NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|363548513|sp|Q07085|]
View 

RecName: Full=Esterase CM06B1

Protein Classification

Esterase_lipase domain-containing protein (domain architecture ID 10085203)

Esterase_lipase domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
16-521 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


:

Pssm-ID: 238191  Cd Length: 493  Bit Score: 559.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  16 ALKASCGPVRGNIYKHddviVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTGGFEQIaGPRTPTPEE 95
Cdd:cd00312    1 LVVTPNGKVRGVDEGG----VYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGG-LWNAKLPGS 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  96 AGCLTLNVFTPRNASseFKNGRPVMVYIHGGGYELCASSDFCAYSLSGTLPlkDVVVVSINYRLGVFGFLTTGDNVCPGN 175
Cdd:cd00312   76 EDCLYLNVYTPKNTK--PGNSLPVMVWIHGGGFMFGSGSLYPGDGLAREGD--NVIVVSINYRLGVLGFLSTGDIELPGN 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 176 FGLWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAIRasENQAKIFRE 255
Cdd:cd00312  152 YGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWAIQ--ENARGRAKR 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 256 FAEFHGFSGRDSSALFKWYQEQSPETLSNVKGYKK--SISGFLTFIPNLDGDFFPKPLDELRKE--APKKQMMTGVTEYE 331
Cdd:cd00312  230 LARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLlfSYSPFLPFGPVVDGDFIPDDPEELIKEgkFAKVPLIIGVTKDE 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 332 GLMLASMNPAF------SPADVGLTLMPQGIYGKDvvsnpDEIQKIFYEKYVEGVDksDELAMRKKLCEALGDEFFNVG- 404
Cdd:cd00312  310 GGYFAAMLLNFdakliiETNDRWLELLPYLLFYAD-----DALADKVLEKYPGDVD--DSVESRKNLSDMLTDLLFKCPa 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 405 VIQAAKNAAKHGNEVYFYTFEYVNPDSFGMWDgmmPFKAAVHCTELRYLLGEGVYSKFEPtEEDRKVMETTTTLFSNFAK 484
Cdd:cd00312  383 RYFLAQHRKAGGSPVYAYVFDHRSSLSVGRWP---PWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAK 458
                        490       500       510
                 ....*....|....*....|....*....|....*..
gi 363548513 485 YGNPNGKGaTAEIWEKYSLNrPERHYRISYPKCEMRD 521
Cdd:cd00312  459 TGNPNTEG-NLVVWPAYTSE-SEKYLDINIEGTEIKQ 493
 
Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
16-521 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 559.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  16 ALKASCGPVRGNIYKHddviVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTGGFEQIaGPRTPTPEE 95
Cdd:cd00312    1 LVVTPNGKVRGVDEGG----VYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGG-LWNAKLPGS 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  96 AGCLTLNVFTPRNASseFKNGRPVMVYIHGGGYELCASSDFCAYSLSGTLPlkDVVVVSINYRLGVFGFLTTGDNVCPGN 175
Cdd:cd00312   76 EDCLYLNVYTPKNTK--PGNSLPVMVWIHGGGFMFGSGSLYPGDGLAREGD--NVIVVSINYRLGVLGFLSTGDIELPGN 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 176 FGLWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAIRasENQAKIFRE 255
Cdd:cd00312  152 YGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWAIQ--ENARGRAKR 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 256 FAEFHGFSGRDSSALFKWYQEQSPETLSNVKGYKK--SISGFLTFIPNLDGDFFPKPLDELRKE--APKKQMMTGVTEYE 331
Cdd:cd00312  230 LARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLlfSYSPFLPFGPVVDGDFIPDDPEELIKEgkFAKVPLIIGVTKDE 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 332 GLMLASMNPAF------SPADVGLTLMPQGIYGKDvvsnpDEIQKIFYEKYVEGVDksDELAMRKKLCEALGDEFFNVG- 404
Cdd:cd00312  310 GGYFAAMLLNFdakliiETNDRWLELLPYLLFYAD-----DALADKVLEKYPGDVD--DSVESRKNLSDMLTDLLFKCPa 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 405 VIQAAKNAAKHGNEVYFYTFEYVNPDSFGMWDgmmPFKAAVHCTELRYLLGEGVYSKFEPtEEDRKVMETTTTLFSNFAK 484
Cdd:cd00312  383 RYFLAQHRKAGGSPVYAYVFDHRSSLSVGRWP---PWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAK 458
                        490       500       510
                 ....*....|....*....|....*....|....*..
gi 363548513 485 YGNPNGKGaTAEIWEKYSLNrPERHYRISYPKCEMRD 521
Cdd:cd00312  459 TGNPNTEG-NLVVWPAYTSE-SEKYLDINIEGTEIKQ 493
COesterase pfam00135
Carboxylesterase family;
17-530 2.88e-179

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 514.55  E-value: 2.88e-179
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513   17 LKASCGPVRGNIYKHDD-VIVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTGGFEQIAGPRTPTPEE 95
Cdd:pfam00135   3 VTTSLGRVRGRRVKVTGgDPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLEGSED 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513   96 agCLTLNVFTPRNAsseFKNGRPVMVYIHGGGYELCASSDFCAYSLSGTLplkDVVVVSINYRLGVFGFLTTGDNVCPGN 175
Cdd:pfam00135  83 --CLYLNVYTPKNL---NKNKLPVMVWIHGGGFMTGSASLYDGSYLAARG---NVIVVTINYRLGILGFLSTGDDEAPGN 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  176 FGLWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAIRasENQAKIFRE 255
Cdd:pfam00135 155 YGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQ--SNPRKRAKK 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  256 FAEFHGFSGRDSSALFKWYQEQSPETL-SNVKGYKKSISGFLTFIPNLDGDFFPK-PLDELRKEA-PKKQMMTGVTEYEG 332
Cdd:pfam00135 233 LAKLVGCPTSDSAELVECLRSKPAEELlDAQLKVVYGSVPFVPFGPVVDGDFLPDhPEELLKSGNfPKVPLLIGVNKDEG 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  333 L-MLASMNPAFSPA-----DVGLTLMPQGIYGKdVVSNPDEIQKIFYEKYVEGVDKSDELAMRKKLCEALGDEFFNVGVI 406
Cdd:pfam00135 313 LyFLAYILDNPDIVkklleDFSNSLLVDLLYLY-LEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCPVL 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  407 QAAKNAAKHGNEVYFYTFEYVNpdSFGMWDgmmPFKAAVHCTELRYLLGEGVYSKFEPTEEDRKVMETTTTLFSNFAKYG 486
Cdd:pfam00135 392 RFARLHASRGSPVYLYSFDYRG--SSLRWP---PWMGVDHGDELPYVFGTPFLGPFLFTKEDRKLSRKMMTYWTNFAKTG 466
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|....
gi 363548513  487 NPNGKGATAeiWEKYSLNrPERHYRISYPKCeMRDVYHEGRIQF 530
Cdd:pfam00135 467 NPNGEGLPK--WPPYTDE-DQQYLSIDLKPR-VKRGLKAEDCAF 506
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
22-512 3.72e-86

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 275.08  E-value: 3.72e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  22 GPVRGNiykhDDVIVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTggFEQIAGPRTPTPEEaGCLTL 101
Cdd:COG2272   10 GKVEGI----TVNGVHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQP--FNRMGSGEDFTGSE-DCLYL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 102 NVFTPRNAssefKNGRPVMVYIHGGGYELCASSDFcAYSLSGTLPLKDVVVVSINYRLGVFGFLT----TGDNVCPGNFG 177
Cdd:COG2272   83 NIWAPEVP----AEKLPVMVYIHGGGYIMGSGSEP-LYDGSALAARGDVVVVSVNYRLGALGFLDlsslDTEDAFASNLG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 178 LWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCdfaIRASENQAKIFREFA 257
Cdd:COG2272  158 LLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASR---VTSREEAREKAAAFA 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 258 EFHGFSGRDSSALFKwyqeQSPETLsnVKGY---KKSISGFLTFIPNLDGDFFPK-PLDELRKEAP-KKQMMTGVTEYEG 332
Cdd:COG2272  235 RALGIPEATLDKLRA----LSAEDL--VKARlplIGRTFGAVPYGPVLGDSLLPRdPLEAIAQGRShGVPLMIGTNHDEG 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 333 LMLASMNPAFSPADVGLTLMpqgiygKDVVSNPDEIQKI--FYEKYVEGVDKSDELamrkklceaLGDEFFNVGVIQAAk 410
Cdd:COG2272  309 SLFINFNPDSPPGLRDKVAA------RLPGKELINAERVpaAYPGVSAAAAAFGAL---------VTDRLFKAPSIRLA- 372
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 411 NAAKHGNEVYFYTFEYVNPDSFGmwdgmmPFKAAVHCTELRYLLGE--GVYSKFEPTEEDRKVMETTTTLFSNFAKYGNP 488
Cdd:COG2272  373 QAQSAGAPTWLYRFDYAPDTVRV------PGFGAPHATELSLVFGNlvALGSAAQTARATAKLSRQMQDAWANFARTGSP 446
                        490       500
                 ....*....|....*....|....
gi 363548513 489 NGKGATAeiWEKYslNRPERHYRI 512
Cdd:COG2272  447 NGLGLPD--WPAY--TEERRATLV 466
 
Name Accession Description Interval E-value
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
16-521 0e+00

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 559.64  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  16 ALKASCGPVRGNIYKHddviVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTGGFEQIaGPRTPTPEE 95
Cdd:cd00312    1 LVVTPNGKVRGVDEGG----VYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGG-LWNAKLPGS 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  96 AGCLTLNVFTPRNASseFKNGRPVMVYIHGGGYELCASSDFCAYSLSGTLPlkDVVVVSINYRLGVFGFLTTGDNVCPGN 175
Cdd:cd00312   76 EDCLYLNVYTPKNTK--PGNSLPVMVWIHGGGFMFGSGSLYPGDGLAREGD--NVIVVSINYRLGVLGFLSTGDIELPGN 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 176 FGLWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAIRasENQAKIFRE 255
Cdd:cd00312  152 YGLKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWAIQ--ENARGRAKR 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 256 FAEFHGFSGRDSSALFKWYQEQSPETLSNVKGYKK--SISGFLTFIPNLDGDFFPKPLDELRKE--APKKQMMTGVTEYE 331
Cdd:cd00312  230 LARLLGCNDTSSAELLDCLRSKSAEELLDATRKLLlfSYSPFLPFGPVVDGDFIPDDPEELIKEgkFAKVPLIIGVTKDE 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 332 GLMLASMNPAF------SPADVGLTLMPQGIYGKDvvsnpDEIQKIFYEKYVEGVDksDELAMRKKLCEALGDEFFNVG- 404
Cdd:cd00312  310 GGYFAAMLLNFdakliiETNDRWLELLPYLLFYAD-----DALADKVLEKYPGDVD--DSVESRKNLSDMLTDLLFKCPa 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 405 VIQAAKNAAKHGNEVYFYTFEYVNPDSFGMWDgmmPFKAAVHCTELRYLLGEGVYSKFEPtEEDRKVMETTTTLFSNFAK 484
Cdd:cd00312  383 RYFLAQHRKAGGSPVYAYVFDHRSSLSVGRWP---PWLGTVHGDEIFFVFGNPLLKEGLR-EEEEKLSRTMMKYWANFAK 458
                        490       500       510
                 ....*....|....*....|....*....|....*..
gi 363548513 485 YGNPNGKGaTAEIWEKYSLNrPERHYRISYPKCEMRD 521
Cdd:cd00312  459 TGNPNTEG-NLVVWPAYTSE-SEKYLDINIEGTEIKQ 493
COesterase pfam00135
Carboxylesterase family;
17-530 2.88e-179

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 514.55  E-value: 2.88e-179
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513   17 LKASCGPVRGNIYKHDD-VIVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTGGFEQIAGPRTPTPEE 95
Cdd:pfam00135   3 VTTSLGRVRGRRVKVTGgDPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLEGSED 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513   96 agCLTLNVFTPRNAsseFKNGRPVMVYIHGGGYELCASSDFCAYSLSGTLplkDVVVVSINYRLGVFGFLTTGDNVCPGN 175
Cdd:pfam00135  83 --CLYLNVYTPKNL---NKNKLPVMVWIHGGGFMTGSASLYDGSYLAARG---NVIVVTINYRLGILGFLSTGDDEAPGN 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  176 FGLWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAIRasENQAKIFRE 255
Cdd:pfam00135 155 YGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQ--SNPRKRAKK 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  256 FAEFHGFSGRDSSALFKWYQEQSPETL-SNVKGYKKSISGFLTFIPNLDGDFFPK-PLDELRKEA-PKKQMMTGVTEYEG 332
Cdd:pfam00135 233 LAKLVGCPTSDSAELVECLRSKPAEELlDAQLKVVYGSVPFVPFGPVVDGDFLPDhPEELLKSGNfPKVPLLIGVNKDEG 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  333 L-MLASMNPAFSPA-----DVGLTLMPQGIYGKdVVSNPDEIQKIFYEKYVEGVDKSDELAMRKKLCEALGDEFFNVGVI 406
Cdd:pfam00135 313 LyFLAYILDNPDIVkklleDFSNSLLVDLLYLY-LEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCPVL 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  407 QAAKNAAKHGNEVYFYTFEYVNpdSFGMWDgmmPFKAAVHCTELRYLLGEGVYSKFEPTEEDRKVMETTTTLFSNFAKYG 486
Cdd:pfam00135 392 RFARLHASRGSPVYLYSFDYRG--SSLRWP---PWMGVDHGDELPYVFGTPFLGPFLFTKEDRKLSRKMMTYWTNFAKTG 466
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|....
gi 363548513  487 NPNGKGATAeiWEKYSLNrPERHYRISYPKCeMRDVYHEGRIQF 530
Cdd:pfam00135 467 NPNGEGLPK--WPPYTDE-DQQYLSIDLKPR-VKRGLKAEDCAF 506
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
22-512 3.72e-86

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 275.08  E-value: 3.72e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  22 GPVRGNiykhDDVIVDGYLGIPYAKPPVGELRFKKPVTVDVWTEIKDCYKYGPACVQTggFEQIAGPRTPTPEEaGCLTL 101
Cdd:COG2272   10 GKVEGI----TVNGVHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQP--FNRMGSGEDFTGSE-DCLYL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 102 NVFTPRNAssefKNGRPVMVYIHGGGYELCASSDFcAYSLSGTLPLKDVVVVSINYRLGVFGFLT----TGDNVCPGNFG 177
Cdd:COG2272   83 NIWAPEVP----AEKLPVMVYIHGGGYIMGSGSEP-LYDGSALAARGDVVVVSVNYRLGALGFLDlsslDTEDAFASNLG 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 178 LWDQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCdfaIRASENQAKIFREFA 257
Cdd:COG2272  158 LLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASR---VTSREEAREKAAAFA 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 258 EFHGFSGRDSSALFKwyqeQSPETLsnVKGY---KKSISGFLTFIPNLDGDFFPK-PLDELRKEAP-KKQMMTGVTEYEG 332
Cdd:COG2272  235 RALGIPEATLDKLRA----LSAEDL--VKARlplIGRTFGAVPYGPVLGDSLLPRdPLEAIAQGRShGVPLMIGTNHDEG 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 333 LMLASMNPAFSPADVGLTLMpqgiygKDVVSNPDEIQKI--FYEKYVEGVDKSDELamrkklceaLGDEFFNVGVIQAAk 410
Cdd:COG2272  309 SLFINFNPDSPPGLRDKVAA------RLPGKELINAERVpaAYPGVSAAAAAFGAL---------VTDRLFKAPSIRLA- 372
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 411 NAAKHGNEVYFYTFEYVNPDSFGmwdgmmPFKAAVHCTELRYLLGE--GVYSKFEPTEEDRKVMETTTTLFSNFAKYGNP 488
Cdd:COG2272  373 QAQSAGAPTWLYRFDYAPDTVRV------PGFGAPHATELSLVFGNlvALGSAAQTARATAKLSRQMQDAWANFARTGSP 446
                        490       500
                 ....*....|....*....|....
gi 363548513 489 NGKGATAeiWEKYslNRPERHYRI 512
Cdd:COG2272  447 NGLGLPD--WPAY--TEERRATLV 466
Aes COG0657
Acetyl esterase/lipase [Lipid transport and metabolism];
103-224 2.93e-13

Acetyl esterase/lipase [Lipid transport and metabolism];


Pssm-ID: 223730 [Multi-domain]  Cd Length: 312  Bit Score: 70.73  E-value: 2.93e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513 103 VFTPRNASsefKNGRPVMVYIHGGGYELCaSSDFCAYSLSGTLPLKDVVVVSINYRLGVFG-FLTTGDNVCPgnfglwdq 181
Cdd:COG0657   68 VYRPDRKA---AATAPVVLYLHGGGWVLG-SLRTHDALVARLAAAAGAVVVSVDYRLAPEHpFPAALEDAYA-------- 135
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 363548513 182 tlALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSR 224
Cdd:COG0657  136 --AYRWLRANAAELGIDPSRIAVAGDSAGGHLALALALAARDR 176
Abhydrolase_3 pfam07859
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
120-211 1.65e-09

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 336840 [Multi-domain]  Cd Length: 205  Bit Score: 57.60  E-value: 1.65e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 363548513  120 MVYIHGGGYELC--ASSD-FCAySLSGTLplkDVVVVSINYRLG---VFgflttgdnvcPGNFglwDQTL-ALKWVQKHI 192
Cdd:pfam07859   1 LVYFHGGGFVLGsaDTHDrLCR-RLAARL---GAVVVSVDYRLApehPF----------PAAY---DDAYaALRWLAEQA 63
                          90
                  ....*....|....*....
gi 363548513  193 SSFGGDPNCVTVFGQSAGG 211
Cdd:pfam07859  64 WELGADPSRIAVAGDSAGG 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH