NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5921806|sp|O88502|]
View 

RecName: Full=High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A; Short=MmPDE8

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
550-801 1.09e-103

3'5'-cyclic nucleotide phosphodiesterase;


:

Pssm-ID: 333946  Cd Length: 236  Bit Score: 319.10  E-value: 1.09e-103
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    550 YHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAF 629
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    630 QLtLENDQCNIFKQMERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSINKpltaqeseepdrsleDIKAMLKTPESRA 709
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKFKELVKI---------------SEKNLLNTEEDRL 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    710 LIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAWDA 789
Cdd:pfam00233 145 LLLQLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALAD 223
                         250
                  ....*....|...
gi 5921806    790 FV-DLPNLMQHLD 801
Cdd:pfam00233 224 LFpELQPLLDNLE 236
PAS_9 pfam13426
PAS domain;
222-320 8.51e-11

PAS domain;


:

Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 59.40  E-value: 8.51e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    222 EAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV----PINEKKGDLLDAINSCVTVDKEWqgvyhtQKKNGDNIQ 297
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLfgepEASEALEEALREGREVREVEVVL------YRKDGEPFW 75
                          90       100
                  ....*....|....*....|...
gi 5921806    298 QNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:pfam13426  76 VLVSASPIRDDGGELVGIIAILR 98
PAS COG2202
PAS domain [Signal transduction mechanisms];
118-320 2.28e-06

PAS domain [Signal transduction mechanisms];


:

Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 49.46  E-value: 2.28e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  118 DKLHDIIIIDHRYPRQMdaetlCRSIRSSKFSENTVIVGVVRRVDKEESSLMPFLAAGFTRRFIENPNV---MACYNELL 194
Cdd:COG2202  27 EELLGLLLALHPEDRDR-----LRELLRRLLAGEELLSEELRLVRKDGEERWVELSAAPLRDGEGRVLGllgLRDITERK 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  195 QLACGEVRSQLKLRAcnsvftALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV--PINEKKGDLLDAI 272
Cdd:COG2202 102 RAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLihPEDEERRELELAR 175
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 5921806  273 NSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:COG2202 176 ALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIAR 223
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
78-155 6.32e-03

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


:

Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 38.82  E-value: 6.32e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5921806   78 VLLVfTKEDSQCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKlHDIIIIDHRYPRqMDAETLCRSIRSSKFSENTVIV 155
Cdd:COG0745   3 ILLV-EDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPD-LDGLELCRRLRAKKGSGPPIIV 77
 
Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
550-801 1.09e-103

3'5'-cyclic nucleotide phosphodiesterase;


Pssm-ID: 333946  Cd Length: 236  Bit Score: 319.10  E-value: 1.09e-103
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    550 YHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAF 629
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    630 QLtLENDQCNIFKQMERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSINKpltaqeseepdrsleDIKAMLKTPESRA 709
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKFKELVKI---------------SEKNLLNTEEDRL 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    710 LIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAWDA 789
Cdd:pfam00233 145 LLLQLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALAD 223
                         250
                  ....*....|...
gi 5921806    790 FV-DLPNLMQHLD 801
Cdd:pfam00233 224 LFpELQPLLDNLE 236
PAS_9 pfam13426
PAS domain;
222-320 8.51e-11

PAS domain;


Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 59.40  E-value: 8.51e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    222 EAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV----PINEKKGDLLDAINSCVTVDKEWqgvyhtQKKNGDNIQ 297
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLfgepEASEALEEALREGREVREVEVVL------YRKDGEPFW 75
                          90       100
                  ....*....|....*....|...
gi 5921806    298 QNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:pfam13426  76 VLVSASPIRDDGGELVGIIAILR 98
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
550-743 1.26e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032 [Multi-domain]  Cd Length: 145  Bit Score: 57.35  E-value: 1.26e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  550 YHNSTHAADVLHATAYFLSRDKIKEtldrIDEVAALIAATVHDVDHPGRTNSFlcnagnqlavlYNDTAVLESHHVALAF 629
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELGLSE----EDIELLRLAALLHDIGKPGTPDAI-----------TEEESELEKDHAIVGA 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  630 QLTlendqcnifkqmERNDYRTLRQSIIDMVLATEMtKHFEHVNKFINSINKpltaqesEEPDRSLEDikamlktpesra 709
Cdd:cd00077  66 EIL------------RELLLEEVIKLIDELILAVDA-SHHERLDGLGYPDGL-------KGEEITLEA------------ 113
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 5921806  710 likrMMIKCADVSNPCRPL--EHCIEWAARISEEYF 743
Cdd:cd00077 114 ----RIVKLADRLDALRRDsrEKRRRIAEEDLEELL 145
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
548-650 4.76e-07

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679 [Multi-domain]  Cd Length: 124  Bit Score: 49.22  E-value: 4.76e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806     548 NPYHNSTHAADVLHATAYflsrdkIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNagnqlavlyndTAVLESHHVAL 627
Cdd:smart00471   1 SDYHVFEHSLRVAQLAAA------LAEELGLLDIELLLLAALLHDIGKPGTPDSFLVK-----------TSVLEDHHFIG 63
                           90       100
                   ....*....|....*....|...
gi 5921806     628 AFQLtLENDQCNIFKQMERNDYR 650
Cdd:smart00471  64 AEIL-LEEEEPRILEEILRTAIL 85
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
226-320 5.36e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 48.40  E-value: 5.36e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  226 ITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPV 305
Cdd:cd00130   7 VLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVSLTPI 86
                        90
                ....*....|....*
gi 5921806  306 IGQGGKIRHYVSIIR 320
Cdd:cd00130  87 RDEGGEVIGLLGVVR 101
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
216-344 1.68e-06

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions]


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 51.06  E-value: 1.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    216 ALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQKKNGDN 295
Cdd:TIGR02938   9 TVDQAPLAISITDLKANILYANDAFTRITGYTKEEIIGKNESVLSNHTTPPEVYQALWGSLAEQKPWAGKLLNRRKDGEL 88
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 5921806    296 IQQNVKIIPVIGQGGKIRHYVSIIRvcngnnkveTTTECVQTDSQTDNQ 344
Cdd:TIGR02938  89 YLAELTVAPVLNEAGETTHFLGMHR---------DITELHRLEQVVANQ 128
PAS COG2202
PAS domain [Signal transduction mechanisms];
118-320 2.28e-06

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 49.46  E-value: 2.28e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  118 DKLHDIIIIDHRYPRQMdaetlCRSIRSSKFSENTVIVGVVRRVDKEESSLMPFLAAGFTRRFIENPNV---MACYNELL 194
Cdd:COG2202  27 EELLGLLLALHPEDRDR-----LRELLRRLLAGEELLSEELRLVRKDGEERWVELSAAPLRDGEGRVLGllgLRDITERK 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  195 QLACGEVRSQLKLRAcnsvftALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV--PINEKKGDLLDAI 272
Cdd:COG2202 102 RAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLihPEDEERRELELAR 175
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 5921806  273 NSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:COG2202 176 ALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIAR 223
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
215-259 5.75e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 38.92  E-value: 5.75e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 5921806     215 TALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV 259
Cdd:smart00091   5 AILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLEL 49
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
79-165 3.85e-03

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088 [Multi-domain]  Cd Length: 113  Bit Score: 37.56  E-value: 3.85e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806   79 LLVftkEDS--QCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKLHDIIIIDHRYPRqMDAETLCRSIRssKFSENTVIVG 156
Cdd:cd00156   1 LIV---DDDplIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPG-MDGLELLRRIR--KRGPDIPIIF 74

                ....*....
gi 5921806  157 VVRRVDKEE 165
Cdd:cd00156  75 LTAHGDDED 83
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
78-155 6.32e-03

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 38.82  E-value: 6.32e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5921806   78 VLLVfTKEDSQCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKlHDIIIIDHRYPRqMDAETLCRSIRSSKFSENTVIV 155
Cdd:COG0745   3 ILLV-EDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPD-LDGLELCRRLRAKKGSGPPIIV 77
 
Name Accession Description Interval E-value
PDEase_I pfam00233
3'5'-cyclic nucleotide phosphodiesterase;
550-801 1.09e-103

3'5'-cyclic nucleotide phosphodiesterase;


Pssm-ID: 333946  Cd Length: 236  Bit Score: 319.10  E-value: 1.09e-103
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    550 YHNSTHAADVLHATAYFLSRDKIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNAGNQLAVLYNDTAVLESHHVALAF 629
Cdd:pfam00233   1 YHNWRHAADVAQTMYYLLKKGGLKNVLTDLEILALLIAALCHDVDHPGTNNAFLINTKSPLAILYNDRSVLENHHCATAF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    630 QLtLENDQCNIFKQMERNDYRTLRQSIIDMVLATEMTKHFEHVNKFINSINKpltaqeseepdrsleDIKAMLKTPESRA 709
Cdd:pfam00233  81 KI-LSKEECNILSNLSADEYQEFRKLIIDLILATDMAKHFELLKKFKELVKI---------------SEKNLLNTEEDRL 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    710 LIKRMMIKCADVSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVmPVFDRNTCSIPKSQISFIDYFITDMFDAWDA 789
Cdd:pfam00233 145 LLLQLLIKAADISNPTRPWEISKRWAERLMEEFFRQGDLEKELGLPVS-PLMDREKTNLPKSQIGFIDFIVLPLFEALAD 223
                         250
                  ....*....|...
gi 5921806    790 FV-DLPNLMQHLD 801
Cdd:pfam00233 224 LFpELQPLLDNLE 236
PAS_9 pfam13426
PAS domain;
222-320 8.51e-11

PAS domain;


Pssm-ID: 338733 [Multi-domain]  Cd Length: 102  Bit Score: 59.40  E-value: 8.51e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    222 EAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV----PINEKKGDLLDAINSCVTVDKEWqgvyhtQKKNGDNIQ 297
Cdd:pfam13426   2 DGILITDEDGRIIYVNPAALRLLGYTREELLGKSLTDLfgepEASEALEEALREGREVREVEVVL------YRKDGEPFW 75
                          90       100
                  ....*....|....*....|...
gi 5921806    298 QNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:pfam13426  76 VLVSASPIRDDGGELVGIIAILR 98
HDc cd00077
Metal dependent phosphohydrolases with conserved 'HD' motif
550-743 1.26e-09

Metal dependent phosphohydrolases with conserved 'HD' motif


Pssm-ID: 238032 [Multi-domain]  Cd Length: 145  Bit Score: 57.35  E-value: 1.26e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  550 YHNSTHAADVLHATAYFLSRDKIKEtldrIDEVAALIAATVHDVDHPGRTNSFlcnagnqlavlYNDTAVLESHHVALAF 629
Cdd:cd00077   1 EHRFEHSLRVAQLARRLAEELGLSE----EDIELLRLAALLHDIGKPGTPDAI-----------TEEESELEKDHAIVGA 65
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  630 QLTlendqcnifkqmERNDYRTLRQSIIDMVLATEMtKHFEHVNKFINSINKpltaqesEEPDRSLEDikamlktpesra 709
Cdd:cd00077  66 EIL------------RELLLEEVIKLIDELILAVDA-SHHERLDGLGYPDGL-------KGEEITLEA------------ 113
                       170       180       190
                ....*....|....*....|....*....|....*.
gi 5921806  710 likrMMIKCADVSNPCRPL--EHCIEWAARISEEYF 743
Cdd:cd00077 114 ----RIVKLADRLDALRRDsrEKRRRIAEEDLEELL 145
PAS pfam00989
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
215-320 3.18e-08

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 334337 [Multi-domain]  Cd Length: 112  Bit Score: 52.02  E-value: 3.18e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    215 TALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQK-KNG 293
Cdd:pfam00989   5 AILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEDDDAEVVELLRQALRQGEESRGFEVTFKlPDG 84
                          90       100
                  ....*....|....*....|....*..
gi 5921806    294 DNIQQNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:pfam00989  85 RPRHVEVRASPVRDAGGEILGFLGFLR 111
HDc smart00471
Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic ...
548-650 4.76e-07

Metal dependent phosphohydrolases with conserved 'HD' motif; Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).


Pssm-ID: 214679 [Multi-domain]  Cd Length: 124  Bit Score: 49.22  E-value: 4.76e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806     548 NPYHNSTHAADVLHATAYflsrdkIKETLDRIDEVAALIAATVHDVDHPGRTNSFLCNagnqlavlyndTAVLESHHVAL 627
Cdd:smart00471   1 SDYHVFEHSLRVAQLAAA------LAEELGLLDIELLLLAALLHDIGKPGTPDSFLVK-----------TSVLEDHHFIG 63
                           90       100
                   ....*....|....*....|...
gi 5921806     628 AFQLtLENDQCNIFKQMERNDYR 650
Cdd:smart00471  64 AEIL-LEEEEPRILEEILRTAIL 85
PAS cd00130
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
226-320 5.36e-07

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.


Pssm-ID: 238075 [Multi-domain]  Cd Length: 103  Bit Score: 48.40  E-value: 5.36e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  226 ITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPV 305
Cdd:cd00130   7 VLDLDGRILYANPAAEQLLGYSPEELIGKSLLDLIHPEDREELRERLENLLSGGEPVTLEVRLRRKDGSVIWVLVSLTPI 86
                        90
                ....*....|....*
gi 5921806  306 IGQGGKIRHYVSIIR 320
Cdd:cd00130  87 RDEGGEVIGLLGVVR 101
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
216-344 1.68e-06

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes. [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions]


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 51.06  E-value: 1.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    216 ALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHTQKKNGDN 295
Cdd:TIGR02938   9 TVDQAPLAISITDLKANILYANDAFTRITGYTKEEIIGKNESVLSNHTTPPEVYQALWGSLAEQKPWAGKLLNRRKDGEL 88
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 5921806    296 IQQNVKIIPVIGQGGKIRHYVSIIRvcngnnkveTTTECVQTDSQTDNQ 344
Cdd:TIGR02938  89 YLAELTVAPVLNEAGETTHFLGMHR---------DITELHRLEQVVANQ 128
PAS COG2202
PAS domain [Signal transduction mechanisms];
118-320 2.28e-06

PAS domain [Signal transduction mechanisms];


Pssm-ID: 225112 [Multi-domain]  Cd Length: 232  Bit Score: 49.46  E-value: 2.28e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  118 DKLHDIIIIDHRYPRQMdaetlCRSIRSSKFSENTVIVGVVRRVDKEESSLMPFLAAGFTRRFIENPNV---MACYNELL 194
Cdd:COG2202  27 EELLGLLLALHPEDRDR-----LRELLRRLLAGEELLSEELRLVRKDGEERWVELSAAPLRDGEGRVLGllgLRDITERK 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  195 QLACGEVRSQLKLRAcnsvftALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV--PINEKKGDLLDAI 272
Cdd:COG2202 102 RAEEALRESEERLRA------LLEASPDGIWVLDEDGRILYANPAAEELLGYSPEEELGRGLSDLihPEDEERRELELAR 175
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*...
gi 5921806  273 NSCVTVDKEWQGVYHTQKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIR 320
Cdd:COG2202 176 ALAEGRGGPLEIEYRVRRKDGERVRWILSRISPVRDDGEIVGVVGIAR 223
sensory_box TIGR00229
PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain ...
215-320 4.70e-06

PAS domain S-box; The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions]


Pssm-ID: 272971 [Multi-domain]  Cd Length: 124  Bit Score: 46.13  E-value: 4.70e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806    215 TALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTVDKEWQGVYHT-QKKNG 293
Cdd:TIGR00229   7 AIFESSPDAIIVIDLEGNILYVNPAFEEIFGYSAEELIGRNVLELIPEEDREEVRERIERRLEGEPEPVSEERRvRRKDG 86
                          90       100
                  ....*....|....*....|....*..
gi 5921806    294 DNIQQNVKIIPVIGQGGkIRHYVSIIR 320
Cdd:TIGR00229  87 SEIWVEVSVSPIRTNGG-ELGVVGIVR 112
PAS smart00091
PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising ...
215-259 5.75e-04

PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels.


Pssm-ID: 214512  Cd Length: 67  Bit Score: 38.92  E-value: 5.75e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 5921806     215 TALEKSQEAIEITSEDHIIQYANPAFESTMGYQSGELIGKELAQV 259
Cdd:smart00091   5 AILESLPDGIFVLDLDGRILYANPAAEELLGYSPEELIGKSLLEL 49
RocR COG3829
Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding Fis domains ...
118-320 1.54e-03

Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding Fis domains [Transcription, Signal transduction mechanisms];


Pssm-ID: 226350 [Multi-domain]  Cd Length: 560  Bit Score: 41.90  E-value: 1.54e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  118 DKLHD--IIIIDHRYPRQMDA-----------ETLCRSIRSSKFSENT----------VIVGVVRRVDKEESSLMP---- 170
Cdd:COG3829   8 KSILDgpVVIDKNTGIDVANAlalakrqknaeAVIGRPLREILETLGMerveqsrdkeLTERLKLKVKRIVVVGKTpvde 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806  171 ---FLAAGFTRRFIEnpnvmacynELLQLAcgeVRSQLKLRACnsVFTALEKSQEAIEITSEDHIIQYANPAFESTMGYQ 247
Cdd:COG3829  88 qgrVVGVLEVFLDIS---------EALELI---EENLRQLRQR--LEAILDSIDDGLLVVDEDGIIIYYNKAYAKLLGLS 153
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 5921806  248 SGELIGKELAQVPINEKKGDLLDAINSCVTVDKewqgvyHTQKKNGDNIQQNVkiIPVIgQGGKIRHYVSIIR 320
Cdd:COG3829 154 PEEVLGKHLLDVVSAGEDSTLLEVLRTGKPIRD------VVQTYNGNKIIVNV--APVY-ADGQLIGVVGISK 217
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
79-165 3.85e-03

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088 [Multi-domain]  Cd Length: 113  Bit Score: 37.56  E-value: 3.85e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921806   79 LLVftkEDS--QCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKLHDIIIIDHRYPRqMDAETLCRSIRssKFSENTVIVG 156
Cdd:cd00156   1 LIV---DDDplIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPG-MDGLELLRRIR--KRGPDIPIIF 74

                ....*....
gi 5921806  157 VVRRVDKEE 165
Cdd:cd00156  75 LTAHGDDED 83
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
78-155 6.32e-03

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 38.82  E-value: 6.32e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 5921806   78 VLLVfTKEDSQCNGFHRACEKAGFKCTVTKEVQTVLTCFQDKlHDIIIIDHRYPRqMDAETLCRSIRSSKFSENTVIV 155
Cdd:COG0745   3 ILLV-EDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ-PDLVLLDLMLPD-LDGLELCRRLRAKKGSGPPIIV 77
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH