NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|17558864|ref|NP_504398|]
View 

Carboxylic ester hydrolase [Caenorhabditis elegans]

Protein Classification

carboxylesterase family protein (domain architecture ID 10444481)

carboxylesterase family protein catalyzes the hydrolysis of a carboxylic ester to form an alcohol and a carboxylate

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
COesterase pfam00135
Carboxylesterase family;
18-511 3.47e-174

Carboxylesterase family;


:

Pssm-ID: 333868  Cd Length: 507  Bit Score: 501.46  E-value: 3.47e-174
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    18 NASCGPIRGNVYEH-GDKIVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGALMVSQATnhdFA 96
Cdd:pfam00135   4 TTSLGRVRGRRVKVtGGDPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLE---GS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    97 EDnCLNLNVFAPKWKSAefpNGFPVMVYFYGGGFEVGFSSMFDDYSLTGTLplkDVILVTPNYRIGPLGFFATGDDVARG 176
Cdd:pfam00135  81 ED-CLYLNVYTPKNLNK---NKLPVMVWIHGGGFMTGSASLYDGSYLAARG---NVIVVTINYRLGILGFLSTGDDEAPG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   177 NWGLWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPFGIRSKDVEglIFR 256
Cdd:pfam00135 154 NYGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQSNPRK--RAK 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   257 EFANHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKC-PASGMFSFVPNFDGDFFPK-PFDELRKEA-PKLGAIVSIGEYE 333
Cdd:pfam00135 232 KLAKLVGCPTSDSAELVECLRSKPAEELLDAQLKVVyGSVPFVPFGPVVDGDFLPDhPEELLKSGNfPKVPLLIGVNKDE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   334 GLGFE----DFYAGQKTPQQMLSAALGP-----EVVRNREEVVKRAAESYLKNGGNENEENIAKTLVEIFGDYYFSVGAF 404
Cdd:pfam00135 312 GLYFLayilDNPDIVKKLLEDFSNSLLVdllylYLEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCPVL 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   405 DTVRSLVKYGNTVYLYSFNYFNPntpivFGKNRPFNAANHGSDLRYIFG---EGTGEFSKEDRQVMDMMGTYHTNFAKYG 481
Cdd:pfam00135 392 RFARLHASRGSPVYLYSFDYRGS-----SLRWPPWMGVDHGDELPYVFGtpfLGPFLFTKEDRKLSRKMMTYWTNFAKTG 466
                         490       500       510
                  ....*....|....*....|....*....|
gi 17558864   482 NPNGKGvSVPWEKYSlDNPGRYFKIDYPKC 511
Cdd:pfam00135 467 NPNGEG-LPKWPPYT-DEDQQYLSIDLKPR 494
 
Name Accession Description Interval E-value
COesterase pfam00135
Carboxylesterase family;
18-511 3.47e-174

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 501.46  E-value: 3.47e-174
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    18 NASCGPIRGNVYEH-GDKIVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGALMVSQATnhdFA 96
Cdd:pfam00135   4 TTSLGRVRGRRVKVtGGDPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLE---GS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    97 EDnCLNLNVFAPKWKSAefpNGFPVMVYFYGGGFEVGFSSMFDDYSLTGTLplkDVILVTPNYRIGPLGFFATGDDVARG 176
Cdd:pfam00135  81 ED-CLYLNVYTPKNLNK---NKLPVMVWIHGGGFMTGSASLYDGSYLAARG---NVIVVTINYRLGILGFLSTGDDEAPG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   177 NWGLWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPFGIRSKDVEglIFR 256
Cdd:pfam00135 154 NYGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQSNPRK--RAK 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   257 EFANHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKC-PASGMFSFVPNFDGDFFPK-PFDELRKEA-PKLGAIVSIGEYE 333
Cdd:pfam00135 232 KLAKLVGCPTSDSAELVECLRSKPAEELLDAQLKVVyGSVPFVPFGPVVDGDFLPDhPEELLKSGNfPKVPLLIGVNKDE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   334 GLGFE----DFYAGQKTPQQMLSAALGP-----EVVRNREEVVKRAAESYLKNGGNENEENIAKTLVEIFGDYYFSVGAF 404
Cdd:pfam00135 312 GLYFLayilDNPDIVKKLLEDFSNSLLVdllylYLEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCPVL 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   405 DTVRSLVKYGNTVYLYSFNYFNPntpivFGKNRPFNAANHGSDLRYIFG---EGTGEFSKEDRQVMDMMGTYHTNFAKYG 481
Cdd:pfam00135 392 RFARLHASRGSPVYLYSFDYRGS-----SLRWPPWMGVDHGDELPYVFGtpfLGPFLFTKEDRKLSRKMMTYWTNFAKTG 466
                         490       500       510
                  ....*....|....*....|....*....|
gi 17558864   482 NPNGKGvSVPWEKYSlDNPGRYFKIDYPKC 511
Cdd:pfam00135 467 NPNGEG-LPKWPPYT-DEDQQYLSIDLKPR 494
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
20-515 1.00e-130

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 389.77  E-value: 1.00e-130
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864  20 SCGPIRGNVYehgdKIVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGALmvSQATNHDFAEDn 99
Cdd:cd00312   5 PNGKVRGVDE----GGVYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGG--LWNAKLPGSED- 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 100 CLNLNVFAPKwkSAEFPNGFPVMVYFYGGGFEVGFSSMFDDYSLTGTLPlkDVILVTPNYRIGPLGFFATGDDVARGNWG 179
Cdd:cd00312  78 CLYLNVYTPK--NTKPGNSLPVMVWIHGGGFMFGSGSLYPGDGLAREGD--NVIVVSINYRLGVLGFLSTGDIELPGNYG 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 180 LWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPFGIRSkdVEGLIFREFA 259
Cdd:cd00312 154 LKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWAIQE--NARGRAKRLA 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 260 NHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKCPA--SGMFSFVPNFDGDFFPKPFDELRKE--APKLGAIVSIGEYEGL 335
Cdd:cd00312 232 RLLGCNDTSSAELLDCLRSKSAEELLDATRKLLLFsySPFLPFGPVVDGDFIPDDPEELIKEgkFAKVPLIIGVTKDEGG 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 336 GF-----EDFYAGQKTPQQMLSAALGPEVVRNREEVVKRAAESYLknGGNENEENIAKTLVEIFGDYYFSVGAFDTVRSL 410
Cdd:cd00312 312 YFaamllNFDAKLIIETNDRWLELLPYLLFYADDALADKVLEKYP--GDVDDSVESRKNLSDMLTDLLFKCPARYFLAQH 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 411 VKY-GNTVYLYSFNYFNPNtpiVFGKNRPFNAANHGSDLRYIFGE--GTGEFSKEDRQVMDMMGTYHTNFAKYGNPNGKG 487
Cdd:cd00312 390 RKAgGSPVYAYVFDHRSSL---SVGRWPPWLGTVHGDEIFFVFGNplLKEGLREEEEKLSRTMMKYWANFAKTGNPNTEG 466
                       490       500
                ....*....|....*....|....*...
gi 17558864 488 VSVPWEKYSLDNPgRYFKIDYPKCEMAD 515
Cdd:cd00312 467 NLVVWPAYTSESE-KYLDINIEGTEIKQ 493
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
22-517 6.94e-81

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 261.21  E-value: 6.94e-81
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864  22 GPIRGNVyEHGdkiVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGAlMVSQATnhdFAEDnCL 101
Cdd:COG2272  10 GKVEGIT-VNG---VHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQPFNRMG-SGEDFT---GSED-CL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 102 NLNVFAPKwKSAEfpnGFPVMVYFYGGGFEVGFSS--MFDDYSLTGTlplKDVILVTPNYRIGPLGFFA-TGDDVARG-- 176
Cdd:COG2272  81 YLNIWAPE-VPAE---KLPVMVYIHGGGYIMGSGSepLYDGSALAAR---GDVVVVSVNYRLGALGFLDlSSLDTEDAfa 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 177 -NWGLWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPfgiRSKDVEGLIF 255
Cdd:COG2272 154 sNLGLLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASRV---TSREEAREKA 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 256 REFANHHGYTGNDSKSLlqwyQSQDSEIFLKAEGY-KCPASGMFSFVPNFDGDFFPKPFDELRKEAPKLGAIVSIGEY-- 332
Cdd:COG2272 231 AAFARALGIPEATLDKL----RALSAEDLVKARLPlIGRTFGAVPYGPVLGDSLLPRDPLEAIAQGRSHGVPLMIGTNhd 306
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 333 EGLGFEDFYAGQKTPQQMLSAALGPEVVRNREEvvkRAAESYlknggnENEENIAKTLVEIFGDYYFSVgafDTVRSLVK 412
Cdd:COG2272 307 EGSLFINFNPDSPPGLRDKVAARLPGKELINAE---RVPAAY------PGVSAAAAAFGALVTDRLFKA---PSIRLAQA 374
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 413 Y--GNTVYLYSFNYfnPNTPIvfgkNRPFNAANHGSDLRYIFGEGTGE-----FSKEDRQVMDMMGTYHTNFAKYGNPNG 485
Cdd:COG2272 375 QsaGAPTWLYRFDY--APDTV----RVPGFGAPHATELSLVFGNLVALgsaaqTARATAKLSRQMQDAWANFARTGSPNG 448
                       490       500       510
                ....*....|....*....|....*....|..
gi 17558864 486 KGVSvPWEKYSLDNPgRYFKIDyPKCEMADNF 517
Cdd:COG2272 449 LGLP-DWPAYTEERR-ATLVLD-PEIKVENDP 477
 
Name Accession Description Interval E-value
COesterase pfam00135
Carboxylesterase family;
18-511 3.47e-174

Carboxylesterase family;


Pssm-ID: 333868  Cd Length: 507  Bit Score: 501.46  E-value: 3.47e-174
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    18 NASCGPIRGNVYEH-GDKIVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGALMVSQATnhdFA 96
Cdd:pfam00135   4 TTSLGRVRGRRVKVtGGDPVDAFLGIPYAEPPVGELRFQPPQPPEPWTGVRDATKFPPRCPQNGDLTDPGFSGLE---GS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864    97 EDnCLNLNVFAPKWKSAefpNGFPVMVYFYGGGFEVGFSSMFDDYSLTGTLplkDVILVTPNYRIGPLGFFATGDDVARG 176
Cdd:pfam00135  81 ED-CLYLNVYTPKNLNK---NKLPVMVWIHGGGFMTGSASLYDGSYLAARG---NVIVVTINYRLGILGFLSTGDDEAPG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   177 NWGLWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPFGIRSKDVEglIFR 256
Cdd:pfam00135 154 NYGLLDQVLALRWVQENIASFGGDPNNVTLFGESAGAASVSLLLLSPLSKGLFHRAILMSGSALSPWAIQSNPRK--RAK 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   257 EFANHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKC-PASGMFSFVPNFDGDFFPK-PFDELRKEA-PKLGAIVSIGEYE 333
Cdd:pfam00135 232 KLAKLVGCPTSDSAELVECLRSKPAEELLDAQLKVVyGSVPFVPFGPVVDGDFLPDhPEELLKSGNfPKVPLLIGVNKDE 311
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   334 GLGFE----DFYAGQKTPQQMLSAALGP-----EVVRNREEVVKRAAESYLKNGGNENEENIAKTLVEIFGDYYFSVGAF 404
Cdd:pfam00135 312 GLYFLayilDNPDIVKKLLEDFSNSLLVdllylYLEGRPEEISEAIKEEYTDWADRDDPETSRDALVDLLTDYLFNCPVL 391
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   405 DTVRSLVKYGNTVYLYSFNYFNPntpivFGKNRPFNAANHGSDLRYIFG---EGTGEFSKEDRQVMDMMGTYHTNFAKYG 481
Cdd:pfam00135 392 RFARLHASRGSPVYLYSFDYRGS-----SLRWPPWMGVDHGDELPYVFGtpfLGPFLFTKEDRKLSRKMMTYWTNFAKTG 466
                         490       500       510
                  ....*....|....*....|....*....|
gi 17558864   482 NPNGKGvSVPWEKYSlDNPGRYFKIDYPKC 511
Cdd:pfam00135 467 NPNGEG-LPKWPPYT-DEDQQYLSIDLKPR 494
Esterase_lipase cd00312
Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on ...
20-515 1.00e-130

Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate.


Pssm-ID: 238191  Cd Length: 493  Bit Score: 389.77  E-value: 1.00e-130
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864  20 SCGPIRGNVYehgdKIVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGALmvSQATNHDFAEDn 99
Cdd:cd00312   5 PNGKVRGVDE----GGVYSFLGIPYAEPPVGDLRFKEPQPYEPWSDVLDATSYPPSCMQWDQLGGG--LWNAKLPGSED- 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 100 CLNLNVFAPKwkSAEFPNGFPVMVYFYGGGFEVGFSSMFDDYSLTGTLPlkDVILVTPNYRIGPLGFFATGDDVARGNWG 179
Cdd:cd00312  78 CLYLNVYTPK--NTKPGNSLPVMVWIHGGGFMFGSGSLYPGDGLAREGD--NVIVVSINYRLGVLGFLSTGDIELPGNYG 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 180 LWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPFGIRSkdVEGLIFREFA 259
Cdd:cd00312 154 LKDQRLALKWVQDNIAAFGGDPDSVTIFGESAGGASVSLLLLSPDSKGLFHRAISQSGSALSPWAIQE--NARGRAKRLA 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 260 NHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKCPA--SGMFSFVPNFDGDFFPKPFDELRKE--APKLGAIVSIGEYEGL 335
Cdd:cd00312 232 RLLGCNDTSSAELLDCLRSKSAEELLDATRKLLLFsySPFLPFGPVVDGDFIPDDPEELIKEgkFAKVPLIIGVTKDEGG 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 336 GF-----EDFYAGQKTPQQMLSAALGPEVVRNREEVVKRAAESYLknGGNENEENIAKTLVEIFGDYYFSVGAFDTVRSL 410
Cdd:cd00312 312 YFaamllNFDAKLIIETNDRWLELLPYLLFYADDALADKVLEKYP--GDVDDSVESRKNLSDMLTDLLFKCPARYFLAQH 389
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 411 VKY-GNTVYLYSFNYFNPNtpiVFGKNRPFNAANHGSDLRYIFGE--GTGEFSKEDRQVMDMMGTYHTNFAKYGNPNGKG 487
Cdd:cd00312 390 RKAgGSPVYAYVFDHRSSL---SVGRWPPWLGTVHGDEIFFVFGNplLKEGLREEEEKLSRTMMKYWANFAKTGNPNTEG 466
                       490       500
                ....*....|....*....|....*...
gi 17558864 488 VSVPWEKYSLDNPgRYFKIDYPKCEMAD 515
Cdd:cd00312 467 NLVVWPAYTSESE-KYLDINIEGTEIKQ 493
PnbA COG2272
Carboxylesterase type B [Lipid transport and metabolism];
22-517 6.94e-81

Carboxylesterase type B [Lipid transport and metabolism];


Pssm-ID: 225181  Cd Length: 491  Bit Score: 261.21  E-value: 6.94e-81
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864  22 GPIRGNVyEHGdkiVNGYLGIPFAKAPIGDLRFKKSVEAEKWTQPLDCYKYGPGCPQSAALGAlMVSQATnhdFAEDnCL 101
Cdd:COG2272  10 GKVEGIT-VNG---VHSWLGIPYAAPPVGELRFRRPVPPEPWSGVRDATQFGPACPQPFNRMG-SGEDFT---GSED-CL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 102 NLNVFAPKwKSAEfpnGFPVMVYFYGGGFEVGFSS--MFDDYSLTGTlplKDVILVTPNYRIGPLGFFA-TGDDVARG-- 176
Cdd:COG2272  81 YLNIWAPE-VPAE---KLPVMVYIHGGGYIMGSGSepLYDGSALAAR---GDVVVVSVNYRLGALGFLDlSSLDTEDAfa 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 177 -NWGLWDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAATCPfgiRSKDVEGLIF 255
Cdd:COG2272 154 sNLGLLDQILALKWVRDNIEAFGGDPQNVTLFGESAGAASILTLLAVPSAKGLFHRAIALSGAASRV---TSREEAREKA 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 256 REFANHHGYTGNDSKSLlqwyQSQDSEIFLKAEGY-KCPASGMFSFVPNFDGDFFPKPFDELRKEAPKLGAIVSIGEY-- 332
Cdd:COG2272 231 AAFARALGIPEATLDKL----RALSAEDLVKARLPlIGRTFGAVPYGPVLGDSLLPRDPLEAIAQGRSHGVPLMIGTNhd 306
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 333 EGLGFEDFYAGQKTPQQMLSAALGPEVVRNREEvvkRAAESYlknggnENEENIAKTLVEIFGDYYFSVgafDTVRSLVK 412
Cdd:COG2272 307 EGSLFINFNPDSPPGLRDKVAARLPGKELINAE---RVPAAY------PGVSAAAAAFGALVTDRLFKA---PSIRLAQA 374
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 413 Y--GNTVYLYSFNYfnPNTPIvfgkNRPFNAANHGSDLRYIFGEGTGE-----FSKEDRQVMDMMGTYHTNFAKYGNPNG 485
Cdd:COG2272 375 QsaGAPTWLYRFDY--APDTV----RVPGFGAPHATELSLVFGNLVALgsaaqTARATAKLSRQMQDAWANFARTGSPNG 448
                       490       500       510
                ....*....|....*....|....*....|..
gi 17558864 486 KGVSvPWEKYSLDNPgRYFKIDyPKCEMADNF 517
Cdd:COG2272 449 LGLP-DWPAYTEERR-ATLVLD-PEIKVENDP 477
Aes COG0657
Acetyl esterase/lipase [Lipid transport and metabolism];
105-239 3.35e-12

Acetyl esterase/lipase [Lipid transport and metabolism];


Pssm-ID: 223730 [Multi-domain]  Cd Length: 312  Bit Score: 67.27  E-value: 3.35e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864 105 VFAPKWKSAEfpnGFPVMVYFYGGGFeVGFSSMFDDYSLTGTLPLKDVILVTPNYRIGP-LGFFATGDDVARgnwglwdq 183
Cdd:COG0657  68 VYRPDRKAAA---TAPVVLYLHGGGW-VLGSLRTHDALVARLAAAAGAVVVSVDYRLAPeHPFPAALEDAYA-------- 135
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 17558864 184 alALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANK----YFQKFI-PMSGAA 239
Cdd:COG0657 136 --AYRWLRANAAELGIDPSRIAVAGDSAGGHLALALALAARDRGlplpAAQVLIsPLLDLT 194
Abhydrolase_3 pfam07859
alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.
122-213 1.16e-08

alpha/beta hydrolase fold; This catalytic domain is found in a very wide range of enzymes.


Pssm-ID: 336840 [Multi-domain]  Cd Length: 205  Bit Score: 54.90  E-value: 1.16e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17558864   122 MVYFYGGGFEVGFSSMFDDY--SLTGTLplkDVILVTPNYRIGPLGFFATG-DDVargnwglWDqalALQWVQKHIKSFG 198
Cdd:pfam07859   1 LVYFHGGGFVLGSADTHDRLcrRLAARL---GAVVVSVDYRLAPEHPFPAAyDDA-------YA---ALRWLAEQAWELG 67
                          90
                  ....*....|....*
gi 17558864   199 GDPSNVTISGTSAGG 213
Cdd:pfam07859  68 ADPSRIAVAGDSAGG 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH