NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30688425|ref|NP_566796|]
View 

glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis thaliana]

Protein Classification

aldehyde dehydrogenase (domain architecture ID 11477421)

aldehyde dehydrogenase such as glyceraldehyde-3-phosphate dehydrogenase, which catalyzes the NAD-dependent oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate, and erythrose-4-phosphate dehydrogenase, which catalyzes NAD-dependent conversion of D-erythrose 4-phosphate to 4-phosphoerythronate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PLN03096 PLN03096
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
10-396 0e+00

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


:

Pssm-ID: 215572  Cd Length: 395  Bit Score: 700.92  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   10 KGFTEFSGLRSSSASLPFGKKLSSDEfvsiVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD 89
Cdd:PLN03096  13 KGFSEFSGLKSSSAVTFGKRSDSLDF----VVFATSAVSSSGGARRAVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLD 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   90 IIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAG 169
Cdd:PLN03096  89 VVAINDTGGVKQASHLLKYDSTLGTFDADVKPVGDDAISVDGKVIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDREGAG 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  170 KHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 249
Cdd:PLN03096 169 KHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKHSDPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  250 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKE 329
Cdd:PLN03096 249 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKE 328
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30688425  330 LKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 396
Cdd:PLN03096 329 LKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANKWK 395
 
Name Accession Description Interval E-value
PLN03096 PLN03096
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
10-396 0e+00

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 215572  Cd Length: 395  Bit Score: 700.92  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   10 KGFTEFSGLRSSSASLPFGKKLSSDEfvsiVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD 89
Cdd:PLN03096  13 KGFSEFSGLKSSSAVTFGKRSDSLDF----VVFATSAVSSSGGARRAVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLD 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   90 IIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAG 169
Cdd:PLN03096  89 VVAINDTGGVKQASHLLKYDSTLGTFDADVKPVGDDAISVDGKVIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDREGAG 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  170 KHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 249
Cdd:PLN03096 169 KHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKHSDPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  250 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKE 329
Cdd:PLN03096 249 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKE 328
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30688425  330 LKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 396
Cdd:PLN03096 329 LKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANKWK 395
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
61-396 8.09e-160

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism];


Pssm-ID: 223135  Cd Length: 335  Bit Score: 452.40  E-value: 8.09e-160
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  61 KLKVAINGFGRIGRNFLRCWHGRKDSpLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKpSGETAISVDGKIIQVVSNR 140
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDGD-IEVVAINDLTDPDYLAHLLKYDSVHGRFDGEVE-VKDDALVVNGKGIKVLAER 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 141 NPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEA-GAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLA 219
Cdd:COG0057  79 DPANLPWADLGVDIVVECTGKFTGREKAEKHLKAgGAKKVLISAPGKDDVATVVYGVNHNYYDAGHTIVSNASCTTNCLA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 220 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPN 299
Cdd:COG0057 159 PVAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPHKDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPN 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 300 VSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWG 379
Cdd:COG0057 239 VSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWG 318
                       330
                ....*....|....*..
gi 30688425 380 YSQRVVDLADIVANNWK 396
Cdd:COG0057 319 YSNRVVDLLAMVAKALK 335
GAPDH-I TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
63-386 2.35e-158

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675  Cd Length: 326  Bit Score: 448.26  E-value: 2.35e-158
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425    63 KVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSgETAISVDGK-IIQVVSNRN 141
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPGNDLEVVAINDLTDLEKLAYLLKYDSVHGRFEGEVTVD-EDGLVVNGKeVISVFSERD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPF 221
Cdd:TIGR01534  80 PSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDVKTIVYGVNHDEYDGEERIISNASCTTNCLAPL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   222 VKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVS 301
Cdd:TIGR01534 160 AKVLDEAFGIVSGLMTTVHAYTNDQNLLDGPHKDLRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTPNVS 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   302 VVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDD--MVKVIAWYDNEWG 379
Cdd:TIGR01534 240 LVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVTGLGdsLVKVYAWYDNEWG 319

                  ....*..
gi 30688425   380 YSQRVVD 386
Cdd:TIGR01534 320 YSNRLVD 326
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
62-213 4.34e-70

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 217.03  E-value: 4.34e-70
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425     62 LKVAINGFGRIGRNFLRCWHGRKDspLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETaISVDGKIIQVVSNRN 141
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPD--VEVVAINDLTDPEYLAYLLKYDSVHGRFPGTVEVEGDG-LVVNGKAIKVFAERD 77
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 30688425    142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASC 213
Cdd:smart00846  78 PANLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDADPTFVYGVNHDEYDGEDHIISNASC 149
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
218-374 6.58e-66

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 308445  Cd Length: 158  Bit Score: 206.68  E-value: 6.58e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   218 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRAR-AAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVP 296
Cdd:pfam02800   1 LAPLAKVLNDAFGIKKGLMTTVHAYTNDQKLLDGPHHKDLRRGrAAAPNIIPTSTGAAKAVGLVLPELKGKLDGMAVRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 30688425   297 TPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWY 374
Cdd:pfam02800  81 TPNVSVVDLVVELEKPVTVEEVNAALKEAAEGALKGILGYTEDPLVSSDFVGDPHSSIFDAKETIVVGGNFVKVVAWY 158
 
Name Accession Description Interval E-value
PLN03096 PLN03096
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
10-396 0e+00

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 215572  Cd Length: 395  Bit Score: 700.92  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   10 KGFTEFSGLRSSSASLPFGKKLSSDEfvsiVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD 89
Cdd:PLN03096  13 KGFSEFSGLKSSSAVTFGKRSDSLDF----VVFATSAVSSSGGARRAVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLD 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   90 IIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAG 169
Cdd:PLN03096  89 VVAINDTGGVKQASHLLKYDSTLGTFDADVKPVGDDAISVDGKVIKVVSDRNPLNLPWGELGIDLVIEGTGVFVDREGAG 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  170 KHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 249
Cdd:PLN03096 169 KHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKHSDPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  250 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKE 329
Cdd:PLN03096 249 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDAAEKE 328
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30688425  330 LKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 396
Cdd:PLN03096 329 LKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANKWK 395
PLN02237 PLN02237
glyceraldehyde-3-phosphate dehydrogenase B
12-395 0e+00

glyceraldehyde-3-phosphate dehydrogenase B


Pssm-ID: 215131  Cd Length: 442  Bit Score: 595.73  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   12 FTEFSGLRSSSAsLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDII 91
Cdd:PLN02237  27 VAEFSGLRASSC-VTFAKNAREASFFDVVASQLAPKVAGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVV 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   92 AINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKH 171
Cdd:PLN02237 106 VVNDSGGVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  172 IEAGAKKVIITAPGKG-DIPTYVVGVNADAYSHDEP-IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLL 249
Cdd:PLN02237 186 IQAGAKKVIITAPAKGaDIPTYVVGVNEDDYDHEVAnIVSNASCTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLL 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  250 DASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEK 328
Cdd:PLN02237 266 DASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGItAEDVNAAFRKAADG 345
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 30688425  329 ELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 395
Cdd:PLN02237 346 PLKGILAVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKW 412
PRK07403 PRK07403
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
62-396 2.98e-180

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 180962  Cd Length: 337  Bit Score: 504.06  E-value: 2.98e-180
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   62 LKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKpSGETAISVDGKIIQVVSNRN 141
Cdd:PRK07403   2 IRVAINGFGRIGRNFLRCWLGRENSQLELVAINDTSDPRTNAHLLKYDSMLGKLNADIS-ADENSITVNGKTIKCVSDRN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTYVVGVNADAYSHDE-PIISNASCTTNCLA 219
Cdd:PRK07403  81 PLNLPWKEWGIDLIIESTGVFVTKEGASKHIQAGAKKVLITAPGKGeDIGTYVVGVNHHEYDHEDhNIISNASCTTNCLA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  220 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPN 299
Cdd:PRK07403 161 PIAKVLHDNFGIIKGTMTTTHSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPELKGKLNGIALRVPTPN 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  300 VSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWG 379
Cdd:PRK07403 241 VSVVDLVVQVEKRTITEQVNEVLKDASEGPLKGILEYSDLPLVSSDYRGTDASSIVDASLTMVMGGDMVKVIAWYDNEWG 320
                        330
                 ....*....|....*..
gi 30688425  380 YSQRVVDLADIVANNWK 396
Cdd:PRK07403 321 YSQRVVDLAELVARKWK 337
GapA COG0057
Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate ...
61-396 8.09e-160

Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism];


Pssm-ID: 223135  Cd Length: 335  Bit Score: 452.40  E-value: 8.09e-160
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  61 KLKVAINGFGRIGRNFLRCWHGRKDSpLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKpSGETAISVDGKIIQVVSNR 140
Cdd:COG0057   1 MIKVAINGFGRIGRLVARAALERDGD-IEVVAINDLTDPDYLAHLLKYDSVHGRFDGEVE-VKDDALVVNGKGIKVLAER 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 141 NPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEA-GAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLA 219
Cdd:COG0057  79 DPANLPWADLGVDIVVECTGKFTGREKAEKHLKAgGAKKVLISAPGKDDVATVVYGVNHNYYDAGHTIVSNASCTTNCLA 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 220 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPN 299
Cdd:COG0057 159 PVAKVLNDAFGIEKGLMTTVHAYTNDQKLVDGPHKDLRRARAAALNIIPTSTGAAKAVGLVLPELKGKLTGMAIRVPTPN 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 300 VSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWG 379
Cdd:COG0057 239 VSVVDLTVELEKEVTVEEINAALKAASEIGLKGILGYTEDPLVSSDFNGDPHSSIFDASATIVLGGNLVKLVAWYDNEWG 318
                       330
                ....*....|....*..
gi 30688425 380 YSQRVVDLADIVANNWK 396
Cdd:COG0057 319 YSNRVVDLLAMVAKALK 335
GAPDH-I TIGR01534
glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents ...
63-386 2.35e-158

glyceraldehyde-3-phosphate dehydrogenase, type I; This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273675  Cd Length: 326  Bit Score: 448.26  E-value: 2.35e-158
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425    63 KVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSgETAISVDGK-IIQVVSNRN 141
Cdd:TIGR01534   1 KVGINGFGRIGRLVLRRILEKPGNDLEVVAINDLTDLEKLAYLLKYDSVHGRFEGEVTVD-EDGLVVNGKeVISVFSERD 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPF 221
Cdd:TIGR01534  80 PSDLPWKALGVDIVIECTGKFRDKEKLEKHLEAGAKKVLISAPSKGDVKTIVYGVNHDEYDGEERIISNASCTTNCLAPL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   222 VKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVS 301
Cdd:TIGR01534 160 AKVLDEAFGIVSGLMTTVHAYTNDQNLLDGPHKDLRRARAAALNIIPTSTGAAKAIGKVLPELAGKLTGMAIRVPTPNVS 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   302 VVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDD--MVKVIAWYDNEWG 379
Cdd:TIGR01534 240 LVDLVVNLEKDVTVEEVNAALKEASEGELKGVLGYTEDELVSSDFIGSPYSSIVDATATKVTGLGdsLVKVYAWYDNEWG 319

                  ....*..
gi 30688425   380 YSQRVVD 386
Cdd:TIGR01534 320 YSNRLVD 326
PRK07729 PRK07729
glyceraldehyde-3-phosphate dehydrogenase; Validated
61-396 1.85e-155

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 236079  Cd Length: 343  Bit Score: 441.48  E-value: 1.85e-155
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   61 KLKVAINGFGRIGRNFLRcwHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPsGETAISVDGKIIQVVSNR 140
Cdd:PRK07729   2 KTKVAINGFGRIGRMVFR--KAIKESAFEIVAINASYPSETLAHLIKYDTVHGKFDGTVEA-FEDHLLVDGKKIRLLNNR 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  141 NPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDE-PIISNASCTTNCLA 219
Cdd:PRK07729  79 DPKELPWTDLGIDIVIEATGKFNSKEKAILHVEAGAKKVILTAPGKNEDVTIVVGVNEDQLDIEKhTIISNASCTTNCLA 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  220 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPN 299
Cdd:PRK07729 159 PVVKVLDEQFGIENGLMTTVHAYTNDQKNIDNPHKDLRRARACGQSIIPTTTGAAKALAKVLPHLNGKLHGMALRVPTPN 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  300 VSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWG 379
Cdd:PRK07729 239 VSLVDLVVDVKRDVTVEEINEAFKTAANGALKGILEFSEEPLVSIDFNTNTHSAIIDGLSTMVMGDRKVKVLAWYDNEWG 318
                        330
                 ....*....|....*..
gi 30688425  380 YSQRVVDLADIVANNWK 396
Cdd:PRK07729 319 YSCRVVDLVTLVADELA 335
PLN02272 PLN02272
glyceraldehyde-3-phosphate dehydrogenase
2-387 5.05e-104

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 177912  Cd Length: 421  Bit Score: 313.72  E-value: 5.05e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425    2 ASVTFSVPKGFTEFSGLRSSSASLPFGKklssdefvSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWH 81
Cdd:PLN02272  34 SSVGFSSSLSFSGSSSGASSSLQSCSAR--------SVQPIKATATEAPPAVLKSSSSGKTKIGINGFGRIGRLVLRIAT 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   82 GRKDspLDIIAINDTG-GVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTG 160
Cdd:PLN02272 106 SRDD--IEVVAVNDPFiDAKYMAYMFKYDSTHGNFKGTINVVDDSTLEINGKQIKVTSKRDPAEIPWGDFGAEYVVESSG 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  161 VFVDREGAGKHIEAGAKKVIITAPgKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTH 240
Cdd:PLN02272 184 VFTTVEKASAHLKGGAKKVVISAP-SADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVH 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  241 SYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN 319
Cdd:PLN02272 263 ATTATQKTVDGpSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVK 342
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 30688425  320 AAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL 387
Cdd:PLN02272 343 AAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDL 410
PRK13535 PRK13535
erythrose 4-phosphate dehydrogenase; Provisional
62-386 2.51e-97

erythrose 4-phosphate dehydrogenase; Provisional


Pssm-ID: 184122  Cd Length: 336  Bit Score: 293.50  E-value: 2.51e-97
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   62 LKVAINGFGRIGRNFLRCWH--GRKDSpLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETaISVDGKIIQVVSN 139
Cdd:PRK13535   2 IRVAINGFGRIGRNVLRALYesGRRAE-ITVVAINELADAEGMAHLLKYDTSHGRFAWDVRQERDQ-LFVGDDAIRLLHE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  140 RNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDI-PTYVVGVNADAYSHDEPIISNASCTTNCL 218
Cdd:PRK13535  80 RDIASLPWRELGVDVVLDCTGVYGSREDGEAHIAAGAKKVLFSHPGSNDLdATVVYGVNHDQLRAEHRIVSNASCTTNCI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  219 APFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTP 298
Cdd:PRK13535 160 IPVIKLLDDAFGIESGTVTTIHSAMNDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRIFPQFNDRFEAISVRVPTI 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  299 NVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEW 378
Cdd:PRK13535 240 NVTAIDLSVTVKKPVKVNEVNQLLQKAAQGAFHGIVDYTELPLVSIDFNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEW 319

                 ....*...
gi 30688425  379 GYSQRVVD 386
Cdd:PRK13535 320 GFANRMLD 327
E4PD_g-proteo TIGR01532
erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases ...
63-386 4.70e-96

erythrose-4-phosphate dehydrogenase; This model represents the small clade of dehydrogenases in gamma-proteobacteria which utilize NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose. This enzyme activity appears to have evolved from glyceraldehyde-3-phosphate dehydrogenase, whose substrate differs only in the lack of one carbon relative to E4P. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]


Pssm-ID: 130595  Cd Length: 325  Bit Score: 289.87  E-value: 4.70e-96
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425    63 KVAINGFGRIGRNFLRCWH--GRKDSpLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGEtAISVDGKIIQVVSNR 140
Cdd:TIGR01532   1 RVAINGFGRIGRNVLRALYesGRRAE-ITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQDRD-QLFVGDDAIRVLHER 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   141 NPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDI-PTYVVGVNADAYSHDEPIISNASCTTNCLA 219
Cdd:TIGR01532  79 SLQSLPWRELGVDLVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGASDLdATIVYGVNQDQLRAEHRIVSNASCTTNCIV 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   220 PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPN 299
Cdd:TIGR01532 159 PVIKLLDDAYGIESGTITTIHSAMNDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGIERFFPQFNDRFEAIAVRVPTVN 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   300 VSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWG 379
Cdd:TIGR01532 239 VTAIDLSVTVKKPVKANEVNLLLQKAAQGALRGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLVKTLVWCDNEWG 318

                  ....*..
gi 30688425   380 YSQRVVD 386
Cdd:TIGR01532 319 FANRMLD 325
PTZ00023 PTZ00023
glyceraldehyde-3-phosphate dehydrogenase; Provisional
63-394 2.56e-95

glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173322  Cd Length: 337  Bit Score: 288.27  E-value: 2.56e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   63 KVAINGFGRIGRNFLRCWHGRKDspLDIIAINDT-GGVKQASHLLKYDSTLGIFDADVKPSGETAIsVDGKIIQVVSNRN 141
Cdd:PTZ00023   4 KLGINGFGRIGRLVFRAALERED--VEVVAINDPfMTLDYMCYLLKYDSVHGSLPAEVSVTDGFLM-IGSKKVHVFFEKD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPF 221
Cdd:PTZ00023  81 PAAIPWGKNGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPPKDDTPIYVMGVNHTQYDKSQRIVSNASCTTNCLAPL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  222 VKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLR---RARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTP 298
Cdd:PTZ00023 161 AKVVNDKFGIVEGLMTTVHASTANQLTVDGPSKGGKdwrAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  299 NVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEW 378
Cdd:PTZ00023 241 DVSVVDLTCKLAKPAKYEEIVAAVKKAAEGPLKGILGYTDDEVVSSDFVHDKRSSIFDVKAGIALNDTFVKLVSWYDNEW 320
                        330
                 ....*....|....*.
gi 30688425  379 GYSQRVVDLADIVANN 394
Cdd:PTZ00023 321 GYSNRLLDLAHYITQK 336
PRK08955 PRK08955
glyceraldehyde-3-phosphate dehydrogenase; Validated
61-391 5.46e-95

glyceraldehyde-3-phosphate dehydrogenase; Validated


Pssm-ID: 169599  Cd Length: 334  Bit Score: 287.40  E-value: 5.46e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   61 KLKVAINGFGRIGRNFLRC-WhgrkDSP-LDIIAINDTGG-VKQASHLLKYDSTLGIFDADVKPSGEtAISVDGKIIQVV 137
Cdd:PRK08955   2 TIKVGINGFGRIGRLALRAaW----DWPeVEFVQINDPAGdAATLAHLLEFDSVHGRWHHEVTAEGD-AIVINGKRIRTT 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  138 SNRNPSLLPWKelGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGD-IPTYVVGVNADAYSHDE-PIISNASCTT 215
Cdd:PRK08955  77 QNKAIADTDWS--GCDVVIEASGVMKTKALLQAYLDQGVKRVVVTAPVKEEgVLNIVMGVNDHLFDPAIhPIVTAASCTT 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  216 NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRV 295
Cdd:PRK08955 155 NCLAPVVKVIHEKLGIKHGSMTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAITEIFPELKGKLNGHAVRV 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  296 PTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYD 375
Cdd:PRK08955 235 PLANASLTDCVFEVERDTTVEEVNALLKEAAEGELKGILGYEERPLVSIDYKTDPRSSIVDALSTMVVNGTQVKLYAWYD 314
                        330
                 ....*....|....*.
gi 30688425  376 NEWGYSQRVVDLADIV 391
Cdd:PRK08955 315 NEWGYANRTAELARKV 330
gapA PRK15425
glyceraldehyde-3-phosphate dehydrogenase A; Provisional
62-387 4.63e-90

glyceraldehyde-3-phosphate dehydrogenase A; Provisional


Pssm-ID: 185323  Cd Length: 331  Bit Score: 274.69  E-value: 4.63e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   62 LKVAINGFGRIGRNFLRCWHGRKDspLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSgETAISVDGKIIQVVSNRN 141
Cdd:PRK15425   3 IKVGINGFGRIGRIVFRAAQKRSD--IEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVK-DGHLIVNGKKIRVTAERD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEpIISNASCTTNCLAPF 221
Cdd:PRK15425  80 PANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQD-IVSNASCTTNCLAPL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  222 VKVLDQKFGIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNV 300
Cdd:PRK15425 159 AKVINDNFGIIEGLMTTVHATTATQKTVDGpSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNV 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  301 SVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGY 380
Cdd:PRK15425 239 SVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGY 318

                 ....*..
gi 30688425  381 SQRVVDL 387
Cdd:PRK15425 319 SNKVLDL 325
PTZ00434 PTZ00434
cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional
60-392 1.60e-89

cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional


Pssm-ID: 185614  Cd Length: 361  Bit Score: 274.24  E-value: 1.60e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   60 AKLKVAINGFGRIGRNFLR--CWHGRKDSPLDIIAIND-TGGVKQASHLLKYDSTLGIFDADV-----KPSGET--AISV 129
Cdd:PTZ00434   2 APIKVGINGFGRIGRMVFQaiCDQGLIGTEIDVVAVVDmSTNAEYFAYQMKYDTVHGRPKYTVettksSPSVKTddVLVV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  130 DG-KIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEP-I 207
Cdd:PTZ00434  82 NGhRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEHhV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  208 ISNASCTTNCLAPFVKVLDQK-FGIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLK 285
Cdd:PTZ00434 162 VSNASCTTNCLAPIVHVLTKEgFGIETGLMTTIHSYTATQKTVDGvSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTK 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  286 GKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTM---V 362
Cdd:PTZ00434 242 GKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNRSSIYDSKATLqnnL 321
                        330       340       350
                 ....*....|....*....|....*....|.
gi 30688425  363 MGDD-MVKVIAWYDNEWGYSQRVVDLADIVA 392
Cdd:PTZ00434 322 PGERrFFKIVSWYDNEWGYSHRVVDLVRYMA 352
PLN02358 PLN02358
glyceraldehyde-3-phosphate dehydrogenase
57-387 1.77e-84

glyceraldehyde-3-phosphate dehydrogenase


Pssm-ID: 165999  Cd Length: 338  Bit Score: 260.81  E-value: 1.77e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   57 VTEAKLKVAINGFGRIGRNFLRCWHGRKDspLDIIAINDTG-GVKQASHLLKYDSTLGIFD-ADVKPSGETAISVDGKII 134
Cdd:PLN02358   1 MADKKIRIGINGFGRIGRLVARVVLQRDD--VELVAVNDPFiTTEYMTYMFKYDSVHGQWKhHELKIKDDKTLLFGEKPV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  135 QVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKgDIPTYVVGVNADAYSHDEPIISNASCT 214
Cdd:PLN02358  79 TVFGIRNPEDIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSK-DAPMFVVGVNEHEYKSDLDIVSNASCT 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  215 TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIAL 293
Cdd:PLN02358 158 TNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGpSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSF 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  294 RVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAW 373
Cdd:PLN02358 238 RVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSW 317
                        330
                 ....*....|....
gi 30688425  374 YDNEWGYSQRVVDL 387
Cdd:PLN02358 318 YDNEWGYSSRVVDL 331
PRK08289 PRK08289
glyceraldehyde-3-phosphate dehydrogenase; Reviewed
64-392 1.77e-83

glyceraldehyde-3-phosphate dehydrogenase; Reviewed


Pssm-ID: 236219  Cd Length: 477  Bit Score: 262.55  E-value: 1.77e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   64 VAINGFGRIGRNFLR--CWHGRKDSPLDIIAINDTGG-----VKQAShLLKYDSTLGIFDADVKPSGET-AISVDGKIIQ 135
Cdd:PRK08289 130 VVLYGFGRIGRLLARllIEKTGGGNGLRLRAIVVRKGsegdlEKRAS-LLRRDSVHGPFNGTITVDEENnAIIANGNYIQ 208
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  136 VVSNRNPSLLPWKELGID--IVIEGTGVFVDREGAGKHIEA-GAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNAS 212
Cdd:PRK08289 209 VIYANSPEEVDYTAYGINnaLVVDNTGKWRDEEGLSQHLKSkGVAKVLLTAPGKGDIKNIVHGVNHSDITDEDKIVSAAS 288
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  213 CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA 292
Cdd:PRK08289 289 CTTNAITPVLKAVNDKYGIVNGHVETVHSYTNDQNLIDNYHKGDRRGRSAPLNMVITETGAAKAVAKALPELAGKLTGNA 368
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  293 LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRD-SAEKELKGILDVCDEP-LVSVDFRCSDFSTTIDSSLTMVMGDDMVkV 370
Cdd:PRK08289 369 IRVPTPNVSMAILNLNLEKETSREELNEYLRQmSLHSPLQNQIDYTDSTeVVSSDFVGSRHAGVVDSQATIVNGNRAV-L 447
                        330       340
                 ....*....|....*....|..
gi 30688425  371 IAWYDNEWGYSQRVVDLADIVA 392
Cdd:PRK08289 448 YVWYDNEFGYSCQVVRVMEQMA 469
Gp_dh_N smart00846
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
62-213 4.34e-70

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 214851  Cd Length: 149  Bit Score: 217.03  E-value: 4.34e-70
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425     62 LKVAINGFGRIGRNFLRCWHGRKDspLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETaISVDGKIIQVVSNRN 141
Cdd:smart00846   1 IKVGINGFGRIGRLVLRAALERPD--VEVVAINDLTDPEYLAYLLKYDSVHGRFPGTVEVEGDG-LVVNGKAIKVFAERD 77
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 30688425    142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASC 213
Cdd:smart00846  78 PANLPWGELGVDIVVECTGGFTTREKASAHLKAGAKKVIISAPSKDADPTFVYGVNHDEYDGEDHIISNASC 149
Gp_dh_C pfam02800
Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding ...
218-374 6.58e-66

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. C-terminal domain is a mixed alpha/antiparallel beta fold.


Pssm-ID: 308445  Cd Length: 158  Bit Score: 206.68  E-value: 6.58e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   218 LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRAR-AAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVP 296
Cdd:pfam02800   1 LAPLAKVLNDAFGIKKGLMTTVHAYTNDQKLLDGPHHKDLRRGrAAAPNIIPTSTGAAKAVGLVLPELKGKLDGMAVRVP 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 30688425   297 TPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWY 374
Cdd:pfam02800  81 TPNVSVVDLVVELEKPVTVEEVNAALKEAAEGALKGILGYTEDPLVSSDFVGDPHSSIFDAKETIVVGGNFVKVVAWY 158
Gp_dh_N pfam00044
Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric ...
62-165 3.80e-41

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold.


Pssm-ID: 333793 [Multi-domain]  Cd Length: 101  Bit Score: 140.30  E-value: 3.80e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425    62 LKVAINGFGRIGRNFLRCWHGRKDspLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGEtAISVDGKIIQVVSNRN 141
Cdd:pfam00044   1 VKVGINGFGRIGRLVLRAALERPD--IEVVAINDLTDPETLAHLLKYDSVHGRFPGEVEADED-GLIVNGKKIKVFAERD 77
                          90       100
                  ....*....|....*....|....
gi 30688425   142 PSLLPWKELGIDIVIEGTGVFVDR 165
Cdd:pfam00044  78 PAELPWGDLGVDVVIESTGVFTTK 101
PTZ00353 PTZ00353
glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional
64-391 9.09e-29

glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional


Pssm-ID: 173546  Cd Length: 342  Bit Score: 114.59  E-value: 9.09e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425   64 VAINGFGRIGRNFLrcWHGRKDSPLDIIAINDTG-GVKQASHLLKYDSTLGIFD-ADVKPSGETAISVDGKIIQVVSNRN 141
Cdd:PTZ00353   5 VGINGFGPVGKAVL--FASLTDPLVTVVAVNDASvSIAYIAYVLEQESPLSAPDgASIRVVGEQIVLNGTQKIRVSAKHD 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  142 PSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIItAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPF 221
Cdd:PTZ00353  83 LVEIAWRDYGVQYVVECTGLYSTRSRCWGHVTGGAKGVFV-AGQSADAPTVMAGSNDERLSASLPVCCAGAPIAVALAPV 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  222 VKVLDQKFGIIKGTMTTTHSyTGDQRLLDASHRDLR---RARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTP 298
Cdd:PTZ00353 162 IRALHEVYGVEECSYTAIHG-MQPQEPIAARSKNSQdwrQTRVAIDAIAPYRDNGAETVCKLLPHLVGRISGSAFQVPVK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  299 NVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFrCSDFSTTID-SSLTMVMGDDMVKVIAWYDNE 377
Cdd:PTZ00353 241 KGCAIDMLVRTKQPVSKEVVDSALAEAASDRLNGVLCISKRDMISVDC-IPNGKLCYDaTSSSSSREGEVHKMVLWFDVE 319
                        330
                 ....*....|....
gi 30688425  378 WGYSQRVVDLADIV 391
Cdd:PTZ00353 320 CYYAARLLSLVKQL 333
Asd COG0136
Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism];
123-231 9.55e-04

Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism];


Pssm-ID: 223214 [Multi-domain]  Cd Length: 334  Bit Score: 40.67  E-value: 9.55e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425 123 GETAISVDGKIIQVvSNRNPSLLPWKelGIDIVIEGTGVFVDREGAGKHIEAGAkkVIITAPG----KGDIPTYVVGVNA 198
Cdd:COG0136  41 GKKYIEFGGKSIGV-PEDAADEFVFS--DVDIVFFAAGGSVSKEVEPKAAEAGC--VVIDNSSafrmDPDVPLVVPEVNP 115
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 30688425 199 DA---YSHDEPIISNASCTTNCLAPFVKVLDQKFGI 231
Cdd:COG0136 116 EHlidYQKRGFIIANPNCSTIQLVLALKPLHDAFGI 151
PRK14874 PRK14874
aspartate-semialdehyde dehydrogenase; Provisional
127-231 3.03e-03

aspartate-semialdehyde dehydrogenase; Provisional


Pssm-ID: 237845 [Multi-domain]  Cd Length: 334  Bit Score: 38.99  E-value: 3.03e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30688425  127 ISVDGKIIQV--VSNRNPSllpwkelGIDIVIEGTGVFVDREGAGKHIEAGAkkVII-------TAPgkgDIPTYVVGVN 197
Cdd:PRK14874  44 LSFKGKELKVedLTTFDFS-------GVDIALFSAGGSVSKKYAPKAAAAGA--VVIdnssafrMDP---DVPLVVPEVN 111
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 30688425  198 ADAYSHDEP--IISNASCTTNCLAPFVKVLDQKFGI 231
Cdd:PRK14874 112 PEALAEHRKkgIIANPNCSTIQMVVALKPLHDAAGI 147
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH