NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|116875854|ref|NP_034002|]
View 

cyclin-dependent kinase 5 activator 2 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CDK5_activator super family cl03966
Cyclin-dependent kinase 5 activator protein;
51-329 1.99e-99

Cyclin-dependent kinase 5 activator protein;


The actual alignment was detected with superfamily member pfam03261:

Pssm-ID: 308730  Cd Length: 348  Bit Score: 298.34  E-value: 1.99e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854   51 ESRLKRPSVLISALTWKRLVAASAKKKKGSKKV--TPKPASTGPDPLVQ------------QRNRENLLRKGRDGPDGGG 116
Cdd:pfam03261  36 EKSLKKHSLFINALSWKKLSTSHNKKKLDNKKNksANLPSACFKDQLLDftfnsstssdknQNIQLSCSRIENHNQQNCN 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  117 TAKPLA----VPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGS---------------PRRV 177
Cdd:pfam03261 116 CANTPTvysqVPSASKTTTIQHELFRSLLQVNNRNSLSNHNKLSQKQPLSLSLPPKHVPQQlqpssiqrssnaqvtPRKT 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  178 IVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDElASAAE 257
Cdd:pfam03261 196 VIQASTSELLKCLGIFLHNRCYRLKDFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRDLVSGEE-HKESE 274
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116875854  258 LQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEG 329
Cdd:pfam03261 275 LQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLAIVNRLSRKMLRINAEPGFFTEVFTDLKSCG 346
 
Name Accession Description Interval E-value
CDK5_activator pfam03261
Cyclin-dependent kinase 5 activator protein;
51-329 1.99e-99

Cyclin-dependent kinase 5 activator protein;


Pssm-ID: 308730  Cd Length: 348  Bit Score: 298.34  E-value: 1.99e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854   51 ESRLKRPSVLISALTWKRLVAASAKKKKGSKKV--TPKPASTGPDPLVQ------------QRNRENLLRKGRDGPDGGG 116
Cdd:pfam03261  36 EKSLKKHSLFINALSWKKLSTSHNKKKLDNKKNksANLPSACFKDQLLDftfnsstssdknQNIQLSCSRIENHNQQNCN 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  117 TAKPLA----VPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGS---------------PRRV 177
Cdd:pfam03261 116 CANTPTvysqVPSASKTTTIQHELFRSLLQVNNRNSLSNHNKLSQKQPLSLSLPPKHVPQQlqpssiqrssnaqvtPRKT 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  178 IVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDElASAAE 257
Cdd:pfam03261 196 VIQASTSELLKCLGIFLHNRCYRLKDFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRDLVSGEE-HKESE 274
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116875854  258 LQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEG 329
Cdd:pfam03261 275 LQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLAIVNRLSRKMLRINAEPGFFTEVFTDLKSCG 346
 
Name Accession Description Interval E-value
CDK5_activator pfam03261
Cyclin-dependent kinase 5 activator protein;
51-329 1.99e-99

Cyclin-dependent kinase 5 activator protein;


Pssm-ID: 308730  Cd Length: 348  Bit Score: 298.34  E-value: 1.99e-99
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854   51 ESRLKRPSVLISALTWKRLVAASAKKKKGSKKV--TPKPASTGPDPLVQ------------QRNRENLLRKGRDGPDGGG 116
Cdd:pfam03261  36 EKSLKKHSLFINALSWKKLSTSHNKKKLDNKKNksANLPSACFKDQLLDftfnsstssdknQNIQLSCSRIENHNQQNCN 115
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  117 TAKPLA----VPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGS---------------PRRV 177
Cdd:pfam03261 116 CANTPTvysqVPSASKTTTIQHELFRSLLQVNNRNSLSNHNKLSQKQPLSLSLPPKHVPQQlqpssiqrssnaqvtPRKT 195
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116875854  178 IVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDElASAAE 257
Cdd:pfam03261 196 VIQASTSELLKCLGIFLHNRCYRLKDFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRDLVSGEE-HKESE 274
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 116875854  258 LQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEG 329
Cdd:pfam03261 275 LQASVLTCLYLSYSYMGNEISYPLKPFLVEDSKEKFWDRCLAIVNRLSRKMLRINAEPGFFTEVFTDLKSCG 346
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH