--RG 120
PRK06835 PRK06835
DNA replication protein DnaC; Validated
519-570 1.22e-03

DNA replication protein DnaC; Validated


Pssm-ID: 235871 [Multi-domain]  Cd Length: 329  Bit Score: 41.81  E-value: 1.22e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 11265361  519 ENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANE 570
Cdd:PRK06835 155 DDEPLSPRKNMEKILEKCKNFIENFDKNNENLLFYGNTGTGKTFLSNCIAKE 206
RNA_helicase pfam00910
RNA helicase; This family includes RNA helicases thought to be involved in duplex unwinding ...
550-570 1.24e-03

RNA helicase; This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses.


Pssm-ID: 279280  Cd Length: 105  Bit Score: 38.76  E-value: 1.24e-03
                          10        20
                  ....*....|....*....|.
gi 11265361   550 VLFYGPPGCGKTLLAKAIANE 570
Cdd:pfam00910   1 IWLYGPPGCGKSTLAKYLARA 21
hslU PRK05201
ATP-dependent protease ATP-binding subunit HslU; Provisional
323-358 1.99e-03

ATP-dependent protease ATP-binding subunit HslU; Provisional


Pssm-ID: 235364 [Multi-domain]  Cd Length: 443  Bit Score: 41.22  E-value: 1.99e-03
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 11265361  323 RKAFEEAEKNApsIIFIDEIDSIAPKREKTNGEVER 358
Cdd:PRK05201 241 QEAIERVEQNG--IVFIDEIDKIAARGGSSGPDVSR 274
CDC6 COG1474
Cdc6-related protein, AAA superfamily ATPase [Replication, recombination and repair];
274-470 2.29e-03

Cdc6-related protein, AAA superfamily ATPase [Replication, recombination and repair];


Pssm-ID: 224391 [Multi-domain]  Cd Length: 366  Bit Score: 40.80  E-value: 2.29e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 274 PKGILLYGPPGSGKTLIARAVANE----TGAFFFC-ING----------PEIMSKLAGESESNLR-----KAFEEA--EK 331
Cdd:COG1474  42 PSNIIIYGPTGTGKTATVKFVMEEleesSANVEVVyINClelrtpyqvlSKILNKLGKVPLTGDSsleilKRLYDNlsKK 121
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 332 NAPSIIFIDEIDSIAPKREKtngeverrIVSQLLTLMDGLKSRAHVIVMGAT-NRPNSIDPALR-RFGRF--------DR 401
Cdd:COG1474 122 GKTVIVILDEVDALVDKDGE--------VLYSLLRAPGENKVKVSIIAVSNDdKFLDYLDPRVKsSLGPSeivfppytAE 193
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 11265361 402 EIDIGVPDeigRLEVLRIhtkNMKLAEDVdLERISKDThGYVGADL---AALCTEAALQCIREKMDVIDLED 470
Cdd:COG1474 194 ELYDILRE---RVEEGFS---AGVIDDDV-LKLIAALV-AAESGDArkaIDILRRAGEIAEREGSRKVSEDH 257
DUF2075 pfam09848
Uncharacterized conserved protein (DUF2075); This domain, found in various prokaryotic ...
548-657 2.62e-03

Uncharacterized conserved protein (DUF2075); This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.


Pssm-ID: 313132 [Multi-domain]  Cd Length: 352  Bit Score: 40.71  E-value: 2.62e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   548 KGVLF-YGPPGCGKTLLAKAIANECQ-------ANFISVKGPELLTMW--FGESEANVREIFDKAR-----QSAP----- 607
Cdd:pfam09848   1 KAVFFvTGGPGTGKTVVGLNLFAELQdsdlggtAVYLSGNHPLVLVLYeaLAGDLPKRKKSSLFQRptsfiNNLHkthph 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 11265361   608 -CVLFFDEldsiaTQRGNSAGDAGGaADRVLNQLLTEMDgmNAKKTVFIIG 657
Cdd:pfam09848  81 eDVVIFDE-----AHRLWTKSDPYN-NFSGPNQLKEIMK--RARVIVFLID 123
AAA_22 pfam13401
AAA domain;
277-348 2.63e-03

AAA domain;


Pssm-ID: 315964 [Multi-domain]  Cd Length: 128  Bit Score: 38.46  E-value: 2.63e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANE--TGAFFFCINGP------EIMSKLAGE---------SESNLRKAFEEA--EKNAPSII 337
Cdd:pfam13401   7 LVLTGESGTGKTTLLRRLLEQlpARDSVVLVELPsgtsprDLLRALLRAlglplegrlSKEELLAALQQLllRLARAVVL 86
                          90
                  ....*....|.
gi 11265361   338 FIDEIDSIAPK 348
Cdd:pfam13401  87 IIDEAQHLSLE 97
ClpA COG0542
ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein ...
554-695 2.99e-03

ATP-dependent Clp protease ATP-binding subunit ClpA [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 223616 [Multi-domain]  Cd Length: 786  Bit Score: 41.11  E-value: 2.99e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 554 GPPGCGKT----LLAKAIANEcqanfisvKGPELL----------------TMWFGESEANVREIFDKARQSAPCVLFFD 613
Cdd:COG0542 198 GEPGVGKTaiveGLAQRIVNG--------DVPESLkdkriysldlgslvagAKYRGEFEERLKAVLKEVEKSKNVILFID 269
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 614 ELDSIaTQRGNSAGDAGGAADrVLNQLLtemdgmnAKKTVFIIGATN----RPDI-IDSALLRpgRLdQLIYIPLPDEDS 688
Cdd:COG0542 270 EIHTI-VGAGATEGGAMDAAN-LLKPAL-------ARGELRCIGATTldeyRKYIeKDAALER--RF-QKVLVDEPSVED 337

                ....*..
gi 11265361 689 RLNIFKA 695
Cdd:COG0542 338 TIAILRG 344
COG1373 COG1373
Predicted ATPase, AAA+ superfamily [General function prediction only];
246-345 3.00e-03

Predicted ATPase, AAA+ superfamily [General function prediction only];


Pssm-ID: 224292 [Multi-domain]  Cd Length: 398  Bit Score: 40.46  E-value: 3.00e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361 246 RKQMAQIRELVELPLRH-PQLFKSIGVKPPKgILLYGPPGSGKT----LIARAVANETGAFFFCingpEIMSKlaGESES 320
Cdd:COG1373   9 IEEDSDIKKWEIERRKLlPRLIKKLDLRPFI-ILILGPRQVGKTtllkLLIKGLLEEIIYINFD----DLRLD--RIELL 81
                        90       100
                ....*....|....*....|....*
gi 11265361 321 NLRKAFEEAEKNAPSIIFIDEIDSI 345
Cdd:COG1373  82 DLLRAYIELKEREKSYIFLDEIQNV 106
TIGR02928 TIGR02928
orc1/cdc6 family replication initiation protein; Members of this protein family are found ...
273-375 3.24e-03

orc1/cdc6 family replication initiation protein; Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other. [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 274354 [Multi-domain]  Cd Length: 365  Bit Score: 40.31  E-value: 3.24e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   273 PPKGILLYGPPGSGKTLIARAVANE-------TGAFFF-----C--INGP-EIMSKLA---GESESN-----------LR 323
Cdd:TIGR02928  39 RPSNVFIYGKTGTGKTAVTKYVMKEleeaaedRDVRVVtvyvnCqiLDTLyQVLVELAnqlRGSGEEvpttglstsevFR 118
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 11265361   324 KAFEEAEKNAPSIIFI-DEIDSIAPK---------REKTNGEVER-RI----VSQLLTLMDGLKSRA 375
Cdd:TIGR02928 119 RLYKELNERGDSLIIVlDEIDYLVGDdddllyqlsRARSNGDLDNaKVgvigISNDLKFRENLDPRV 185
TIP49 COG1224
DNA helicase TIP49, TBP-interacting protein [Transcription];
548-593 3.59e-03

DNA helicase TIP49, TBP-interacting protein [Transcription];


Pssm-ID: 224145 [Multi-domain]  Cd Length: 450  Bit Score: 40.41  E-value: 3.59e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*...
gi 11265361 548 KGVLFYGPPGCGKTLLAKAIANECQAN--FISVKGPELLTMWFGESEA 593
Cdd:COG1224  66 RGILIVGPPGTGKTALAMGIARELGEDvpFVAISGSEIYSLEVKKTEA 113
Mg_chelatase pfam01078
Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that ...
550-567 3.86e-03

Magnesium chelatase, subunit ChlI; Magnesium-chelatase is a three-component enzyme that catalyzes the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.


Pssm-ID: 307292  Cd Length: 207  Bit Score: 39.44  E-value: 3.86e-03
                          10
                  ....*....|....*...
gi 11265361   550 VLFYGPPGCGKTLLAKAI 567
Cdd:pfam01078  25 LLMIGPPGSGKTMLAKRL 42
hslU TIGR00390
ATP-dependent protease HslVU, ATPase subunit; This model represents the ATPase subunit of ...
309-530 4.14e-03

ATP-dependent protease HslVU, ATPase subunit; This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment) is Ser in other members of the seed alignment. [Protein fate, Protein folding and stabilization]


Pssm-ID: 273052 [Multi-domain]  Cd Length: 441  Bit Score: 40.18  E-value: 4.14e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   309 EIMSKLAgESESNLRKAFEEAEKNApsIIFIDEIDSIAPKREKTNGEVERRIVSQ-LLTLMDGLK--------SRAHV-- 377
Cdd:TIGR00390 226 EEAAKLV-DPEEIKQEAIDAVEQSG--IIFIDEIDKIAKKGESSGADVSREGVQRdLLPIVEGSTvntkygmvKTDHIlf 302
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   378 IVMGATN--RPNSIDPALRrfGRFDreidigvpdeigrlevLRIHTKNmkLAEDvDLERISKDTHGYVGADLAALCTEAA 455
Cdd:TIGR00390 303 IAAGAFQlaKPSDLIPELQ--GRFP----------------IRVELQA--LTTD-DFERILTEPKNSLIKQYKALMKTEG 361
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   456 LQcirekmdvIDLEDDSID--AEILNSMAVSNEH-----FHTALgnsnPSALRETVVEVPNVSWEDIG-GLENVKRELQE 527
Cdd:TIGR00390 362 VN--------IEFSDEAIKriAELAYNVNEKTENigarrLHTVL----ERLLEDISFEAPDLSGQNITiDADYVSKKLGA 429

                  ...
gi 11265361   528 TVQ 530
Cdd:TIGR00390 430 LVA 432
Parvo_NS1 pfam01057
Parvovirus non-structural protein NS1; This family also contains the NS2 protein. Parvoviruses ...
550-569 4.35e-03

Parvovirus non-structural protein NS1; This family also contains the NS2 protein. Parvoviruses encode two non-structural proteins, NS1 and NS2. The mRNA for NS2 contains the coding sequence for the first 87 amino acids of NS1, then by an alternative splicing mechanism mRNA from a different reading frame, encoding the last 78 amino acids, makes up the full length of the NS2 mRNA. NS1, is the major non-structural protein. It is essential for DNA replication. It is an 83-kDa nuclear phosphoprotein. It has DNA helicase and ATPase activity.


Pssm-ID: 307276  Cd Length: 271  Bit Score: 39.60  E-value: 4.35e-03
                          10        20
                  ....*....|....*....|
gi 11265361   550 VLFYGPPGCGKTLLAKAIAN 569
Cdd:pfam01057 116 VWFYGPASTGKTNLAQAIAH 135
HslU COG1220
ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein ...
308-370 4.83e-03

ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 224141 [Multi-domain]  Cd Length: 444  Bit Score: 39.94  E-value: 4.83e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 11265361 308 PEIMSKLAgESESNLRKAFEEAEKNApsIIFIDEIDSIAPKREKTNGEVERRIVSQ-LLTLMDG 370
Cdd:COG1220 228 EEEADKLI-DQEEIKQEAIDAAEQNG--IVFIDEIDKIAKRGGSGGPDVSREGVQRdLLPLVEG 288
NACHT pfam05729
NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in ...
550-699 8.16e-03

NACHT domain; This NTPase domain is found in apoptosis proteins as well as those involved in MHC transcription activation. This family is closely related to pfam00931.


Pssm-ID: 310381  Cd Length: 166  Bit Score: 37.67  E-value: 8.16e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   550 VLFYGPPGCGKTLLAKAIANE----------------------CQANFISVKgpELLTMWFGESEANVREIFDKARQSAP 607
Cdd:pfam05729   3 VILQGEAGSGKTTLLQKIALLwaqgklpqgfdfvfflpcrelsRSGNALSLA--DLLFSQWPEPAAPVSEVFAVILELPD 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   608 CVLF-FDELDSIATQRGNSAGDAGgaADRVLNQLLTEmdgmNAKKTVFIIgATNRPDiidsALLR-PGRLDQLIYIPLP- 684
Cdd:pfam05729  81 RLLLiLDGLDELVSDLGQLDGPCP--VRTLLSSLLRK----KLLPGASLL-LTSRPD----ALRDlRRGLEEPRYLEVRg 149
                         170
                  ....*....|....*.
gi 11265361   685 -DEDSRlnifKACLRK 699
Cdd:pfam05729 150 fSEDDR----KQYVRK 161
cyt_kin_arch TIGR02173
cytidylate kinase, putative; Proteins in this family are believed to be cytidylate kinase. ...
277-361 8.43e-03

cytidylate kinase, putative; Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.


Pssm-ID: 274012 [Multi-domain]  Cd Length: 171  Bit Score: 37.79  E-value: 8.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11265361   277 ILLYGPPGSGKTLIARAVANETGAFFfcINGPEIMSKLAGESESNLRKAFEEAEKNapsiifiDEIDSIAPKREKTNGEV 356
Cdd:TIGR02173   3 ITISGPPGSGKTTVAKILAEKLSLKL--ISAGDIFRELAAKMGLDLIEFLNYAEEN-------PEIDKKIDRRIHEIALK 73

                  ....*
gi 11265361   357 ERRIV 361
Cdd:TIGR02173  74 EKNVV 78
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH