NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28071008|emb|CAD61885|]
View 

unnamed protein product [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 super family cl29593
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
143-485 7.58e-35

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


The actual alignment was detected with superfamily member cd00200:

Pssm-ID: 356469 [Multi-domain]  Cd Length: 289  Bit Score: 132.07  E-value: 7.58e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 143 DSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIY 222
Cdd:cd00200   6 KGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLW 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 223 GEGDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGD 302
Cdd:cd00200  79 DLETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQ 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 303 DAICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrqaatqqnwdyr 382
Cdd:cd00200 156 DGTIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS----------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 383 wqqvpkkawrklklpGDSSLMTYRGHgvLHTLIRCRFSPihstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRD 462
Cdd:cd00200 208 ---------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTS 266
                       330       340
                ....*....|....*....|...
gi 28071008 463 VSWHPFEEKIVSSSWDGNLRLWQ 485
Cdd:cd00200 267 LAWSPDGKRLASGSADGTIRIWD 289
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
143-485 7.58e-35

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 132.07  E-value: 7.58e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 143 DSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIY 222
Cdd:cd00200   6 KGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLW 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 223 GEGDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGD 302
Cdd:cd00200  79 DLETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQ 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 303 DAICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrqaatqqnwdyr 382
Cdd:cd00200 156 DGTIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS----------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 383 wqqvpkkawrklklpGDSSLMTYRGHgvLHTLIRCRFSPihstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRD 462
Cdd:cd00200 208 ---------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTS 266
                       330       340
                ....*....|....*....|...
gi 28071008 463 VSWHPFEEKIVSSSWDGNLRLWQ 485
Cdd:cd00200 267 LAWSPDGKRLASGSADGTIRIWD 289
WD40 COG2319
WD40 repeat [General function prediction only];
143-505 9.70e-26

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 109.79  E-value: 9.70e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 143 DSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRfRKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSD--YIHICN 220
Cdd:COG2319  62 RGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE-KLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLdgTVKLWD 140
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 221 IYGEGDTHTALDLRPDErrfaVFSIAVSSDGRE-VLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFS 299
Cdd:COG2319 141 LSTPGKLIRTLEGHSES----VTSLAFSPDGKLlASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIAS 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 300 GGDDAICKVWDRRTMR--------------------------------------EDDPKPVGALAGHQDGITFIDSKGDA 341
Cdd:COG2319 217 GSSDGTIRLWDLSTGKllrstlsghsdsvvssfspdgsllasgssdgtirlwdlRSSSSLLRTLSGHSSSVLSVAFSPDG 296
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 342 RYLISNSKDQTIKLWDIRrfSSREGMEASRQAATQQNWDYRWQQVPKKAW---------RKLKLPGDSSLMTYRGHGVLH 412
Cdd:COG2319 297 KLLASGSSDGTVRLWDLE--TGKLLSSLTLKGHEGPVSSLSFSPDGSLLVsggsddgtiRLWDLRTGKPLKTLEGHSNVL 374
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 413 TLircRFSPIHstgqQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYF 492
Cdd:COG2319 375 SV---SFSPDG----RVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKTSLKS 447
                       410
                ....*....|...
gi 28071008 493 QDDMPESEECASA 505
Cdd:COG2319 448 VSFSPDGKVLASK 460
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
115-358 1.03e-10

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 63.95  E-value: 1.03e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  115 GLCHRGSFSlgeQSRVISHFLPNDLgftdSYSQKAFCGI-YSKDGQIFMSACQDQTIRLYDCrygrfrkfKSI--KARDV 191
Cdd:PLN00181 458 GLCKYLSFS---KLRVKADLKQGDL----LNSSNLVCAIgFDRDGEFFATAGVNKKIKIFEC--------ESIikDGRDI 522
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  192 GWSVLDVAFTPDGNHFLYSSW-------SDYIHICNIYGEGDTHTALDLRPDERRfaVFSIAVSSDGREVLG-GANDGCL 263
Cdd:PLN00181 523 HYPVVELASRSKLSGICWNSYiksqvasSNFEGVVQVWDVARSQLVTEMKEHEKR--VWSIDYSSADPTLLAsGSDDGSV 600
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  264 YVFDREQNRRTLQIEShEDDVNAVAFADISSQILFSGGDDAICKVWDRRtmredDPK-PVGALAGHQDGITFIDSKgDAR 342
Cdd:PLN00181 601 KLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLR-----NPKlPLCTMIGHSKTVSYVRFV-DSS 673
                        250
                 ....*....|....*.
gi 28071008  343 YLISNSKDQTIKLWDI 358
Cdd:PLN00181 674 TLVSSSTDNTLKLWDL 689
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
446-484 2.48e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 46.92  E-value: 2.48e-07
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 28071008    446 SGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 484
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLW 39
WD40 pfam00400
WD domain, G-beta repeat;
447-484 3.69e-06

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 43.50  E-value: 3.69e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 28071008   447 GHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 484
Cdd:pfam00400   1 GKLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVW 38
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
143-485 7.58e-35

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 132.07  E-value: 7.58e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 143 DSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSIKARDVGWsvldVAFTPDGNhFLYSSWSDyiHICNIY 222
Cdd:cd00200   6 KGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRD----VAASADGT-YLASGSSD--KTIRLW 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 223 GEGDTHTALDLRPDErrFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQILFSGGD 302
Cdd:cd00200  79 DLETGECVRTLTGHT--SYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAF-SPDGTFVASSSQ 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 303 DAICKVWDRRTMreddpKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRrfssregmeasrqaatqqnwdyr 382
Cdd:cd00200 156 DGTIKLWDLRTG-----KCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS----------------------- 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 383 wqqvpkkawrklklpGDSSLMTYRGHgvLHTLIRCRFSPihstGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRD 462
Cdd:cd00200 208 ---------------TGKCLGTLRGH--ENGVNSVAFSP----DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTS 266
                       330       340
                ....*....|....*....|...
gi 28071008 463 VSWHPFEEKIVSSSWDGNLRLWQ 485
Cdd:cd00200 267 LAWSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
194-487 6.33e-30

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 118.59  E-value: 6.33e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 194 SVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTaldlrPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRR 273
Cdd:cd00200  11 GVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRT-----LKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGEC 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 274 TLQIESHEDDVNAVAFADiSSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTI 353
Cdd:cd00200  86 VRTLTGHTSYVSSVAFSP-DGRILSSSSRDKTIKVWDVET-----GKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTI 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 354 KLWDIRrfssregmeasrqaatqqnwdyrwqqvpkkawrklklpGDSSLMTYRGH--GVLHtlirCRFSPihsTGQQFIy 431
Cdd:cd00200 160 KLWDLR--------------------------------------TGKCVATLTGHtgEVNS----VAFSP---DGEKLL- 193
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 28071008 432 SGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYR 487
Cdd:cd00200 194 SSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLR 249
WD40 COG2319
WD40 repeat [General function prediction only];
143-505 9.70e-26

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 109.79  E-value: 9.70e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 143 DSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRfRKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSD--YIHICN 220
Cdd:COG2319  62 RGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE-KLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLdgTVKLWD 140
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 221 IYGEGDTHTALDLRPDErrfaVFSIAVSSDGRE-VLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFS 299
Cdd:COG2319 141 LSTPGKLIRTLEGHSES----VTSLAFSPDGKLlASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIAS 216
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 300 GGDDAICKVWDRRTMR--------------------------------------EDDPKPVGALAGHQDGITFIDSKGDA 341
Cdd:COG2319 217 GSSDGTIRLWDLSTGKllrstlsghsdsvvssfspdgsllasgssdgtirlwdlRSSSSLLRTLSGHSSSVLSVAFSPDG 296
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 342 RYLISNSKDQTIKLWDIRrfSSREGMEASRQAATQQNWDYRWQQVPKKAW---------RKLKLPGDSSLMTYRGHGVLH 412
Cdd:COG2319 297 KLLASGSSDGTVRLWDLE--TGKLLSSLTLKGHEGPVSSLSFSPDGSLLVsggsddgtiRLWDLRTGKPLKTLEGHSNVL 374
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 413 TLircRFSPIHstgqQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYF 492
Cdd:COG2319 375 SV---SFSPDG----RVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDFSPDGKSLASGSSDNTIRLWDLKTSLKS 447
                       410
                ....*....|...
gi 28071008 493 QDDMPESEECASA 505
Cdd:COG2319 448 VSFSPDGKVLASK 460
WD40 COG2319
WD40 repeat [General function prediction only];
126-484 3.37e-22

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 99.39  E-value: 3.37e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 126 EQSRVISHFLPNDLGFTDSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSikardvgwSVLDVAFTPDGN 205
Cdd:COG2319   7 TSSENKSKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHED--------SITSIAFSPDGE 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 206 HFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTL-QIESHEDDV 284
Cdd:COG2319  79 LLLSGSSDGTIKLWDLDNGEKLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLDGTVKLWDLSTPGKLIrTLEGHSESV 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 285 NAVAFADISSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLI-SNSKDQTIKLWDIRrfss 363
Cdd:COG2319 159 TSLAFSPDGKLLASGSSLDGTIKLWDLRT-----GKPLSTLAGHTDPVSSLAFSPDGGLLIaSGSSDGTIRLWDLS---- 229
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 364 regmeasrqaatqqnwdyrwqqvpkkawrklklPGDSSLMTYRGHgvLHTLIRCrFSPIHStgqqFIYSGCSTGKVVVYD 443
Cdd:COG2319 230 ---------------------------------TGKLLRSTLSGH--SDSVVSS-FSPDGS----LLASGSSDGTIRLWD 269
                       330       340       350       360
                ....*....|....*....|....*....|....*....|..
gi 28071008 444 LLSGHI-VKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 484
Cdd:COG2319 270 LRSSSSlLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLW 311
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
276-490 5.36e-21

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 92.78  E-value: 5.36e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 276 QIESHEDDVNAVAFADiSSQILFSGGDDAICKVWDRRTMReddpkPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKL 355
Cdd:cd00200   4 TLKGHTGGVTCVAFSP-DGKLLATGSGDGTIKVWDLETGE-----LLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 356 WDIRrfssregmeasrqaatqqnwdyrwqqvpkkawrklklpGDSSLMTYRGH--GVLHtlirCRFSPIHstgqQFIYSG 433
Cdd:cd00200  78 WDLE--------------------------------------TGECVRTLTGHtsYVSS----VAFSPDG----RILSSS 111
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 28071008 434 CSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAE 490
Cdd:cd00200 112 SRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGK 168
WD40 COG2319
WD40 repeat [General function prediction only];
137-313 4.90e-14

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 73.97  E-value: 4.90e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 137 NDLGFTDSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSIKARDVgwSVLDVAFTPDGNHFLYSSWSDyi 216
Cdd:COG2319 275 SLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTLKGHEG--PVSSLSFSPDGSLLVSGGSDD-- 350
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 217 HICNIYgegDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFaDISSQI 296
Cdd:COG2319 351 GTIRLW---DLRTGKPLKTLEGHSNVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSLLRNLDGHTSRVTSLDF-SPDGKS 426
                       170
                ....*....|....*..
gi 28071008 297 LFSGGDDAICKVWDRRT 313
Cdd:COG2319 427 LASGSSDNTIRLWDLKT 443
WD40 COG2319
WD40 repeat [General function prediction only];
277-493 6.19e-12

WD40 repeat [General function prediction only];


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 67.42  E-value: 6.19e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 277 IESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLW 356
Cdd:COG2319  13 SKLLKKSELGPSLNSLSLLSLGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLW 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 357 DIRrfSSREGMEASRQAATQQNWDYRWQQV-----------PKKAWRKLKLPGDSS-LMTYRGHGvlHTLIRCRFSPihs 424
Cdd:COG2319  93 DLD--NGEKLIKSLEGLHDSSVSKLALSSPdgnsillasssLDGTVKLWDLSTPGKlIRTLEGHS--ESVTSLAFSP--- 165
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 425 TGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEK-IVSSSWDGNLRLWQYRQAEYFQ 493
Cdd:COG2319 166 DGKLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLlIASGSSDGTIRLWDLSTGKLLR 235
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
321-484 1.12e-11

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 65.43  E-value: 1.12e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 321 PVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDirrfssregmeasrqaatqqnwdyrwqqvpkkawrklkLPGDS 400
Cdd:cd00200   1 LRRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWD--------------------------------------LETGE 42
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008 401 SLMTYRGHgvLHTLIRCRFSPIHstgqQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGN 480
Cdd:cd00200  43 LLRTLKGH--TGPVRDVAASADG----TYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKT 116

                ....
gi 28071008 481 LRLW 484
Cdd:cd00200 117 IKVW 120
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
115-358 1.03e-10

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 63.95  E-value: 1.03e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  115 GLCHRGSFSlgeQSRVISHFLPNDLgftdSYSQKAFCGI-YSKDGQIFMSACQDQTIRLYDCrygrfrkfKSI--KARDV 191
Cdd:PLN00181 458 GLCKYLSFS---KLRVKADLKQGDL----LNSSNLVCAIgFDRDGEFFATAGVNKKIKIFEC--------ESIikDGRDI 522
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  192 GWSVLDVAFTPDGNHFLYSSW-------SDYIHICNIYGEGDTHTALDLRPDERRfaVFSIAVSSDGREVLG-GANDGCL 263
Cdd:PLN00181 523 HYPVVELASRSKLSGICWNSYiksqvasSNFEGVVQVWDVARSQLVTEMKEHEKR--VWSIDYSSADPTLLAsGSDDGSV 600
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  264 YVFDREQNRRTLQIEShEDDVNAVAFADISSQILFSGGDDAICKVWDRRtmredDPK-PVGALAGHQDGITFIDSKgDAR 342
Cdd:PLN00181 601 KLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLR-----NPKlPLCTMIGHSKTVSYVRFV-DSS 673
                        250
                 ....*....|....*.
gi 28071008  343 YLISNSKDQTIKLWDI 358
Cdd:PLN00181 674 TLVSSSTDNTLKLWDL 689
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
446-484 2.48e-07

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 46.92  E-value: 2.48e-07
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 28071008    446 SGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 484
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLW 39
WD40 pfam00400
WD domain, G-beta repeat;
447-484 3.69e-06

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 43.50  E-value: 3.69e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 28071008   447 GHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLW 484
Cdd:pfam00400   1 GKLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVW 38
WD40 pfam00400
WD domain, G-beta repeat;
320-357 2.36e-05

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 41.19  E-value: 2.36e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 28071008   320 KPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWD 357
Cdd:pfam00400   2 KLLKTLEGHSSSVTSLAFSPDGKLLASGSDDGTVKVWD 39
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
318-357 1.04e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 39.60  E-value: 1.04e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 28071008    318 DPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWD 357
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
PTZ00420 PTZ00420
coronin; Provisional
218-358 1.16e-04

coronin; Provisional


Pssm-ID: 240412 [Multi-domain]  Cd Length: 568  Bit Score: 44.56  E-value: 1.16e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  218 ICNIYGEGDTHTALDLRPDERRFAVFSIAVSSD----GREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADIS 293
Cdd:PTZ00420   7 IKNLYPDPSNNLFDDLRICSRVIDSCGIACSSGfvavPWEVEGGGLIGAIRLENQMRKPPVIKLKGHTSSILDLQFNPCF 86
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28071008  294 SQILFSGGDDAICKVWDRRTMRED-----DPKPVgaLAGHQDGITFIDSKGDARYLISNSK-DQTIKLWDI 358
Cdd:PTZ00420  87 SEILASGSEDLTIRVWEIPHNDESvkeikDPQCI--LKGHKKKISIIDWNPMNYYIMCSSGfDSFVNIWDI 155
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
277-310 4.67e-04

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651 [Multi-domain]  Cd Length: 40  Bit Score: 37.68  E-value: 4.67e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 28071008    277 IESHEDDVNAVAFADiSSQILFSGGDDAICKVWD 310
Cdd:smart00320   8 LKGHTGPVTSVAFSP-DGKYLASGSDDGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
277-310 6.81e-04

WD domain, G-beta repeat;


Pssm-ID: 334060 [Multi-domain]  Cd Length: 39  Bit Score: 36.96  E-value: 6.81e-04
                          10        20        30
                  ....*....|....*....|....*....|....
gi 28071008   277 IESHEDDVNAVAFADiSSQILFSGGDDAICKVWD 310
Cdd:pfam00400   7 LEGHSSSVTSLAFSP-DGKLLASGSDDGTVKVWD 39
PTZ00421 PTZ00421
coronin; Provisional
275-377 2.47e-03

coronin; Provisional


Pssm-ID: 173611 [Multi-domain]  Cd Length: 493  Bit Score: 40.26  E-value: 2.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28071008  275 LQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTmreddPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIK 354
Cdd:PTZ00421 119 VHLQGHTKKVGIVSFHPSAMNVLASAGADMVVNVWDVER-----GKAVEVIKCHSDQITSLEWNLDGSLLCTTSKDKKLN 193
                         90       100
                 ....*....|....*....|...
gi 28071008  355 LWDIRRFSSREGMEASRQAATQQ 377
Cdd:PTZ00421 194 IIDPRDGTIVSSVEAHASAKSQR 216
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH