NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|15221277|ref|NP_172692|]
View 

LRR and NB-ARC domains-containing disease resistance protein [Arabidopsis thaliana]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
160-441 3.27e-115

NB-ARC domain;


:

Pssm-ID: 307194  Cd Length: 287  Bit Score: 353.23  E-value: 3.27e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   160 QETMLERVWTRLTEDGDE--IVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGE 237
Cdd:pfam00931   1 RETMVEKVIGKLSE*NDElgIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   238 EWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRV-DDPMEVSCLEPN 316
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   317 EAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPG-MEQILPIL 395
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGyLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 15221277   396 KYSYDNLnKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDEN 441
Cdd:pfam00931 241 SLSYDNL-PSCLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPS 285
LRR_8 pfam13855
Leucine rich repeat;
539-599 3.00e-06

Leucine rich repeat;


:

Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 45.21  E-value: 3.00e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15221277   539 ELTTLFLQKNdSLLHISDEFFRCIPMLVVLDLSGNsSLRKL-PNQISKLVSLRYLDLSWTYI 599
Cdd:pfam13855   1 NLRSLDLSNN-RLTVLDDGAFKGLSNLKVLDLSNN-LLTTLsPGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
516-646 9.57e-06

Leucine-rich repeat (LRR) protein [Transcription];


:

Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 48.81  E-value: 9.57e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277 516 SSVRRMSLMENEIEILSGSPECL-ELTTLFLQKNDsLLHISDEFFRCiPMLVVLDLSGNSsLRKLPNQISKLVSLRYLDL 594
Cdd:COG4886 140 SNLKELDLSDNKIESLPSPLRNLpNLKNLDLSFND-LSDLPKLLSNL-SNLNNLDLSGNK-ISDLPPEIELLSALEELDL 216
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|..
gi 15221277 595 SWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMS 646
Cdd:COG4886 217 SNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQIS 268
 
Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
160-441 3.27e-115

NB-ARC domain;


Pssm-ID: 307194  Cd Length: 287  Bit Score: 353.23  E-value: 3.27e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   160 QETMLERVWTRLTEDGDE--IVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGE 237
Cdd:pfam00931   1 RETMVEKVIGKLSE*NDElgIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   238 EWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRV-DDPMEVSCLEPN 316
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   317 EAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPG-MEQILPIL 395
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGyLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 15221277   396 KYSYDNLnKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDEN 441
Cdd:pfam00931 241 SLSYDNL-PSCLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPS 285
PLN03210 PLN03210
Resistant to P. syringae 6; Provisional
158-640 6.06e-09

Resistant to P. syringae 6; Provisional


Pssm-ID: 215633 [Multi-domain]  Cd Length: 1153  Bit Score: 59.89  E-value: 6.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   158 VGQETMLERVWTRLTEDGDEI--VGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQG--DIGKRLD 233
Cdd:PLN03210  187 VGIEDHIAKMSSLLHLESEEVrmVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANpdDYNMKLH 266
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   234 LGGEEWDNVnENQRALDIYNV------LGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDP 307
Cdd:PLN03210  267 LQRAFLSEI-LDKKDIKIYHLgameerLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHI 345
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   308 MEVsCLEPNE-AWELFQMKVGEntlKGHP--DIPELARKVAGKCCGLPLALNVIGETMAcKRMVQEWrnaIDVLSSYAAE 384
Cdd:PLN03210  346 YEV-CLPSNElALEMFCRSAFK---KNSPpdGFMELASEVALRAGNLPLGLNVLGSYLR-GRDKEDW---MDMLPRLRNG 417
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   385 FPGmeQILPILKYSYDNLNKEQVKPCFLYCSLFpedYRMEKERLIDYWICEGFIDENesreralsqgyeiIGI--LVRAC 462
Cdd:PLN03210  418 LDG--KIEKTLRVSYDGLNNKKDKAIFRHIACL---FNGEKVNDIKLLLANSDLDVN-------------IGLknLVDKS 479
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   463 LLLEEainKEQVKMHDVVREMALWI----ASDLGEH------KERCIVqvgvgLREVPKVKNwssVRRMSLMENEIEIL- 531
Cdd:PLN03210  480 LIHVR---EDIVEMHSLLQEMGKEIvraqSNEPGEReflvdaKDICDV-----LEDNTGTKK---VLGITLDIDEIDELh 548
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   532 ------SGSPECLEL---TTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGnSSLRKLPNQIsKLVSLRYLDLSWTYIKRL 602
Cdd:PLN03210  549 ihenafKGMRNLLFLkfyTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDK-YPLRCMPSNF-RPENLVKLQMQGSKLEKL 626
                         490       500       510
                  ....*....|....*....|....*....|....*...
gi 15221277   603 PVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQL 640
Cdd:PLN03210  627 WDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKL 664
LRR_8 pfam13855
Leucine rich repeat;
539-599 3.00e-06

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 45.21  E-value: 3.00e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15221277   539 ELTTLFLQKNdSLLHISDEFFRCIPMLVVLDLSGNsSLRKL-PNQISKLVSLRYLDLSWTYI 599
Cdd:pfam13855   1 NLRSLDLSNN-RLTVLDDGAFKGLSNLKVLDLSNN-LLTTLsPGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
516-646 9.57e-06

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 48.81  E-value: 9.57e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277 516 SSVRRMSLMENEIEILSGSPECL-ELTTLFLQKNDsLLHISDEFFRCiPMLVVLDLSGNSsLRKLPNQISKLVSLRYLDL 594
Cdd:COG4886 140 SNLKELDLSDNKIESLPSPLRNLpNLKNLDLSFND-LSDLPKLLSNL-SNLNNLDLSGNK-ISDLPPEIELLSALEELDL 216
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|..
gi 15221277 595 SWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMS 646
Cdd:COG4886 217 SNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQIS 268
 
Name Accession Description Interval E-value
NB-ARC pfam00931
NB-ARC domain;
160-441 3.27e-115

NB-ARC domain;


Pssm-ID: 307194  Cd Length: 287  Bit Score: 353.23  E-value: 3.27e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   160 QETMLERVWTRLTEDGDE--IVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGE 237
Cdd:pfam00931   1 RETMVEKVIGKLSE*NDElgIVGIHGMGGVGKTTLAAQIFNDDSLVGGHFDSVAWVVVSKTFTIEDLQQDILKRLGLEDS 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   238 EWDNVNENQRALDIYNVLGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRV-DDPMEVSCLEPN 316
Cdd:pfam00931  81 DWVEKNEGELADKIRRLLLRKRFLLVLDDVWDEEDWDKIGVPFPDRENGSRVLLTTRSESVANRVGGtSYPHEVELLEPD 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   317 EAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSYAAEFPG-MEQILPIL 395
Cdd:pfam00931 161 EAWELFENKVFEKELETCPDLEDVAKEIVEKCRGLPLALKVIGGLLATKSTVQEWEHVADQLNNKLAESRGyLNEVLSIL 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 15221277   396 KYSYDNLnKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDEN 441
Cdd:pfam00931 241 SLSYDNL-PSCLKRCFLYLSLFPEDKEIPVKRLVKLWVAEGFVIPS 285
PLN03210 PLN03210
Resistant to P. syringae 6; Provisional
158-640 6.06e-09

Resistant to P. syringae 6; Provisional


Pssm-ID: 215633 [Multi-domain]  Cd Length: 1153  Bit Score: 59.89  E-value: 6.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   158 VGQETMLERVWTRLTEDGDEI--VGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQG--DIGKRLD 233
Cdd:PLN03210  187 VGIEDHIAKMSSLLHLESEEVrmVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANpdDYNMKLH 266
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   234 LGGEEWDNVnENQRALDIYNV------LGKQKFVLLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDP 307
Cdd:PLN03210  267 LQRAFLSEI-LDKKDIKIYHLgameerLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHI 345
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   308 MEVsCLEPNE-AWELFQMKVGEntlKGHP--DIPELARKVAGKCCGLPLALNVIGETMAcKRMVQEWrnaIDVLSSYAAE 384
Cdd:PLN03210  346 YEV-CLPSNElALEMFCRSAFK---KNSPpdGFMELASEVALRAGNLPLGLNVLGSYLR-GRDKEDW---MDMLPRLRNG 417
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   385 FPGmeQILPILKYSYDNLNKEQVKPCFLYCSLFpedYRMEKERLIDYWICEGFIDENesreralsqgyeiIGI--LVRAC 462
Cdd:PLN03210  418 LDG--KIEKTLRVSYDGLNNKKDKAIFRHIACL---FNGEKVNDIKLLLANSDLDVN-------------IGLknLVDKS 479
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   463 LLLEEainKEQVKMHDVVREMALWI----ASDLGEH------KERCIVqvgvgLREVPKVKNwssVRRMSLMENEIEIL- 531
Cdd:PLN03210  480 LIHVR---EDIVEMHSLLQEMGKEIvraqSNEPGEReflvdaKDICDV-----LEDNTGTKK---VLGITLDIDEIDELh 548
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277   532 ------SGSPECLEL---TTLFLQKNDSLLHISDEFFRCIPMLVVLDLSGnSSLRKLPNQIsKLVSLRYLDLSWTYIKRL 602
Cdd:PLN03210  549 ihenafKGMRNLLFLkfyTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDK-YPLRCMPSNF-RPENLVKLQMQGSKLEKL 626
                         490       500       510
                  ....*....|....*....|....*....|....*...
gi 15221277   603 PVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQL 640
Cdd:PLN03210  627 WDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKL 664
LRR_8 pfam13855
Leucine rich repeat;
539-599 3.00e-06

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 45.21  E-value: 3.00e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15221277   539 ELTTLFLQKNdSLLHISDEFFRCIPMLVVLDLSGNsSLRKL-PNQISKLVSLRYLDLSWTYI 599
Cdd:pfam13855   1 NLRSLDLSNN-RLTVLDDGAFKGLSNLKVLDLSNN-LLTTLsPGAFSGLPSLRYLDLSGNRL 60
LRR COG4886
Leucine-rich repeat (LRR) protein [Transcription];
516-646 9.57e-06

Leucine-rich repeat (LRR) protein [Transcription];


Pssm-ID: 227223 [Multi-domain]  Cd Length: 394  Bit Score: 48.81  E-value: 9.57e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15221277 516 SSVRRMSLMENEIEILSGSPECL-ELTTLFLQKNDsLLHISDEFFRCiPMLVVLDLSGNSsLRKLPNQISKLVSLRYLDL 594
Cdd:COG4886 140 SNLKELDLSDNKIESLPSPLRNLpNLKNLDLSFND-LSDLPKLLSNL-SNLNNLDLSGNK-ISDLPPEIELLSALEELDL 216
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|..
gi 15221277 595 SWTYIKRLPVGLQELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMS 646
Cdd:COG4886 217 SNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQIS 268
LRR_8 pfam13855
Leucine rich repeat;
565-619 4.41e-03

Leucine rich repeat;


Pssm-ID: 338972 [Multi-domain]  Cd Length: 60  Bit Score: 35.96  E-value: 4.41e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 15221277   565 LVVLDLSGNSsLRKL-PNQISKLVSLRYLDLSWTYIKRL-PVGLQELKKLRYLRLDY 619
Cdd:pfam13855   2 LRSLDLSNNR-LTVLdDGAFKGLSNLKVLDLSNNLLTTLsPGAFSGLPSLRYLDLSG 57
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH