NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23615541|emb|CAD52533|]
View 

ABC transporter B family member 5, putative [Plasmodium falciparum 3D7]

Protein Classification

ABC transporter ATP-binding protein (domain architecture ID 11438555)

ABC transporter ATP-binding protein containing both ATPase and permease components of an ABC-type multidrug transport system

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
168-918 1.01e-46

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


:

Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 176.47  E-value: 1.01e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 168 FIKNYFVDRN-IIKTIIFYFPYFICGGIASYMRIYFTNQCIKNIEIRLKKQVHDKILMNNEEEFKEYKTSDYLVnctfiE 246
Cdd:COG1132  40 IIDALLADLGeLLELLLLLLLLALLGGVLRALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLIS-----R 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 247 IKYSAKELITCITQTFRYMN----SVVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRIKIETTTMEEKQIARF 322
Cdd:COG1132 115 LTNDVEAVSNLVSTVLVLVFtsilLLIGSLVLLFSLSWRLALILLLILPLLALVLSLLARKSRKLSRRVREALGELNARL 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 323 SDSLQKKNIISLFGNESYEHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLVSF 402
Cdd:COG1132 195 LESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLLSSLGTVLVLALGGFLVLSGSLTVGALAAF 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 403 IVYSTMLGLGVGGMLKLKKDINLLQISLQKIYEILDLtksetqtdinnyeqgKLTIQDKQVNlsknkqsgnsmgkykpdn 482
Cdd:COG1132 275 ILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDE---------------EPEVEDPPDP------------------ 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 483 dddnkednkedskdynkddnkddnndnnndnnndnnndnnndnnndnnndnnndnnndhhndhnndnnnvvmnelpfkyp 562
Cdd:COG1132     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 563 hksnyiPNNIKGSIRFENVSFSYNhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDN 641
Cdd:COG1132 322 ------LKDTIGSIEFENVSFSYP-----GKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDpTSGEILIDG 390
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 642 LNIKNIHNHFLkRNILSVSEQECCIFNRTIYENLIYGLVplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnn 721
Cdd:COG1132 391 IDIRDISLDSL-RKRIGIVSQDPLLFSGTIRENIALGRP----------------------------------------- 428
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 722 iqstkynsqcyqknkhnitsnfitqsYRTQDEdphnisnhkhidntsrniyqnyytdflnsydeyklniinssINVLCEE 801
Cdd:COG1132 429 --------------------------DATDEE-----------------------------------------IEEALKL 441
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 802 LDLKQFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYIT 879
Cdd:COG1132 442 ANAHEFIANLPDGYDTIVGERgvNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIA 521
                       730       740       750       760
                ....*....|....*....|....*....|....*....|
gi 23615541 880 HSIHILNKMDKIIILDDGKIRAIGTYEQ-IKNDTLFRDIF 918
Cdd:COG1132 522 HRLSTIKNADRIIVLDNGRIVERGTHEElLAKGGLYARLY 561
 
Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
168-918 1.01e-46

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 176.47  E-value: 1.01e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 168 FIKNYFVDRN-IIKTIIFYFPYFICGGIASYMRIYFTNQCIKNIEIRLKKQVHDKILMNNEEEFKEYKTSDYLVnctfiE 246
Cdd:COG1132  40 IIDALLADLGeLLELLLLLLLLALLGGVLRALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLIS-----R 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 247 IKYSAKELITCITQTFRYMN----SVVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRIKIETTTMEEKQIARF 322
Cdd:COG1132 115 LTNDVEAVSNLVSTVLVLVFtsilLLIGSLVLLFSLSWRLALILLLILPLLALVLSLLARKSRKLSRRVREALGELNARL 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 323 SDSLQKKNIISLFGNESYEHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLVSF 402
Cdd:COG1132 195 LESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLLSSLGTVLVLALGGFLVLSGSLTVGALAAF 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 403 IVYSTMLGLGVGGMLKLKKDINLLQISLQKIYEILDLtksetqtdinnyeqgKLTIQDKQVNlsknkqsgnsmgkykpdn 482
Cdd:COG1132 275 ILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDE---------------EPEVEDPPDP------------------ 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 483 dddnkednkedskdynkddnkddnndnnndnnndnnndnnndnnndnnndnnndnnndhhndhnndnnnvvmnelpfkyp 562
Cdd:COG1132     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 563 hksnyiPNNIKGSIRFENVSFSYNhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDN 641
Cdd:COG1132 322 ------LKDTIGSIEFENVSFSYP-----GKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDpTSGEILIDG 390
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 642 LNIKNIHNHFLkRNILSVSEQECCIFNRTIYENLIYGLVplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnn 721
Cdd:COG1132 391 IDIRDISLDSL-RKRIGIVSQDPLLFSGTIRENIALGRP----------------------------------------- 428
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 722 iqstkynsqcyqknkhnitsnfitqsYRTQDEdphnisnhkhidntsrniyqnyytdflnsydeyklniinssINVLCEE 801
Cdd:COG1132 429 --------------------------DATDEE-----------------------------------------IEEALKL 441
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 802 LDLKQFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYIT 879
Cdd:COG1132 442 ANAHEFIANLPDGYDTIVGERgvNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIA 521
                       730       740       750       760
                ....*....|....*....|....*....|....*....|
gi 23615541 880 HSIHILNKMDKIIILDDGKIRAIGTYEQ-IKNDTLFRDIF 918
Cdd:COG1132 522 HRLSTIKNADRIIVLDNGRIVERGTHEElLAKGGLYARLY 561
ABCC_MRP_Like cd03228
ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP ...
576-898 7.70e-36

ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP (Multidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213195 [Multi-domain]  Cd Length: 171  Bit Score: 133.28  E-value: 7.70e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtCNF--SYEGNIFIDNLNIKNIHNHFLK 653
Cdd:cd03228   1 IEFKNVSFSYP----GRPKPVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLL-LRLydPTSGEILIDGVDLRDLDLESLR 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 654 RNIlSVSEQECCIFNRTIYENLIyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyq 733
Cdd:cd03228  76 KNI-AYVPQDPFLFSGTIRENIL--------------------------------------------------------- 97
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 734 knkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkqfinsmph 813
Cdd:cd03228     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 814 nihsniqynnmSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDKIII 893
Cdd:cd03228  98 -----------SGGQRQRIAIARALLRDPPILILDEATSALDPETEALILEALRALAKGKTVIVIAHRLSTIRDADRIIV 166

                ....*
gi 23615541 894 LDDGK 898
Cdd:cd03228 167 LDDGR 171
type_I_sec_LssB TIGR03375
type I secretion system ATPase, LssB family; Type I protein secretion is a system in some ...
572-908 2.16e-29

type I secretion system ATPase, LssB family; Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]


Pssm-ID: 274550 [Multi-domain]  Cd Length: 694  Bit Score: 124.98  E-value: 2.16e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   572 IKGSIRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtCNFsY---EGNIFIDNLNIKNIH 648
Cdd:TIGR03375 460 LQGEIEFRNVSFAYP----GQETPALDNVSLTIRPGEKVAIIGRIGSGKSTLLKLL-LGL-YqptEGSVLLDGVDIRQID 533
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   649 NHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPgnnihkkilnniqstkyn 728
Cdd:TIGR03375 534 PADLRRNIGYVP-QDPRLFYGTLRDNIALG------------------------------AP------------------ 564
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   729 sqcyqknkhnitsnfitqsyrtqdedphnisnhkHIDntsrniyqnyytdflnsyDEYKLNIINSSinvlceelDLKQFI 808
Cdd:TIGR03375 565 ----------------------------------YAD------------------DEEILRAAELA--------GVTEFV 584
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   809 NSMP----HNIHSNIQynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGN----IHKLHKlidlLIPNKTIIYITH 880
Cdd:TIGR03375 585 RRHPdgldMQIGERGR--SLSGGQRQAVALARALLRDPPILLLDEPTSAMDNRSeerfKDRLKR----WLAGKTLVLVTH 658
                         330       340
                  ....*....|....*....|....*...
gi 23615541   881 SIHILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR03375 659 RTSLLDLVDRIIVMDNGRIVADGPKDQV 686
PRK11176 PRK11176
lipid transporter ATP-binding/permease protein; Provisional
567-908 3.13e-26

lipid transporter ATP-binding/permease protein; Provisional


Pssm-ID: 183016 [Multi-domain]  Cd Length: 582  Bit Score: 114.35  E-value: 3.13e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  567 YIPNNIKGSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIK 645
Cdd:PRK11176 333 RVIERAKGDIEFRNVTFTY----PGKEVPALRNINFKIPAGKTVALVGRSGSGKSTIANLLTRFYDiDEGEILLDGHDLR 408
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  646 NIHNHFLKRNILSVSeQECCIFNRTIyenliyglvplyiknnnnnnnnnyyyqylskcifqnmnpGNNIhkkilnniqst 725
Cdd:PRK11176 409 DYTLASLRNQVALVS-QNVHLFNDTI---------------------------------------ANNI----------- 437
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  726 kynsqCYQKNKHnitsnfitqsYRTQDedphnisnhkhIDNTSRNIYQnyytdflnsydeyklniinssinvlceeldlK 805
Cdd:PRK11176 438 -----AYARTEQ----------YSREQ-----------IEEAARMAYA-------------------------------M 460
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  806 QFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIH 883
Cdd:PRK11176 461 DFINKMDNGLDTVIGENgvLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS 540
                        330       340
                 ....*....|....*....|....*
gi 23615541  884 ILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:PRK11176 541 TIEKADEILVVEDGEIVERGTHAEL 565
ABC_tran pfam00005
ABC transporter; ABC transporters for a large family of proteins responsible for translocation ...
597-685 2.55e-16

ABC transporter; ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains.


Pssm-ID: 333758 [Multi-domain]  Cd Length: 150  Bit Score: 76.53  E-value: 2.55e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   597 LKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIHNHFLKRNIlSVSEQECCIFNR-TIYEN 674
Cdd:pfam00005   1 LKNVSLTLNPGEIVALVGPNGAGKSTLLKLISGLLSpTEGTILLDGQDLTDDERKSLRKEI-GYVFQDPQLFPRlTVREN 79
                          90
                  ....*....|.
gi 23615541   675 LIYGLVPLYIK 685
Cdd:pfam00005  80 LRLGLRLKGLS 90
 
Name Accession Description Interval E-value
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
168-918 1.01e-46

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 176.47  E-value: 1.01e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 168 FIKNYFVDRN-IIKTIIFYFPYFICGGIASYMRIYFTNQCIKNIEIRLKKQVHDKILMNNEEEFKEYKTSDYLVnctfiE 246
Cdd:COG1132  40 IIDALLADLGeLLELLLLLLLLALLGGVLRALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDKAKSGDLIS-----R 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 247 IKYSAKELITCITQTFRYMN----SVVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRIKIETTTMEEKQIARF 322
Cdd:COG1132 115 LTNDVEAVSNLVSTVLVLVFtsilLLIGSLVLLFSLSWRLALILLLILPLLALVLSLLARKSRKLSRRVREALGELNARL 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 323 SDSLQKKNIISLFGNESYEHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLVSF 402
Cdd:COG1132 195 LESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLLSSLGTVLVLALGGFLVLSGSLTVGALAAF 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 403 IVYSTMLGLGVGGMLKLKKDINLLQISLQKIYEILDLtksetqtdinnyeqgKLTIQDKQVNlsknkqsgnsmgkykpdn 482
Cdd:COG1132 275 ILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDE---------------EPEVEDPPDP------------------ 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 483 dddnkednkedskdynkddnkddnndnnndnnndnnndnnndnnndnnndnnndnnndhhndhnndnnnvvmnelpfkyp 562
Cdd:COG1132     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 563 hksnyiPNNIKGSIRFENVSFSYNhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDN 641
Cdd:COG1132 322 ------LKDTIGSIEFENVSFSYP-----GKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDpTSGEILIDG 390
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 642 LNIKNIHNHFLkRNILSVSEQECCIFNRTIYENLIYGLVplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnn 721
Cdd:COG1132 391 IDIRDISLDSL-RKRIGIVSQDPLLFSGTIRENIALGRP----------------------------------------- 428
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 722 iqstkynsqcyqknkhnitsnfitqsYRTQDEdphnisnhkhidntsrniyqnyytdflnsydeyklniinssINVLCEE 801
Cdd:COG1132 429 --------------------------DATDEE-----------------------------------------IEEALKL 441
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 802 LDLKQFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYIT 879
Cdd:COG1132 442 ANAHEFIANLPDGYDTIVGERgvNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIA 521
                       730       740       750       760
                ....*....|....*....|....*....|....*....|
gi 23615541 880 HSIHILNKMDKIIILDDGKIRAIGTYEQ-IKNDTLFRDIF 918
Cdd:COG1132 522 HRLSTIKNADRIIVLDNGRIVERGTHEElLAKGGLYARLY 561
SunT COG2274
ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase ...
553-908 2.59e-36

ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms];


Pssm-ID: 225183 [Multi-domain]  Cd Length: 709  Bit Score: 146.99  E-value: 2.59e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 553 VMNELPFKYPHKSNYIPNNIKGSIRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLT-CNF 631
Cdd:COG2274 449 ILDTPPEQEGDKTLIHLPKLQGEIEFENVSFRYG----PDDPPVLEDLSLEIPPGEKVAIVGRSGSGKSTLLKLLLgLYK 524
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 632 SYEGNIFIDNLNIKNIHNHFLKRNIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpg 711
Cdd:COG2274 525 PQQGRILLDGVDLNDIDLASLRRQV-GYVLQDPFLFSGSIRENIALG--------------------------------- 570
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 712 nnihkkilnniqstkynsqcyqknkhnitsnfitqsyrtqdedphnisnhkHIDNTSRNIYQNyytdflnsydeyklnii 791
Cdd:COG2274 571 ---------------------------------------------------NPEATDEEIIEA----------------- 582
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 792 nssinvlCEELDLKQFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLL 869
Cdd:COG2274 583 -------AQLAGAHEFIENLPMGYDTPVGEGgaNLSGGQRQRLALARALLSKPKILLLDEATSALDPETEAIILQNLLQI 655
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 23615541 870 IPNKTIIYITHSIHILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:COG2274 656 LQGRTVIIIAHRLSTIRSADRIIVLDQGKIVEQGSHEEL 694
ABCC_MRP_Like cd03228
ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP ...
576-898 7.70e-36

ATP-binding cassette domain of multidrug resistance protein-like transporters; The MRP (Multidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213195 [Multi-domain]  Cd Length: 171  Bit Score: 133.28  E-value: 7.70e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtCNF--SYEGNIFIDNLNIKNIHNHFLK 653
Cdd:cd03228   1 IEFKNVSFSYP----GRPKPVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLL-LRLydPTSGEILIDGVDLRDLDLESLR 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 654 RNIlSVSEQECCIFNRTIYENLIyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyq 733
Cdd:cd03228  76 KNI-AYVPQDPFLFSGTIRENIL--------------------------------------------------------- 97
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 734 knkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkqfinsmph 813
Cdd:cd03228     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 814 nihsniqynnmSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDKIII 893
Cdd:cd03228  98 -----------SGGQRQRIAIARALLRDPPILILDEATSALDPETEALILEALRALAKGKTVIVIAHRLSTIRDADRIIV 166

                ....*
gi 23615541 894 LDDGK 898
Cdd:cd03228 167 LDDGR 171
ABCC_Glucan_exporter_like cd03254
ATP-binding cassette domain of glucan transporter and related proteins, subfamily C; Glucan ...
574-907 1.33e-35

ATP-binding cassette domain of glucan transporter and related proteins, subfamily C; Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virulence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213221 [Multi-domain]  Cd Length: 229  Bit Score: 134.66  E-value: 1.33e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 574 GSIRFENVSFSYNHydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtCNFsYE---GNIFIDNLNIKNIhNH 650
Cdd:cd03254   1 GEIEFENVNFSYDE-----KKPVLKDINFSIKPGETVAIVGPTGAGKTTLINLL-MRF-YDpqkGQILIDGIDIRDI-SR 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 651 FLKRNILSVSEQECCIFNRTIYENLIYglvplyiknnnnnnnnnyyyqylskcifqnmnpGNNIhkkilnniqstkynsq 730
Cdd:cd03254  73 KSLRSMIGVVLQDTFLFSGTIMENIRL---------------------------------GRPN---------------- 103
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 731 cyqknkhnitsnfitqsyrTQDEDphnisnhkhidntsrniyqnyytdflnsydeyklniinssINVLCEELDLKQFINS 810
Cdd:cd03254 104 -------------------ATDEE----------------------------------------VIEAAKEAGAHDFIMK 124
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 811 MPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKM 888
Cdd:cd03254 125 LPNGYDTVLgeNGGNLSQGERQLLAIARAMLRDPKILILDEATSNIDTETEKLIQEALEKLMKGRTSIIIAHRLSTIKNA 204
                       330
                ....*....|....*....
gi 23615541 889 DKIIILDDGKIRAIGTYEQ 907
Cdd:cd03254 205 DKILVLDDGKIIEEGTHDE 223
ABCC_MsbA cd03251
ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; ...
576-907 1.57e-35

ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213218 [Multi-domain]  Cd Length: 234  Bit Score: 134.67  E-value: 1.57e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSY-EGNIFIDNLNIKNIHNHFLKR 654
Cdd:cd03251   1 VEFKNVTFRYP----GDGPPVLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVdSGRILIDGHDVRDYTLASLRR 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqk 734
Cdd:cd03251  77 QIGLVS-QDVFLFNDTVAENIAYG-------------------------------------------------------- 99
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nKHNITSNFITQSYRTQdedphnisnHKHidntsrniyqnyytdflnsydeyklniinssinvlceeldlkQFINSMPHN 814
Cdd:cd03251 100 -RPGATREEVEEAARAA---------NAH------------------------------------------EFIMELPEG 127
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 IHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDKII 892
Cdd:cd03251 128 YDTVIGERgvKLSGGQRQRIAIARALLKDPPILILDEATSALDTESERLVQAALERLMKNRTTFVIAHRLSTIENADRIV 207
                       330
                ....*....|....*
gi 23615541 893 ILDDGKIRAIGTYEQ 907
Cdd:cd03251 208 VLEDGKIVERGTHEE 222
ABCC_ATM1_transporter cd03253
ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC ...
576-919 1.86e-35

ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C; ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213220 [Multi-domain]  Cd Length: 236  Bit Score: 134.67  E-value: 1.86e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhyDKERKksVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtcnFSY----EGNIFIDNLNIKNIHNHF 651
Cdd:cd03253   1 IEFENVTFAY---DPGRP--VLKDVSFTIPAGKKVAIVGPSGSGKSTILRLL---FRFydvsSGSILIDGQDIREVTLDS 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 652 LKRNIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPGNNihkkilnniqstkynsqc 731
Cdd:cd03253  73 LRRAI-GVVPQDTVLFNDTIGYNIRYG------------------------------RPDAT------------------ 103
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 732 yqknkhnitsnfitqsyrtqDEDphnisnhkhidntsrniyqnyytdflnsydeyklnIINSsinvlCEELDLKQFINSM 811
Cdd:cd03253 104 --------------------DEE-----------------------------------VIEA-----AKAAQIHDKIMRF 123
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 812 PHnihsniQYNNM--------SSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIH 883
Cdd:cd03253 124 PD------GYDTIvgerglklSGGEKQRVAIARAILKNPPILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHRLS 197
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 23615541 884 ILNKMDKIIILDDGKIRAIGTYEQ-IKNDTLFRDIFS 919
Cdd:cd03253 198 TIVNADKIIVLKDGRIVERGTHEElLAKGGLYAEMWK 234
ABCC_MRP_domain2 cd03244
ATP-binding cassette domain 2 of multidrug resistance-associated protein; The ABC subfamily C ...
574-904 2.16e-30

ATP-binding cassette domain 2 of multidrug resistance-associated protein; The ABC subfamily C is also known as MRP (multidrug resistance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213211 [Multi-domain]  Cd Length: 221  Bit Score: 119.52  E-value: 2.16e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 574 GSIRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKST----LWKLLTCnfsYEGNIFIDNLNIKNIHN 649
Cdd:cd03244   1 GDIEFKNVSLRYR----PNLPPVLKNISFSIKPGEKVGIVGRTGSGKSSlllaLFRLVEL---SSGSILIDGVDISKIGL 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 650 HFLkRNILSVSEQECCIFNRTIYENLiyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkyns 729
Cdd:cd03244  74 HDL-RSRISIIPQDPVLFSGTIRSNL------------------------------------------------------ 98
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 730 qcyqknkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytDFLNSYDEYKLniinssINVLcEELDLKQFIN 809
Cdd:cd03244  99 ------------------------------------------------DPFGEYSDEEL------WQAL-ERVGLKEFVE 123
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 810 SMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNK 887
Cdd:cd03244 124 SLPGGLDTVVEEGgeNLSVGQRQLLCLARALLRKSKILVLDEATASVDPETDALIQKTIREAFKDCTVLTIAHRLDTIID 203
                       330
                ....*....|....*..
gi 23615541 888 MDKIIILDDGKIRAIGT 904
Cdd:cd03244 204 SDRILVLDKGRVVEFDS 220
type_I_sec_LssB TIGR03375
type I secretion system ATPase, LssB family; Type I protein secretion is a system in some ...
572-908 2.16e-29

type I secretion system ATPase, LssB family; Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]


Pssm-ID: 274550 [Multi-domain]  Cd Length: 694  Bit Score: 124.98  E-value: 2.16e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   572 IKGSIRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtCNFsY---EGNIFIDNLNIKNIH 648
Cdd:TIGR03375 460 LQGEIEFRNVSFAYP----GQETPALDNVSLTIRPGEKVAIIGRIGSGKSTLLKLL-LGL-YqptEGSVLLDGVDIRQID 533
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   649 NHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPgnnihkkilnniqstkyn 728
Cdd:TIGR03375 534 PADLRRNIGYVP-QDPRLFYGTLRDNIALG------------------------------AP------------------ 564
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   729 sqcyqknkhnitsnfitqsyrtqdedphnisnhkHIDntsrniyqnyytdflnsyDEYKLNIINSSinvlceelDLKQFI 808
Cdd:TIGR03375 565 ----------------------------------YAD------------------DEEILRAAELA--------GVTEFV 584
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   809 NSMP----HNIHSNIQynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGN----IHKLHKlidlLIPNKTIIYITH 880
Cdd:TIGR03375 585 RRHPdgldMQIGERGR--SLSGGQRQAVALARALLRDPPILLLDEPTSAMDNRSeerfKDRLKR----WLAGKTLVLVTH 658
                         330       340
                  ....*....|....*....|....*...
gi 23615541   881 SIHILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR03375 659 RTSLLDLVDRIIVMDNGRIVADGPKDQV 686
MsbA_lipidA TIGR02203
lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide ...
569-908 2.71e-29

lipid A export permease/ATP-binding protein MsbA; This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other]


Pssm-ID: 131258 [Multi-domain]  Cd Length: 571  Bit Score: 123.67  E-value: 2.71e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   569 PNNIKGSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYE-GNIFIDNLNIKNI 647
Cdd:TIGR02203 324 IERARGDVEFRNVTFRY----PGRDRPALDSISLVIEPGETVALVGRSGSGKSTLVNLIPRFYEPDsGQILLDGHDLADY 399
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   648 HNHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstky 727
Cdd:TIGR02203 400 TLASLRRQVALVS-QDVVLFNDTIANNIAYG------------------------------------------------- 429
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   728 nsqcyqknkhnitsnfitqsyRTQDEDPHNIsnhkhidntsRNIYQNYYtdflnsydeyklniinssinvlceeldLKQF 807
Cdd:TIGR02203 430 ---------------------RTEQADRAEI----------ERALAAAY---------------------------AQDF 451
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   808 INSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHIL 885
Cdd:TIGR02203 452 VDKLPLGLDTPIGENgvLLSGGQRQRLAIARALLKDAPILILDEATSALDNESERLVQAALERLMQGRTTLVIAHRLSTI 531
                         330       340
                  ....*....|....*....|...
gi 23615541   886 NKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR02203 532 EKADRIVVMDDGRIVERGTHNEL 554
ABC_MTABC3_MDL1_MDL2 cd03249
ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 ...
576-915 2.98e-29

ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.


Pssm-ID: 213216 [Multi-domain]  Cd Length: 238  Bit Score: 116.87  E-value: 2.98e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydKERKK-SVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTcNFsY---EGNIFIDNLNIKNIHNHF 651
Cdd:cd03249   1 IEFKNVSFRY----PSRPDvPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLE-RF-YdptSGEILLDGVDIRDLNLRW 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 652 LKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkiLNNIQSTKYNSQC 731
Cdd:cd03249  75 LRSQIGLVS-QEPVLFDGTIAENIRYG----------------------------------------KPDATDEEVEEAA 113
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 732 YQKNKHNitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkqFINSM 811
Cdd:cd03249 114 KKANIHD--------------------------------------------------------------------FIMSL 125
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 812 PHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMD 889
Cdd:cd03249 126 PDGYDTLVgeRGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAESEKLVQEALDRAMKGRTTIVIAHRLSTIRNAD 205
                       330       340
                ....*....|....*....|....*..
gi 23615541 890 KIIILDDGKIRAIGTYEQ-IKNDTLFR 915
Cdd:cd03249 206 LIAVLQNGQVVEQGTHDElMAQKGVYA 232
CydD COG4988
ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease ...
568-919 3.31e-28

ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion, Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227321 [Multi-domain]  Cd Length: 559  Bit Score: 120.44  E-value: 3.31e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 568 IPNNIKGSIRFENVSFSYnhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTcNF--SYEGNIFIDNLNIK 645
Cdd:COG4988 313 VANEPPIEISLENLSFRY-----PDGKPALSDLNLTIKAGQLTALVGASGAGKSTLLNLLL-GFlaPTQGEIRVNGIDLR 386
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 646 NIHNHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqst 725
Cdd:COG4988 387 DLSPEAWRKQISWVS-QNPYLFAGTIRENILLA----------------------------------------------- 418
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 726 kynsqcyqknkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyKLNIINSSINVLCEELDLK 805
Cdd:COG4988 419 -------------------------------------------------------------RPDASDEEIIAALDQAGLL 437
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 806 QFINSmPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIH 883
Cdd:COG4988 438 EFVPK-PDGLDTVIgeGGAGLSGGQAQRLALARALLSPASLLLLDEPTAHLDAETEQIILQALQELAKQKTVLVITHRLE 516
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 23615541 884 ILNKMDKIIILDDGKIRAIGTYEQI-KNDTLFRDIFS 919
Cdd:COG4988 517 DAADADRIVVLDNGRLVEQGTHEELsEKQGLYANLLK 553
ABCC_bacteriocin_exporters cd03245
ATP-binding cassette domain of bacteriocin exporters, subfamily C; Many non-lantibiotic ...
574-903 4.00e-28

ATP-binding cassette domain of bacteriocin exporters, subfamily C; Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.


Pssm-ID: 213212 [Multi-domain]  Cd Length: 220  Bit Score: 113.07  E-value: 4.00e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 574 GSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIHNHFL 652
Cdd:cd03245   1 GRIEFRNVSFSY----PNQEIPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGLYKpTSGSVLLDGTDIRQLDPADL 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 653 KRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcy 732
Cdd:cd03245  77 RRNIGYVP-QDVTLFYGTLRDNITLG------------------------------------------------------ 101
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 733 qknkhnitsnfitqsyrtqdedphnisnHKHIDntsrniyqnyytdflnsyDEYKLNIINSSinvlceelDLKQFINSMP 812
Cdd:cd03245 102 ----------------------------APLAD------------------DERILRAAELA--------GVTDFVNKHP 127
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 813 HNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDK 890
Cdd:cd03245 128 NGLDLQIGERgrGLSGGQRQAVALARALLNDPPILLLDEPTSAMDMNSEERLKERLRQLLGDKTLIIITHRPSLLDLVDR 207
                       330
                ....*....|...
gi 23615541 891 IIILDDGKIRAIG 903
Cdd:cd03245 208 IIVMDSGRIVADG 220
ABC_cobalt_CbiO_domain1 cd03225
First domain of the ATP-binding cassette component of cobalt transport system; Domain I of the ...
577-898 1.32e-26

First domain of the ATP-binding cassette component of cobalt transport system; Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.


Pssm-ID: 213192 [Multi-domain]  Cd Length: 211  Bit Score: 108.32  E-value: 1.32e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 577 RFENVSFSYNHydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLT-CNFSYEGNIFIDNLNIKNIHNHFLKRN 655
Cdd:cd03225   1 ELKNLSFSYPD----GARPALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNgLLGPTSGEVLVDGKDLTKLSLKELRRK 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 656 ILSV---SEQEccIFNRTIYENLIYGLVPLYIKnnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcy 732
Cdd:cd03225  77 VGLVfqnPDDQ--FFGPTVEEEVAFGLENLGLP----------------------------------------------- 107
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 733 qknkhnitsnfitqsyrtQDEdphnisnhkhidntsrniyqnyytdflnsydeyklniINSSINVLCEELDLKQFINsmp 812
Cdd:cd03225 108 ------------------EEE-------------------------------------IEERVEEALELVGLEGLRD--- 129
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 813 HNIHSniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLI-PNKTIIYITHSIH-ILNKMDK 890
Cdd:cd03225 130 RSPFT------LSGGQKQRVAIAGVLAMDPDILLLDEPTAGLDPAGRRELLELLKKLKaEGKTIIIVTHDLDlLLELADR 203

                ....*...
gi 23615541 891 IIILDDGK 898
Cdd:cd03225 204 VIVLEDGK 211
PRK11176 PRK11176
lipid transporter ATP-binding/permease protein; Provisional
567-908 3.13e-26

lipid transporter ATP-binding/permease protein; Provisional


Pssm-ID: 183016 [Multi-domain]  Cd Length: 582  Bit Score: 114.35  E-value: 3.13e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  567 YIPNNIKGSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIK 645
Cdd:PRK11176 333 RVIERAKGDIEFRNVTFTY----PGKEVPALRNINFKIPAGKTVALVGRSGSGKSTIANLLTRFYDiDEGEILLDGHDLR 408
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  646 NIHNHFLKRNILSVSeQECCIFNRTIyenliyglvplyiknnnnnnnnnyyyqylskcifqnmnpGNNIhkkilnniqst 725
Cdd:PRK11176 409 DYTLASLRNQVALVS-QNVHLFNDTI---------------------------------------ANNI----------- 437
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  726 kynsqCYQKNKHnitsnfitqsYRTQDedphnisnhkhIDNTSRNIYQnyytdflnsydeyklniinssinvlceeldlK 805
Cdd:PRK11176 438 -----AYARTEQ----------YSREQ-----------IEEAARMAYA-------------------------------M 460
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  806 QFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIH 883
Cdd:PRK11176 461 DFINKMDNGLDTVIGENgvLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS 540
                        330       340
                 ....*....|....*....|....*
gi 23615541  884 ILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:PRK11176 541 TIEKADEILVVEDGEIVERGTHAEL 565
CydC COG4987
ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease ...
553-907 7.86e-26

ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion, Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227320 [Multi-domain]  Cd Length: 573  Bit Score: 113.19  E-value: 7.86e-26
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 553 VMNELPFKYPHKSNYIPNNIkgSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS 632
Cdd:COG4987 316 ILDQKPEVTFPDEQTATTGQ--ALELRNVSFTY----PGQQTKALKNFNLTLAQGEKVAILGRSGSGKSTLLQLLAGAWD 389
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 633 YE-GNIFIDNLNIKNIHNHFLkRNILSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpg 711
Cdd:COG4987 390 PQqGSITLNGVEIASLDEQAL-RETISVLTQRVHLFSGTLRDNLRLA--------------------------------- 435
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 712 nnihkkilnniqstkynsqcyqknKHNITsnfitqsyrtqDEDphnisnhkhidntsrniyqnyytdflnsydeyklnii 791
Cdd:COG4987 436 ------------------------NPDAS-----------DEE------------------------------------- 443
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 792 nssINVLCEELDLKQFINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLL 869
Cdd:COG4987 444 ---LWAALQQVGLEKLLESAPDGLNTWLGEGgrRLSGGERRRLALARALLHDAPLWLLDEPTEGLDPITERQVLALLFEH 520
                       330       340       350
                ....*....|....*....|....*....|....*...
gi 23615541 870 IPNKTIIYITHSIHILNKMDKIIILDDGKIRAIGTYEQ 907
Cdd:COG4987 521 AEGKTLLMVTHRLRGLERMDRIIVLDNGKIIEEGTHAE 558
3a01208 TIGR00958
Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]
562-912 8.61e-26

Conjugate Transporter-2 (CT2) Family protein; [Transport and binding proteins, Other]


Pssm-ID: 273363 [Multi-domain]  Cd Length: 711  Bit Score: 113.66  E-value: 8.61e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   562 PHKSNYIPNNIKGSIRFENVSFSY-NHYDKErkksVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTcNFsYE---GNI 637
Cdd:TIGR00958 465 PLTGTLAPLNLEGLIEFQDVSFSYpNRPDVP----VLKGLTFTLHPGEVVALVGPSGSGKSTVAALLQ-NL-YQptgGQV 538
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   638 FIDNLNIKNIHNHFLKRNILSVSeQECCIFNRTIYENLIYGLVplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkk 717
Cdd:TIGR00958 539 LLDGVPLVQYDHHYLHRQVALVG-QEPVLFSGSVRENIAYGLT------------------------------------- 580
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   718 ilnniqstkynsqcyqknkhnitsnfitqsyRTQDEDPHNISNHKHIDNtsrniyqnyytdflnsydeyklniinssinv 797
Cdd:TIGR00958 581 -------------------------------DTPDEEIMAAAKAANAHD------------------------------- 598
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   798 lceeldlkqFINSMPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLliPNKTI 875
Cdd:TIGR00958 599 ---------FIMEFPNGYDTEVgeKGSQLSGGQKQRIAIARALVRKPRVLILDEATSALDAECEQLLQESRSR--ASRTV 667
                         330       340       350
                  ....*....|....*....|....*....|....*..
gi 23615541   876 IYITHSIHILNKMDKIIILDDGKIRAIGTYEQIKNDT 912
Cdd:TIGR00958 668 LLIAHRLSTVERADQILVLKKGSVVEMGTHKQLMEDQ 704
ECF_ATPase_1 TIGR04520
energy-coupling factor transporter ATPase; Members of this family are ATP-binding cassette ...
576-908 5.05e-24

energy-coupling factor transporter ATPase; Members of this family are ATP-binding cassette (ABC) proteins by homology, but belong to energy coupling factor (ECF) transport systems. The architecture in general is two ATPase subunits (or a double-length fusion protein), a T component, and a substrate capture (S) component that is highly variable, and may be interchangeable in genomes with only one T component. This model identifies many but not examples of the upstream member of the pair of ECF ATPases in Firmicutes and Mollicutes. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 275313 [Multi-domain]  Cd Length: 268  Bit Score: 102.51  E-value: 5.05e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   576 IRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtcN---FSYEGNIFIDNLNIKNIHN-HF 651
Cdd:TIGR04520   1 IEVENVSFSY----PESEKPALKNVSLSIEKGEFVAIIGHNGSGKSTLAKLL--NgllLPTSGKVTVDGLDTLDEENlWE 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   652 LKRNIlsvseqeccifnrtiyenliyGLVplyiknnnnnnnnnyyyqylskciFQnmNPGNnihkkilnniQstkynsqc 731
Cdd:TIGR04520  75 IRKKV---------------------GMV------------------------FQ--NPDN----------Q-------- 89
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   732 yqknkhnitsnFITqsyRTQDED----PHNisnhkhidntsRNIyqnyytdflnSYDEYKlNIINSSInvlcEELDLKQF 807
Cdd:TIGR04520  90 -----------FVG---ATVEDDvafgLEN-----------LGV----------PREEMR-KRVDEAL----KLVGMEDF 129
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   808 INSMPHnihsniqynNMSSGQKQRLSI--IRSLMKDtpIYIFDEITSFLD-EG------NIHKLHKLidlliPNKTIIYI 878
Cdd:TIGR04520 130 RDREPH---------LLSGGQKQRVAIagVLAMRPD--IIILDEATSMLDpKGrkevleTIRKLNKE-----EGITVISI 193
                         330       340       350
                  ....*....|....*....|....*....|
gi 23615541   879 THSIHILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR04520 194 THDMEEAVLADRVIVMNKGKIVAEGTPREI 223
CcmA COG1131
ABC-type multidrug transport system, ATPase component [Defense mechanisms];
576-920 3.27e-23

ABC-type multidrug transport system, ATPase component [Defense mechanisms];


Pssm-ID: 224054 [Multi-domain]  Cd Length: 293  Bit Score: 100.84  E-value: 3.27e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIHNHFlKR 654
Cdd:COG1131   5 IEVRNLTKKYG-----GDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKpTSGEILVLGYDVVKEPAKV-RR 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIYENLIYglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqk 734
Cdd:COG1131  79 RIGYVPQEPSLYPELTVRENLEF--------------------------------------------------------- 101
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqdedphnisnhkhidntsrniYQNYYTDFLNSYDEYklniinssINVLCEELDLKQFINSMPhn 814
Cdd:COG1131 102 -------------------------------------FARLYGLSKEEAEER--------IEELLELFGLEDKANKKV-- 134
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 ihsniqyNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLL--IPNKTIIYITHSIHILNKM-DKI 891
Cdd:COG1131 135 -------RTLSGGMKQRLSIALALLHDPELLILDEPTSGLDPESRREIWELLRELakEGGVTILLSTHILEEAEELcDRV 207
                       330       340
                ....*....|....*....|....*....
gi 23615541 892 IILDDGKIRAIGTYEQIKNDTLFRDIFSL 920
Cdd:COG1131 208 IILNDGKIIAEGTPEELKEKFGGKGVIEL 236
bacteriocin_ABC TIGR01193
ABC-type bacteriocin transporter; This model describes ABC-type bacteriocin transporter. The ...
570-908 5.13e-23

ABC-type bacteriocin transporter; This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair, Transport and binding proteins, Other]


Pssm-ID: 130261 [Multi-domain]  Cd Length: 708  Bit Score: 104.82  E-value: 5.13e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   570 NNIKGSIRFENVSFSYNHYDKerkksVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYE-GNIFIDNLNIKNIH 648
Cdd:TIGR01193 468 NNLNGDIVINDVSYSYGYGSN-----ILSDISLTIKMNSKTTIVGMSGSGKSTLAKLLVGFFQARsGEILLNGFSLKDID 542
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   649 NHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkyn 728
Cdd:TIGR01193 543 RHTLRQFINYLP-QEPYIFSGSILENLLLG-------------------------------------------------- 571
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   729 sqcyqkNKHNITSNFITQSyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlCEELDLKQFI 808
Cdd:TIGR01193 572 ------AKENVSQDEIWAA---------------------------------------------------CEIAEIKDDI 594
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   809 NSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDegnIHKLHKLIDLLIP--NKTIIYITHSIHI 884
Cdd:TIGR01193 595 ENMPLGYQTELSEEgsSISGGQKQRIALARALLTDSKVLILDESTSNLD---TITEKKIVNNLLNlqDKTIIFVAHRLSV 671
                         330       340
                  ....*....|....*....|....
gi 23615541   885 LNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR01193 672 AKQSDKIIVLDHGKIIEQGSHDEL 695
PRK13657 PRK13657
cyclic beta-1,2-glucan ABC transporter; Provisional
569-908 7.37e-23

cyclic beta-1,2-glucan ABC transporter; Provisional


Pssm-ID: 184214 [Multi-domain]  Cd Length: 588  Bit Score: 103.89  E-value: 7.37e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  569 PNNIKGSIRFENVSFSYNHydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNI 647
Cdd:PRK13657 328 LGRVKGAVEFDDVSFSYDN-----SRQGVEDVSFEAKPGQTVAIVGPTGAGKSTLINLLQRVFDpQSGRILIDGTDIRTV 402
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  648 HNHFLKRNIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstky 727
Cdd:PRK13657 403 TRASLRRNI-AVVFQDAGLFNRSIEDNIRVG------------------------------------------------- 432
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  728 nsqcyqknKHNITsnfitqsyrtqDEDphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvLCEELDLKQ- 806
Cdd:PRK13657 433 --------RPDAT-----------DEE-------------------------------------------MRAAAERAQa 450
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  807 --FINSMPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSI 882
Cdd:PRK13657 451 hdFIERKPDGYDTVVgeRGRQLSGGERQRLAIARALLKDPPILILDEATSALDVETEAKVKAALDELMKGRTTFIIAHRL 530
                        330       340
                 ....*....|....*....|....*.
gi 23615541  883 HILNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:PRK13657 531 STVRNADRILVFDNGRVVESGSFDEL 556
ABC_MJ0796_LolCDE_FtsE cd03255
ATP-binding cassette domain of the transporters involved in export of lipoprotein and ...
576-899 8.95e-23

ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.


Pssm-ID: 213222 [Multi-domain]  Cd Length: 218  Bit Score: 97.18  E-value: 8.95e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNHydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTC-NFSYEGNIFIDNLNIKNIHN----H 650
Cdd:cd03255   1 IELKNLSKTYGG--GGEKVQALKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGGlDRPTSGEVRVDGTDISKLSEkelaA 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 651 FLKRNILSVSEQecciFN----RTIYENLiygLVPLYIKNNnnnnnnnyyyqylskcifqnmnPGNNIHKKILNniqstk 726
Cdd:cd03255  79 FRRRHIGFVFQS----FNllpdLTALENV---ELPLLLAGV----------------------PKKERRERAEE------ 123
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 727 ynsqcyqknkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvLCEELDLKQ 806
Cdd:cd03255 124 -----------------------------------------------------------------------LLERVGLGD 132
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 807 FINSMPHnihsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGN-------IHKLHKLIdllipNKTIIYIT 879
Cdd:cd03255 133 RLNHYPS---------ELSGGQQQRVAIARALANDPKIILADEPTGNLDSETgkevmelLRELNKEA-----GTTIVVVT 198
                       330       340
                ....*....|....*....|
gi 23615541 880 HSIHILNKMDKIIILDDGKI 899
Cdd:cd03255 199 HDPELAEYADRIIELRDGKI 218
FepC COG1120
ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component [Inorganic ion ...
575-920 1.68e-22

ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component [Inorganic ion transport and metabolism, Coenzyme transport and metabolism];


Pssm-ID: 224045 [Multi-domain]  Cd Length: 258  Bit Score: 97.63  E-value: 1.68e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 575 SIRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSY-EGNIFIDNLNIKNIHNHFLK 653
Cdd:COG1120   2 MLEVENLSFGYG------GKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPkSGEVLLDGKDIASLSPKELA 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 654 RNILSVSEQECCIFNRTIYENLIYGLVPlyiknnnnnnnnnyyyqylskcifqnmnpgnniHKKILnniqstkynsqcyq 733
Cdd:COG1120  76 KKLAYVPQSPSAPFGLTVYELVLLGRYP---------------------------------HLGLF-------------- 108
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 734 knkhnitsnfitQSYRTQDEDphnisnhkhidntsrniyqnyytdflnsydeyklnIINSSInvlcEELDLKQFINSmph 813
Cdd:COG1120 109 ------------GRPSKEDEE-----------------------------------IVEEAL----ELLGLEHLADR--- 134
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 814 nihsniQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNihkLHKLIDLLI-----PNKTIIYITHSI-HILNK 887
Cdd:COG1120 135 ------PVDELSGGERQRVLIARALAQETPILLLDEPTSHLDIAH---QIEVLELLRdlnreKGLTVVMVLHDLnLAARY 205
                       330       340       350
                ....*....|....*....|....*....|...
gi 23615541 888 MDKIIILDDGKIRAIGTYEQIKNDTLFRDIFSL 920
Cdd:COG1120 206 ADHLILLKDGKIVAQGTPEEVLTEENLREVYGV 238
LolD COG1136
ABC-type lipoprotein export system, ATPase component [Cell wall/membrane/envelope biogenesis];
576-899 1.84e-22

ABC-type lipoprotein export system, ATPase component [Cell wall/membrane/envelope biogenesis];


Pssm-ID: 224059 [Multi-domain]  Cd Length: 226  Bit Score: 96.81  E-value: 1.84e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhYDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIhnhflkr 654
Cdd:COG1136   2 IELKNVSKIY--GLGGEKVEALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLDKpTSGEVLINGKDLTKL------- 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 nilsvSEQEccifnRTIYENLIYGLvplyiknnnnnnnnnyyyqylskcIFQNMnpgnnihkkilnniqstkynsqcyqk 734
Cdd:COG1136  73 -----SEKE-----LAKLRRKKIGF------------------------VFQNF-------------------------- 92
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsNFItqSYRTQDEdphNISNHKHIDNTSRniyqnyytdflnsyDEYKLNIINssinvLCEELDLKQFINSmpHN 814
Cdd:COG1136  93 -------NLL--PDLTVLE---NVELPLLIAGKSA--------------GRRKRAAEE-----LLEVLGLEDRLLK--KK 139
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 IHsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLI--PNKTIIYITHSIHILNKMDKII 892
Cdd:COG1136 140 PS------ELSGGQQQRVAIARALINNPKIILADEPTGNLDSKTAKEVLELLRELNkeRGKTIIMVTHDPELAKYADRVI 213

                ....*..
gi 23615541 893 ILDDGKI 899
Cdd:COG1136 214 ELKDGKI 220
PRK11160 PRK11160
cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
560-907 2.60e-22

cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed


Pssm-ID: 236865 [Multi-domain]  Cd Length: 574  Bit Score: 102.21  E-value: 2.60e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  560 KYPHKSNyiPNNIKGSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIF 638
Cdd:PRK11160 325 TFPTTST--AAADQVSLTLNNVSFTY----PDQPQPVLKGLSLQIKAGEKVALLGRTGCGKSTLLQLLTRAWDpQQGEIL 398
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  639 IDNLNIKNIHNHFLkRNILSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkki 718
Cdd:PRK11160 399 LNGQPIADYSEAAL-RQAISVVSQRVHLFSATLRDNLLLA---------------------------------------- 437
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  719 lnniqstkynsqcyqknKHNITsnfitqsyrtqDEDPHNISN----HKHIDNTSRniyqnyytdflnsydeyklniinss 794
Cdd:PRK11160 438 -----------------APNAS-----------DEALIEVLQqvglEKLLEDDKG------------------------- 464
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  795 invlceeLDL------KQfinsmphnihsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDL 868
Cdd:PRK11160 465 -------LNAwlgeggRQ-----------------LSGGEQRRLGIARALLHDAPLLLLDEPTEGLDAETERQILELLAE 520
                        330       340       350
                 ....*....|....*....|....*....|....*....
gi 23615541  869 LIPNKTIIYITHSIHILNKMDKIIILDDGKIRAIGTYEQ 907
Cdd:PRK11160 521 HAQNKTVLMITHRLTGLEQFDRICVMDNGQIIEQGTHQE 559
type_I_sec_HlyB TIGR01846
type I secretion system ABC transporter, HlyB family; Type I protein secretion is a system in ...
571-908 2.91e-22

type I secretion system ABC transporter, HlyB family; Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. [Protein fate, Protein and peptide secretion and trafficking]


Pssm-ID: 273831 [Multi-domain]  Cd Length: 694  Bit Score: 102.51  E-value: 2.91e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   571 NIKGSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYE-GNIFIDNLNIKNIHN 649
Cdd:TIGR01846 451 ELRGAITFENIRFRY----APDSPEVLSNLNLDIKPGEFIGIVGPSGSGKSTLTKLLQRLYTPQhGQVLVDGVDLAIADP 526
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   650 HFLKRNIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPGNNIHKKIlnniqstkyns 729
Cdd:TIGR01846 527 AWLRRQM-GVVLQENVLFSRSIRDNIALC------------------------------NPGAPFEHVI----------- 564
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   730 qcyqknkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinsSINVLCEELDlkqFIN 809
Cdd:TIGR01846 565 ----------------------------------------------------------------HAAKLAGAHD---FIS 577
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   810 SMPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNK 887
Cdd:TIGR01846 578 ELPQGYNTEVgeKGANLSGGQRQRIAIARALVGNPRILIFDEATSALDYESEALIMRNMREICRGRTVIIIAHRLSTVRA 657
                         330       340
                  ....*....|....*....|.
gi 23615541   888 MDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR01846 658 CDRIIVLEKGQIAESGRHEEL 678
ABCC_Hemolysin cd03252
ATP-binding cassette domain of hemolysin B, subfamily C; The ABC-transporter hemolysin B is a ...
576-908 4.40e-21

ATP-binding cassette domain of hemolysin B, subfamily C; The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.


Pssm-ID: 213219 [Multi-domain]  Cd Length: 237  Bit Score: 92.93  E-value: 4.40e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYE-GNIFIDNLNIKNIHNHFLKR 654
Cdd:cd03252   1 ITFEHVRFRY----KPDGPVILDNISLRIKPGEVVGIVGRSGSGKSTLTKLIQRFYVPEnGRVLVDGHDLALADPAWLRR 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPGNNIHKKIlnniqstkynsqcyqk 734
Cdd:cd03252  77 QV-GVVLQENVLFNRSIRDNIALA------------------------------DPGMSMERVI---------------- 109
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsYRTQDEDPHnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkQFINSMPHN 814
Cdd:cd03252 110 -------------EAAKLAGAH-------------------------------------------------DFISELPEG 127
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 IHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLD---EGNIHK-LHKLIDllipNKTIIYITHSIHILNKM 888
Cdd:cd03252 128 YDTIVgeQGAGLSGGQRQRIAIARALIHNPRILIFDEATSALDyesEHAIMRnMHDICA----GRTVIIIAHRLSTVKNA 203
                       330       340
                ....*....|....*....|
gi 23615541 889 DKIIILDDGKIRAIGTYEQI 908
Cdd:cd03252 204 DRIIVMEKGRIVEQGSHDEL 223
ABCC_TAP cd03248
ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C; ...
569-899 6.87e-21

ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C; TAP (Transporter Associated with Antigen Processing) is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.


Pssm-ID: 213215 [Multi-domain]  Cd Length: 226  Bit Score: 92.15  E-value: 6.87e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 569 PNNIKGSIRFENVSFSY-NHYDKErkksVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTcNFsYE---GNIFIDNLNI 644
Cdd:cd03248   5 PDHLKGIVKFQNVTFAYpTRPDTL----VLQDVSFTLHPGEVTALVGPSGSGKSTVVALLE-NF-YQpqgGQVLLDGKPI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 645 KNIHNHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqyLSKCIFqnmnpgnnihkkilnniQS 724
Cdd:cd03248  79 SQYEHKYLHSKVSLVG-QEPVLFARSLQDNIAYG---------------------LQSCSF-----------------EC 119
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 725 TKYNSQCYqknkhnitsnfitqsyrtqdedphnisnHKHidntsrniyqnyytdflnsydeyklniinssinvlceeldl 804
Cdd:cd03248 120 VKEAAQKA----------------------------HAH----------------------------------------- 130
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 805 kQFINSMPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSI 882
Cdd:cd03248 131 -SFISELASGYDTEVgeKGSQLSGGQKQRVAIARALIRNPQVLILDEATSALDAESEQQVQQALYDWPERRTVLVIAHRL 209
                       330
                ....*....|....*..
gi 23615541 883 HILNKMDKIIILDDGKI 899
Cdd:cd03248 210 STVERADQILVLDGGRI 226
ABCC_cytochrome_bd cd03247
ATP-binding cassette domain of CydCD, subfamily C; The CYD subfamily implicated in cytochrome ...
576-903 1.01e-20

ATP-binding cassette domain of CydCD, subfamily C; The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilis, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.


Pssm-ID: 213214 [Multi-domain]  Cd Length: 178  Bit Score: 90.06  E-value: 1.01e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNF-SYEGNIFIDNLNIKNIHNhfLKR 654
Cdd:cd03247   1 LSINNVSFSY----PEQEQQVLKNLSLELKQGEKIALLGRSGSGKSTLLQLLTGDLkPQQGEITLDGVPVSDLEK--ALS 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIYENLiyGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqk 734
Cdd:cd03247  75 SLISVLNQRPYLFDTTLRNNL--G-------------------------------------------------------- 96
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlKQFinsmphn 814
Cdd:cd03247  97 ----------------------------------------------------------------------RRF------- 99
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 ihsniqynnmSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDKIIIL 894
Cdd:cd03247 100 ----------SGGERQRLALARILLQDAPIVLLDEPTVGLDPITERQLLSLIFEVLKDKTLIWITHHLTGIEHMDKILFL 169

                ....*....
gi 23615541 895 DDGKIRAIG 903
Cdd:cd03247 170 ENGKIIMQG 178
EcfA2 COG1122
Energy-coupling factor transporter ATP-binding protein EcfA2 [Inorganic ion transport and ...
576-911 1.31e-20

Energy-coupling factor transporter ATP-binding protein EcfA2 [Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 224047 [Multi-domain]  Cd Length: 235  Bit Score: 91.55  E-value: 1.31e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTC-NFSYEGNIFIDNLNIKNIHN-HFLK 653
Cdd:COG1122   4 IEAENLSFRY-----PGRKAALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGlLKPTSGEVLVDGLDTSSEKSlLELR 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 654 RNILSV----SEQeccIFNRTIYENLIYGLVplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkyns 729
Cdd:COG1122  79 QKVGLVfqnpDDQ---LFGPTVEDEVAFGLE------------------------------------------------- 106
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 730 qcyqknkhnitsnfitqsyrtqdedphnisNHKHIDntsrniyqnyytdflnsyDEyklniINSSINVLCEELDLKQFIN 809
Cdd:COG1122 107 ------------------------------NLGLPR------------------EE-----IEERVAEALELVGLEELLD 133
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 810 SMPHNihsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIP--NKTIIYITHSIHILNK 887
Cdd:COG1122 134 RPPFN---------LSGGQKQRVAIAGVLAMGPEILLLDEPTAGLDPKGRRELLELLKKLKEegGKTIIIVTHDLELVLE 204
                       330       340
                ....*....|....*....|....*
gi 23615541 888 -MDKIIILDDGKIRAIGTYEQIKND 911
Cdd:COG1122 205 yADRVVVLDDGKILADGDPAEIFND 229
ABC_6TM_ABCB10_like cd18573
Six-transmembrane helical domain (6-TMD) of the mitochondrial transporter ABCB10 (subfamily B, ...
189-416 1.39e-20

Six-transmembrane helical domain (6-TMD) of the mitochondrial transporter ABCB10 (subfamily B, member 10) and similar proteins; This group includes the 6-TM subunit of the ABC10 (also known as ABC mitochondrial erythroid, ABC-me, mABC2, or ABCBA), which is one of the three ATP-binding cassette (ABC) transporters found in the inner membrane of mitochondria, with the nucleotide-binding domains (NBDs) inside the mitochondrial matrix. In mammals, ABCB10 is essential for erythropoiesis and for protection of mitochondria against oxidative stress. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane.


Pssm-ID: 350017 [Multi-domain]  Cd Length: 294  Bit Score: 92.96  E-value: 1.39e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 189 FICGGIASYMRIYftnqCIK----NIEIRLKKQVHDKILMNNEEEFKEYKTSDyLVN-----CTFIeikysAKELITCIT 259
Cdd:cd18573  51 FVVGAAANFGRVY----LLRiageRIVARLRKRLFKSILRQDAAFFDKNKTGE-LVSrlssdTSVV-----GKSLTQNLS 120
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 260 QTFRYMNSVVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRI--KIETTTMEEKQIA--RFSdslqkkNI--IS 333
Cdd:cd18573 121 DGLRSLVSGVGGIGMMLYISPKLTLVMLLVVPPIAVGAVFYGRYVRKLskQVQDALADATKVAeeRLS------NIrtVR 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 334 LFGNESYEHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLVSFIVYSTMLGLGV 413
Cdd:cd18573 195 AFAAERKEVERYAKKVDEVFDLAKKEALASGLFFGSTGFSGNLSLLSVLYYGGSLVASGELTVGDLTSFLMYAVYVGSSV 274

                ...
gi 23615541 414 GGM 416
Cdd:cd18573 275 SGL 277
ABC_NikE_OppD_transporters cd03257
ATP-binding cassette domain of nickel/oligopeptides specific transporters; The ABC transporter ...
576-903 1.82e-20

ATP-binding cassette domain of nickel/oligopeptides specific transporters; The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.


Pssm-ID: 213224 [Multi-domain]  Cd Length: 228  Bit Score: 91.03  E-value: 1.82e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNHYDKERKksVLKNINLEIKASEKVAIIGKSGSGKSTLWK-LLTCNFSYEGNIFIDNlniknihnhflkR 654
Cdd:cd03257   2 LEVKNLSVSFPTGGGSVK--ALDDVSFSIKKGETLGLVGESGSGKSTLARaILGLLKPTSGSIIFDG------------K 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIyenliyglvplyiknnnnnnnnnyyyQYlskcIFQN----MNPGNNIhkkilnniqstkynsq 730
Cdd:cd03257  68 DLLKLSRRLRKIRRKEI--------------------------QM----VFQDpmssLNPRMTI---------------- 101
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 731 cyqknkhnitsnfitqsyRTQDEDPhnISNHKHidntsrniyqnyytdflNSYDEYKLNIInssINVLCEELDLKQFINS 810
Cdd:cd03257 102 ------------------GEQIAEP--LRIHGK-----------------LSKKEARKEAV---LLLLVGVGLPEEVLNR 141
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 811 MPHNihsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLD---EGNIHKL-HKLIDLLipNKTIIYITHSIHILN 886
Cdd:cd03257 142 YPHE---------LSGGQRQRVAIARALALNPKLLIADEPTSALDvsvQAQILDLlKKLQEEL--GLTLLFITHDLGVVA 210
                       330
                ....*....|....*...
gi 23615541 887 KM-DKIIILDDGKIRAIG 903
Cdd:cd03257 211 KIaDRVAVMYAGKIVEEG 228
ABCC_MRP_domain1 cd03250
ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C; This ...
576-898 1.86e-20

ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C; This subfamily is also known as MRP (multidrug resistance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213217 [Multi-domain]  Cd Length: 204  Bit Score: 90.22  E-value: 1.86e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNHyDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIdnlniknihnhflKR 654
Cdd:cd03250   1 ISVEDASFTWDS-GEQETSFTLKDINLEVPKGELVAIVGPVGSGKSSLLSALLGELEkLSGSVSV-------------PG 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSeQECCIFNRTIYENLIyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqk 734
Cdd:cd03250  67 SIAYVS-QEPWIQNGTIRENIL---------------------------------------------------------- 87
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdFLNSYDEYKLNiinSSINVLCEELDLKQfinsMPHN 814
Cdd:cd03250  88 --------------------------------------------FGKPFDEERYE---KVIKACALEPDLEI----LPDG 116
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 IHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDegnIHKLHKLID-----LLIPNKTIIYITHSIHILNK 887
Cdd:cd03250 117 DLTEIGEKgiNLSGGQKQRISLARAVYSDADIYLLDDPLSAVD---AHVGRHIFEncilgLLLNNKTRILVTHQLQLLPH 193
                       330
                ....*....|.
gi 23615541 888 MDKIIILDDGK 898
Cdd:cd03250 194 ADQIVVLDNGR 204
ATM1 COG5265
ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components ...
567-919 2.66e-20

ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227590 [Multi-domain]  Cd Length: 497  Bit Score: 95.12  E-value: 2.66e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 567 YIPNNIKGSIRFENVSFSYNHYdkerkKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtcnFSY----EGNIFIDNL 642
Cdd:COG5265 254 PLWPVRLGAVAFINVSFAYDPR-----RPILNGISFTIPLGKTVAIVGESGAGKSTILRLL---FRFydvnSGSITIDGQ 325
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 643 NIKNIHNHFLKRNIlSVSEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnNI 722
Cdd:COG5265 326 DIRDVTQQSLRRAI-GIVPQDTVLFNDTIAYNIKYG------------------------------------------RP 362
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 723 QSTkynsqcyqknkhnitsnfitqsyrtqDEDPHNISNHKHIdntsrniyqnyytdflnsydeyklniinssinvlceel 802
Cdd:COG5265 363 DAT--------------------------AEEVGAAAEAAQI-------------------------------------- 378
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 803 dlKQFINSMPHNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITH 880
Cdd:COG5265 379 --HDFIQSLPEGYDTGVgeRGLKLSGGEKQRVAIARTILKNPPILILDEATSALDTHTEQAIQAALREVSAGRTTLVIAH 456
                       330       340       350       360
                ....*....|....*....|....*....|....*....|
gi 23615541 881 SIHILNKMDKIIILDDGKIRAIGTYEQ-IKNDTLFRDIFS 919
Cdd:COG5265 457 RLSTIIDADEIIVLDNGRIVERGTHEElLAAGGLYAEMWR 496
MsbA_rel TIGR02204
ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ...
568-908 6.13e-20

ABC transporter, permease/ATP-binding protein; This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.


Pssm-ID: 131259 [Multi-domain]  Cd Length: 576  Bit Score: 94.77  E-value: 6.13e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   568 IPNNIKGSIRFENVSFsynHYDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKN 646
Cdd:TIGR02204 330 LPVPLRGEIEFEQVNF---AYPARPDQPALDGLNLTVRPGETVALVGPSGAGKSTLFQLLLRFYDpQSGRILLDGVDLRQ 406
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   647 IHNHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmNPgnnihkkilnniqstk 726
Cdd:TIGR02204 407 LDPAELRARMALVP-QDPVLFAASVMENIRYG------------------------------RP---------------- 439
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   727 ynsqcyqknkhnitsnfitqsyrtqdedphnisnhkhiDNTSRNIYQnyytdflnsydeyklniinssinvLCEELDLKQ 806
Cdd:TIGR02204 440 --------------------------------------DATDEEVEA------------------------AARAAHAHE 457
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   807 FINSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHI 884
Cdd:TIGR02204 458 FISALPEGYDTYLGERgvTLSGGQRQRIAIARAILKDAPILLLDEATSALDAESEQLVQQALETLMKGRTTLIIAHRLAT 537
                         330       340
                  ....*....|....*....|....
gi 23615541   885 LNKMDKIIILDDGKIRAIGTYEQI 908
Cdd:TIGR02204 538 VLKADRIVVMDQGRIVAQGTHAEL 561
OpuBA COG1125
ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and ...
576-910 1.61e-19

ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism];


Pssm-ID: 224050 [Multi-domain]  Cd Length: 309  Bit Score: 90.05  E-value: 1.61e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNHydkerkKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSY-EGNIFIDNLNIKNIHNHFLKR 654
Cdd:COG1125   2 IEFENVSKRYGN------KKAVDDVNLTIEEGEFLVLIGPSGSGKTTTLKMINRLIEPtSGEILIDGEDISDLDPVELRR 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIYENLiyGLVPLYIKNnnnnnnnnyyyqylskcifqnmnPGNNIHKKIlnniqstkynsqcyqk 734
Cdd:COG1125  76 KIGYVIQQIGLFPHLTVAENI--ATVPKLLGW-----------------------DKERIKKRA---------------- 114
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqDEdphnisnhkhidntsrniyqnyytdFLNSYDeyklniinssinvlceeLDLKQFINSMPHn 814
Cdd:COG1125 115 -----------------DE-------------------------LLDLVG-----------------LDPSEYADRYPH- 134
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 ihsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGN-------IHKLHKLIdllipNKTIIYITHSIHILNK 887
Cdd:COG1125 135 --------ELSGGQQQRVGVARALAADPPILLMDEPFGALDPITrkqlqeeIKELQKEL-----GKTIVFVTHDIDEALK 201
                       330       340
                ....*....|....*....|....
gi 23615541 888 M-DKIIILDDGKIRAIGTYEQIKN 910
Cdd:COG1125 202 LaDRIAVMDAGEIVQYDTPDEILA 225
cbiO PRK13632
cobalt transporter ATP-binding subunit; Provisional
570-923 4.88e-19

cobalt transporter ATP-binding subunit; Provisional


Pssm-ID: 237452 [Multi-domain]  Cd Length: 271  Bit Score: 87.74  E-value: 4.88e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  570 NNIKGSIRFENVSFSYNhydkERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIkNIH 648
Cdd:PRK13632   2 KNKSVMIKVENVSFSYP----NSENNALKNVSFEINEGEYVAILGHNGSGKSTISKILTGLLKpQSGEIKIDGITI-SKE 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  649 NHFLKRNILSVseqeccifnrtiyenliyglvplyiknnnnnnnnnyyyqylskcIFQNmnPGNNihkkilnniqstkyn 728
Cdd:PRK13632  77 NLKEIRKKIGI--------------------------------------------IFQN--PDNQ--------------- 95
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  729 sqcyqknkhnitsnFITQSyrTQDEDPHNISNHKhidntsrniyqnyytdflnsydeYKLNIINSSINVLCEELDLKQFI 808
Cdd:PRK13632  96 --------------FIGAT--VEDDIAFGLENKK-----------------------VPPKKMKDIIDDLAKKVGMEDYL 136
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  809 NSMPHNihsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLL--IPNKTIIYITHSIHILN 886
Cdd:PRK13632 137 DKEPQN---------LSGGQKQRVAIASVLALNPEIIIFDESTSMLDPKGKREIKKIMVDLrkTRKKTLISITHDMDEAI 207
                        330       340       350
                 ....*....|....*....|....*....|....*..
gi 23615541  887 KMDKIIILDDGKIRAIGTYEQIKNDTLFRDIFSLHKP 923
Cdd:PRK13632 208 LADKVIVFSEGKLIAQGKPKEILNNKEILEKAKIDSP 244
ABC_ATPase cd00267
ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large ...
577-898 2.13e-18

ATP-binding cassette transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213179 [Multi-domain]  Cd Length: 157  Bit Score: 82.68  E-value: 2.13e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 577 RFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTC-NFSYEGNIFIDNLNIKNIHNHFLKRN 655
Cdd:cd00267   1 EIENLSFRYG------GRTALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGlLKPTSGEILIDGKDIAKLPLEELRRR 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 656 Ilsvseqeccifnrtiyenliyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqkn 735
Cdd:cd00267  75 I------------------------------------------------------------------------------- 75
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 736 khnitsnfitqSYRTQdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkqfinsmphni 815
Cdd:cd00267  76 -----------GYVPQ---------------------------------------------------------------- 80
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 816 hsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLI-DLLIPNKTIIYITHSI-HILNKMDKIII 893
Cdd:cd00267  81 --------LSGGQRQRVALARALLLNPDLLLLDEPTSGLDPASRERLLELLrELAEEGRTVIIVTHDPeLAELAADRVIV 152

                ....*
gi 23615541 894 LDDGK 898
Cdd:cd00267 153 LKDGK 157
chvA TIGR01192
glucan exporter ATP-binding protein; This model describes glucan exporter ATP binding protein ...
571-910 4.01e-18

glucan exporter ATP-binding protein; This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 130260 [Multi-domain]  Cd Length: 585  Bit Score: 88.79  E-value: 4.01e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   571 NIKGSIRFENVSFSYNHydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtcNFSYE---GNIFIDNLNIKNI 647
Cdd:TIGR01192 330 NVKGAVEFRHITFEFAN-----SSQGVFDVSFEAKAGQTVAIVGPTGAGKTTLINLL--QRVYDptvGQILIDGIDINTV 402
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   648 HNHFLKRNILSVSeQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniQSTKY 727
Cdd:TIGR01192 403 TRESLRKSIATVF-QDAGLFNRSIRENIRLG--------------------------------------------REGAT 437
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   728 NSQCYQKNKHNITSNFItqsyrtqdedphnisnhkhidntsrniyqnyyTDFLNSYDeyklniinssiNVLCEeldlkqf 807
Cdd:TIGR01192 438 DEEVYEAAKAAAAHDFI--------------------------------LKRSNGYD-----------TLVGE------- 467
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   808 insmphnihsniQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNK 887
Cdd:TIGR01192 468 ------------RGNRLSGGERQRLAIARAILKNAPILVLDEATSALDVETEARVKNAIDALRKNRTTFIIAHRLSTVRN 535
                         330       340
                  ....*....|....*....|...
gi 23615541   888 MDKIIILDDGKIRAIGTYEQIKN 910
Cdd:TIGR01192 536 ADLVLFLDQGRLIEKGSFQELIQ 558
ABC_MetN_methionine_transporter cd03258
ATP-binding cassette domain of methionine transporter; MetN (also known as YusC) is an ...
576-908 8.19e-18

ATP-binding cassette domain of methionine transporter; MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213225 [Multi-domain]  Cd Length: 233  Bit Score: 83.40  E-value: 8.19e-18
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhYDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSY-EGNIFIDNlniknihnhflkR 654
Cdd:cd03258   2 IELKNVSKVF--GDTGGKVTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLERPtSGSVLVDG------------T 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIyenliyGLvplyiknnnnnnnnnyyyqylskcIFQNMNpgnnihkkILNniqstkynsqcyqk 734
Cdd:cd03258  68 DLTLLSGKELRKARRRI------GM------------------------IFQHFN--------LLS-------------- 95
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqdedphnisnhkhidntSRNIYQNYytdflnsydEYKLNI-------INSSINVLCEELDLKQF 807
Cdd:cd03258  96 ---------------------------------SRTVFENV---------ALPLEIagvpkaeIEERVLELLELVGLEDK 133
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 808 INSMPhnihsniqyNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGN-------IHKLHKLIDLlipnkTIIYITH 880
Cdd:cd03258 134 ADAYP---------AQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETtqsilalLRDINRELGL-----TIVLITH 199
                       330       340
                ....*....|....*....|....*....
gi 23615541 881 SIHILNKM-DKIIILDDGKIRAIGTYEQI 908
Cdd:cd03258 200 EMEVVKRIcDRVAVMEKGEVVEEGTVEEV 228
ABC_Org_Solvent_Resistant cd03261
ATP-binding cassette transport system involved in resistant to organic solvents; ABC ...
576-912 1.75e-17

ATP-binding cassette transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213228 [Multi-domain]  Cd Length: 235  Bit Score: 82.55  E-value: 1.75e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWK----LLTCNfsyEGNIFIDNlniknihnhf 651
Cdd:cd03261   1 IELRGLTKSF------GGRTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRlivgLLRPD---SGEVLIDG---------- 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 652 lkRNILSVSEQECCIFNRTIyenliyGLVplyiknnnnnnnnnyyyqylskciFQnmnpgnnihkkilnniqstkynsqc 731
Cdd:cd03261  62 --EDISGLSEAELYRLRRRM------GML------------------------FQ------------------------- 84
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 732 yqknkhnitSN--FitqsyrtqdedphnisnhkhidnTSRNIYQNyyTDF-LNSYDEYKLNIINSSINVLCEELDLKQFI 808
Cdd:cd03261  85 ---------SGalF-----------------------DSLTVFEN--VAFpLREHTRLSEEEIREIVLEKLEAVGLRGAE 130
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 809 NSMPHNIhsniqynnmSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLL--IPNKTIIYITHSIHILN 886
Cdd:cd03261 131 DLYPAEL---------SGGMKKRVALARALALDPELLLYDEPTAGLDPIASGVIDDLIRSLkkELGLTSIMVTHDLDTAF 201
                       330       340
                ....*....|....*....|....*..
gi 23615541 887 KM-DKIIILDDGKIRAIGTYEQIKNDT 912
Cdd:cd03261 202 AIaDRIAVLYDGKIVAEGTPEELRASD 228
GlnQ COG1126
ABC-type polar amino acid transport system, ATPase component [Amino acid transport and ...
576-908 3.50e-17

ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism];


Pssm-ID: 224051 [Multi-domain]  Cd Length: 240  Bit Score: 81.79  E-value: 3.50e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTlwkLLTC-NFSYE---GNIFIDNLNIKNIHNHF 651
Cdd:COG1126   3 IEIKNLSKSFG------DKEVLKGISLSVEKGEVVVIIGPSGSGKST---LLRClNGLEEpdsGSITVDGEDVGDKKDIL 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 652 -LKRNILSVSEQecciFN----RTIYENLIYGLVplyiknnnnnnnnnyYYQYLSKcifqnmnpgnnihkkilnniqstk 726
Cdd:COG1126  74 kLRRKVGMVFQQ----FNlfphLTVLENVTLAPV---------------KVKKLSK------------------------ 110
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 727 ynSQCYQKNKHnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvLCEELDLKQ 806
Cdd:COG1126 111 --AEAREKALE------------------------------------------------------------LLEKVGLAD 128
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 807 FINSMPHnihsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHK-LHKLIDLLIPNKTIIYITHSIHIL 885
Cdd:COG1126 129 KADAYPA---------QLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEvLDVMKDLAEEGMTMIIVTHEMGFA 199
                       330       340
                ....*....|....*....|....
gi 23615541 886 NKM-DKIIILDDGKIRAIGTYEQI 908
Cdd:COG1126 200 REVaDRVIFMDQGKIIEEGPPEEF 223
ABC_6TM_TAP_ABCB8_10_like cd18557
Six-transmembrane helical domain (6-TMD) of the ABC transporter TAP, ABCB8 and ABCB10; This ...
189-417 9.92e-17

Six-transmembrane helical domain (6-TMD) of the ABC transporter TAP, ABCB8 and ABCB10; This group includes ABC transporter associated with antigen processing (TAP), which is essential to cellular immunity against viral infection, as well as ABCB8 and ABCB10, which are found in the inner membrane of mitochondria, with the nucleotide-binding domains (NBDs) inside the mitochondrial matrix. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum(ER) for association with MHC class I molecules, which play a central role in the adaptive immune response to viruses and cancers by presenting antigenic peptides to CD8+ cytotoxic T lymphocytes (CTLs). Mammalian ABCB10 is essential for erythropoiesis and for protection of mitochondria against oxidative stress, while ABCB8 is essential for normal cardiac function, maintenance of mitochondrial iron homeostasis and maturation of cytosolic Fe/S proteins.


Pssm-ID: 350001 [Multi-domain]  Cd Length: 289  Bit Score: 81.45  E-value: 9.92e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 189 FICGGIASYMRIYFTNQCIKNIEIRLKKQVHDKILMNNEEEFKEYKTSDyLVNCTFIEIKySAKELITC-ITQTFRYMNS 267
Cdd:cd18557  46 YLLQSVFTFVRYYLFNIAGERIVARLRRDLFSSLLRQEIAFFDKHKTGE-LTSRLSSDTS-VLQSAVTDnLSQLLRNILQ 123
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 268 VVGGLISMSCISLYLTKLCLFIIPIYGLSVLCLLKSLKRIkieTTTMEEKQ-----IArfSDSLQkkNI--ISLFGNESY 340
Cdd:cd18557 124 VIGGLIILFILSWKLTLVLLLVIPLLLIASKIYGRYIRKL---SKEVQDALakagqVA--EESLS--NIrtVRSFSAEEK 196
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 23615541 341 EHRYFCKQLHVLNNLYDKYITCESIFYSFLNIGTNVVICTILCLGRLELTTQHITHGQLVSFIVYSTMLGLGVGGML 417
Cdd:cd18557 197 EIRRYSEALDRSYRLARKKALANALFQGITSLLIYLSLLLVLWYGGYLVLSGQLTVGELTSFILYTIMVASSVGGLS 273
ABC_tran pfam00005
ABC transporter; ABC transporters for a large family of proteins responsible for translocation ...
597-685 2.55e-16

ABC transporter; ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains.


Pssm-ID: 333758 [Multi-domain]  Cd Length: 150  Bit Score: 76.53  E-value: 2.55e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   597 LKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIHNHFLKRNIlSVSEQECCIFNR-TIYEN 674
Cdd:pfam00005   1 LKNVSLTLNPGEIVALVGPNGAGKSTLLKLISGLLSpTEGTILLDGQDLTDDERKSLRKEI-GYVFQDPQLFPRlTVREN 79
                          90
                  ....*....|.
gi 23615541   675 LIYGLVPLYIK 685
Cdd:pfam00005  80 LRLGLRLKGLS 90
DppF COG1124
ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid ...
579-910 5.57e-16

ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism, Inorganic ion transport and metabolism];


Pssm-ID: 224049 [Multi-domain]  Cd Length: 252  Bit Score: 78.46  E-value: 5.57e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 579 ENVSFSYNHydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLT-CNFSYEGNIFIDNlNIKNIHNHFLKRnil 657
Cdd:COG1124   7 RNLSIVYGG--GKFAFHALNNVSLEIERGETLGIVGESGSGKSTLARLLAgLEKPSSGSILLDG-KPLAPKKRAKAF--- 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 658 svseqeccifnrtiyenliYGLVPLyiknnnnnnnnnyyyqylskcIFQN----MNPGNNIhKKILNniqstkynsqcyq 733
Cdd:COG1124  81 -------------------YRPVQM---------------------VFQDpyssLNPRRTV-GRILS------------- 106
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 734 knkhnitsnfitqsyrtqdeDPHNIsnhKHIDNTSRNIYQnyytdflnsydeyklniinssinvLCEELDL-KQFINSMP 812
Cdd:COG1124 107 --------------------EPLRP---HGLSKSQQRIAE------------------------LLDQVGLpPSFLDRRP 139
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 813 HNihsniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDegnIHKLHKLIDLLIPNK-----TIIYITHSIHILNK 887
Cdd:COG1124 140 HE---------LSGGQRQRIAIARALIPEPKLLILDEPTSALD---VSVQAQILNLLLELKkerglTYLFISHDLALVEH 207
                       330       340
                ....*....|....*....|....
gi 23615541 888 M-DKIIILDDGKIRAIGTYEQIKN 910
Cdd:COG1124 208 McDRIAVMDNGQIVEIGPTEELLS 231
ABC_PstB_phosphate_transporter cd03260
ATP-binding cassette domain of the phosphate transport system; Phosphate uptake is of ...
576-908 6.36e-16

ATP-binding cassette domain of the phosphate transport system; Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. PstA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).


Pssm-ID: 213227 [Multi-domain]  Cd Length: 227  Bit Score: 77.61  E-value: 6.36e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLL------TCNFSYEGNIFIDNLNIKNIHN 649
Cdd:cd03260   1 IELRDLNVYYG------DKHALKDISLDIPKGEITALIGPSGCGKSTLLRLLnrlndlIPGAPDEGEVLLDGKDIYDLDV 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 650 HF--LKRNILSVSeQECCIFNRTIYENLIYGLvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkKIlnniqstky 727
Cdd:cd03260  75 DVleLRRRVGMVF-QKPNPFPGSIYDNVAYGL-------------------------------------RL--------- 107
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 728 nsqcyqknkhnitsnfitqsyrtqdedpHNISNHKHIDNTSRniyqnyytdflnsydeyklniinssinVLCEELDLkqf 807
Cdd:cd03260 108 ----------------------------HGIKLKEELDERVE---------------------------EALRKAAL--- 129
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 808 insmPHNIHSNIQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNK 887
Cdd:cd03260 130 ----WDEVKDRLHALGLSGGQQQRLCLARALANEPEVLLLDEPTSALDPISTAKIEELIAELKKEYTIVIVTHNMQQAAR 205
                       330       340
                ....*....|....*....|..
gi 23615541 888 M-DKIIILDDGKIRAIGTYEQI 908
Cdd:cd03260 206 VaDRTAFLLNGRLVEFGPTEQI 227
ABCC_NFT1 cd03369
ATP-binding cassette domain 2 of NFT1, subfamily C; Domain 2 of NFT1 (New full-length MRP-type ...
574-904 7.65e-16

ATP-binding cassette domain 2 of NFT1, subfamily C; Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (multidrug resistance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213269 [Multi-domain]  Cd Length: 207  Bit Score: 77.07  E-value: 7.65e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 574 GSIRFENVSFSYnhydKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLtcnFSY----EGNIFIDNLNIKNIHN 649
Cdd:cd03369   5 GEIEVENLSVRY----APDLPPVLKNVSFKVKAGEKIGIVGRTGAGKSTLILAL---FRFleaeEGKIEIDGIDISTIPL 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 650 HFLkRNILSVSEQECCIFNRTIYENLiyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkyns 729
Cdd:cd03369  78 EDL-RSSLTIIPQDPTLFSGTIRSNL------------------------------------------------------ 102
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 730 qcyqknkhnitsnfitqsyrtqdeDPhnisnhkhidntsrniyqnyytdflnsYDEYklniinsSINVLCEELDLKQfin 809
Cdd:cd03369 103 ------------------------DP---------------------------FDEY-------SDEEIYGALRVSE--- 121
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 810 smphnihsniQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMD 889
Cdd:cd03369 122 ----------GGLNLSQGQRQLLCLARALLKRPRVLVLDEATASIDYATDALIQKTIREEFTNSTILTIAHRLRTIIDYD 191
                       330
                ....*....|....*
gi 23615541 890 KIIILDDGKIRAIGT 904
Cdd:cd03369 192 KILVMDAGEVKEYDH 206
ABC_Iron-Siderophores_B12_Hemin cd03214
ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related ...
579-903 8.01e-16

ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.


Pssm-ID: 213181 [Multi-domain]  Cd Length: 180  Bit Score: 76.32  E-value: 8.01e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 579 ENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNIHNHFLKRNIl 657
Cdd:cd03214   3 ENLSVGYG------GRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLLKpSSGEILLDGKDLASLSPKELARKI- 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 658 svseqeccifnrtiyenliyGLVPlyiknnnnnnnnnyyyqylskcifQNMnpgnnihkkilnniqstkynsqcyqknkh 737
Cdd:cd03214  76 --------------------AYVP------------------------QAL----------------------------- 82
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 738 nitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlcEELDLKQFINSmphnihs 817
Cdd:cd03214  83 --------------------------------------------------------------ELLGLAHLADR------- 93
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 818 niQYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLI--PNKTIIYITHSI-HILNKMDKIIIL 894
Cdd:cd03214  94 --PFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIELLELLRRLAreRGKTVVMVLHDLnLAARYADRVILL 171

                ....*....
gi 23615541 895 DDGKIRAIG 903
Cdd:cd03214 172 KDGRIVAQG 180
PRK10790 PRK10790
putative multidrug transporter membrane\ATP-binding components; Provisional
574-908 1.34e-15

putative multidrug transporter membrane\ATP-binding components; Provisional


Pssm-ID: 182733 [Multi-domain]  Cd Length: 592  Bit Score: 80.92  E-value: 1.34e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  574 GSIRFENVSFSYNHydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSY-EGNIFIDNLNIKNIHNHFL 652
Cdd:PRK10790 339 GRIDIDNVSFAYRD-----DNLVLQNINLSVPSRGFVALVGHTGSGKSTLASLLMGYYPLtEGEIRLDGRPLSSLSHSVL 413
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  653 KRNILSVsEQECCIFNRTIYENLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcy 732
Cdd:PRK10790 414 RQGVAMV-QQDPVVLADTFLANVTLG------------------------------------------------------ 438
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  733 qknkhnitsnfitqsyrtqdedpHNISNHKhidntsrnIYQnyytdflnsydeyklniinssinVLcEELDLKQFINSMP 812
Cdd:PRK10790 439 -----------------------RDISEEQ--------VWQ-----------------------AL-ETVQLAELARSLP 463
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  813 HNIHSNI--QYNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLIPNKTIIYITHSIHILNKMDK 890
Cdd:PRK10790 464 DGLYTPLgeQGNNLSVGQKQLLALARVLVQTPQILILDEATANIDSGTEQAIQQALAAVREHTTLVVIAHRLSTIVEADT 543
                        330
                 ....*....|....*...
gi 23615541  891 IIILDDGKIRAIGTYEQI 908
Cdd:PRK10790 544 ILVLHRGQAVEQGTHQQL 561
ABC_OpuCA_Osmoprotection cd03295
ATP-binding cassette domain of the osmoprotectant transporter; OpuCA is a the ATP binding ...
576-908 2.41e-15

ATP-binding cassette domain of the osmoprotectant transporter; OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213262 [Multi-domain]  Cd Length: 242  Bit Score: 76.57  E-value: 2.41e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNHydkeRKKSVlKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNF-SYEGNIFIDNLNIKNIHNHFLKR 654
Cdd:cd03295   1 IEFENVTKRYGG----GKKAV-NNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLIePTSGEIFIDGEDIREQDPVELRR 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIYENLiyGLVPLYIKnnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcYQK 734
Cdd:cd03295  76 KIGYVIQQIGLFPHMTVEENI--ALVPKLLK----------------------------------------------WPK 107
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 NKhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniINSSINVLCEELDL--KQFINSMP 812
Cdd:cd03295 108 EK------------------------------------------------------IRERADELLALVGLdpAEFADRYP 133
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 813 HnihsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLD-------EGNIHKLHKLIdllipNKTIIYITHSIHIL 885
Cdd:cd03295 134 H---------ELSGGQQQRVGVARALAADPPLLLMDEPFGALDpitrdqlQEEFKRLQQEL-----GKTIVFVTHDIDEA 199
                       330       340
                ....*....|....*....|....
gi 23615541 886 NKM-DKIIILDDGKIRAIGTYEQI 908
Cdd:cd03295 200 FRLaDRIAIMKNGEIVQVGTPDEI 223
ModF COG1119
ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion ...
556-904 2.91e-15

ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism];


Pssm-ID: 224044 [Multi-domain]  Cd Length: 257  Bit Score: 76.58  E-value: 2.91e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 556 ELP-FKYPHKSNYIPNNiKGSIRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCN-FSY 633
Cdd:COG1119  12 ELPePKEPKKRHPIEIN-EPLIELKNVSVRRN------GKKILGDLSWQVNPGEHWAIVGPNGAGKTTLLSLLTGEhPPS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 634 EGNIFIdnlniknihnhFLKRnILSVSeqeccifnrTIYEnliyglvplyiknnnnnnnnnyyyqylskcifqnmnpgnn 713
Cdd:COG1119  85 SGDVTL-----------LGRR-FGKGE---------TIFE---------------------------------------- 103
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 714 IHKKIlnniqstkynsqcyqknkhNITSNFITQSYRTQDedphnisnhkhidnTSRN-IYQNYYTDF---LNSYDEYKLN 789
Cdd:COG1119 104 LRKRI-------------------GLVSSELHERFRVRE--------------TVRDvVLSGFFASIgiyQEDLTAEDLA 150
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 790 IINSsinvLCEELDLKQFINSmphNIHSniqynnMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHK-LIDL 868
Cdd:COG1119 151 AAQW----LLELLGAKHLADR---PFGS------LSQGEQRRVLIARALVKDPELLILDEPAQGLDLIAREQLLNrLEEL 217
                       330       340       350
                ....*....|....*....|....*....|....*....
gi 23615541 869 LIPN--KTIIYITHSIH-ILNKMDKIIILDDGKIRAIGT 904
Cdd:COG1119 218 AASPgaPALLFVTHHAEeIPPCFTHRLLLKEGEVVAQGK 256
MalK COG3839
ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism];
575-910 6.93e-15

ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism];


Pssm-ID: 226359 [Multi-domain]  Cd Length: 338  Bit Score: 76.91  E-value: 6.93e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 575 SIRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLL------TcnfsyEGNIFIDNLNIknih 648
Cdd:COG3839   3 ELELKNVRKSFG------SFEVLKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIagleepT-----SGEILIDGRDV---- 67
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 649 NHFL--KRNILSVSEQECCIFNRTIYENLIYGLvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstk 726
Cdd:COG3839  68 TDLPpeKRGIAMVFQNYALYPHMTVYENIAFGL----------------------------------------------- 100
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 727 ynsqcyqknkhnitsnfitQSYRTQDEDphnisnhkhidntsrniyqnyytdflnsydeyklniINSSINVLCEELDLKQ 806
Cdd:COG3839 101 -------------------KLRGVPKAE------------------------------------IDKRVKEVAKLLGLEH 125
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 807 FINSMPhnihsniqyNNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLD-------EGNIHKLHKLidlliPNKTIIYIT 879
Cdd:COG3839 126 LLNRKP---------LQLSGGQRQRVALARALVRKPKVFLLDEPLSNLDaklrvlmRSEIKKLHER-----LGTTTIYVT 191
                       330       340       350
                ....*....|....*....|....*....|..
gi 23615541 880 HSIHILNKM-DKIIILDDGKIRAIGTYEQIKN 910
Cdd:COG3839 192 HDQVEAMTLaDRIVVMNDGRIQQVGTPLELYE 223
PTZ00265 PTZ00265
multidrug resistance protein (mdr1); Provisional
571-896 7.39e-15

multidrug resistance protein (mdr1); Provisional


Pssm-ID: 240339 [Multi-domain]  Cd Length: 1466  Bit Score: 79.30  E-value: 7.39e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   571 NIKgSIRFENVSFsynHYDKERKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFI-DNLNIKNIH 648
Cdd:PTZ00265  379 DIK-KIQFKNVRF---HYDTRKDVEIYKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDpTEGDIIInDSHNLKDIN 454
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   649 NHFLKRNILSVSeQECCIFNRTIYENLIYGLVPLyiknnnnnnnnnYYYQYLSKCIFQNMnpgnnihkkilNNIQSTKyN 728
Cdd:PTZ00265  455 LKWWRSKIGVVS-QDPLLFSNSIKNNIKYSLYSL------------KDLEALSNYYNEDG-----------NDSQENK-N 509
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   729 SQCYQKNKHNITSNFITQSyRTQDEDPHNISNHKHIDNTsrniyqnyytdflnsydeyklNIINSSINVLceeldLKQFI 808
Cdd:PTZ00265  510 KRNSCRAKCAGDLNDMSNT-TDSNELIEMRKNYQTIKDS---------------------EVVDVSKKVL-----IHDFV 562
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541   809 NSMPHNIHSNIQYN--NMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLI--PNKTIIYITHSIHI 884
Cdd:PTZ00265  563 SALPDKYETLVGSNasKLSGGQKQRISIARAIIRNPKILILDEATSSLDNKSEYLVQKTINNLKgnENRITIIIAHRLST 642
                         330
                  ....*....|..
gi 23615541   885 LNKMDKIIILDD 896
Cdd:PTZ00265  643 IRYANTIFVLSN 654
ABC_DR_subfamily_A cd03230
ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily ...
576-899 8.65e-15

ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; This family of ATP-binding proteins belongs to a multi-subunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryotic systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.


Pssm-ID: 213197 [Multi-domain]  Cd Length: 173  Bit Score: 72.82  E-value: 8.65e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYnhydkeRKKSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFS-YEGNIFIDNLNIKNiHNHFLKR 654
Cdd:cd03230   1 IEVRNLSKRY------GKKTALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKpDSGEIKVLGKDIKK-EPEEVKR 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 655 NILSVSEQECCIFNRTIYENLIYglvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqk 734
Cdd:cd03230  74 RIGYLPEEPSLYENLTVRENLKL--------------------------------------------------------- 96
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 735 nkhnitsnfitqsyrtqdedphnisnhkhidntsrniyqnyytdflnsydeyklniinssinvlceeldlkqfinsmphn 814
Cdd:cd03230     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 815 ihsniqynnmSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLI-DLLIPNKTIIYITHSIHILNKM-DKII 892
Cdd:cd03230  97 ----------SGGMKQRLALAQALLHDPELLILDEPTSGLDPESRREFWELLrELKKEGKTILLSSHILEEAERLcDRVA 166

                ....*..
gi 23615541 893 ILDDGKI 899
Cdd:cd03230 167 ILNNGRI 173
ABC_HisP_GlnQ cd03262
ATP-binding cassette domain of the histidine and glutamine transporters; HisP and GlnQ are the ...
576-899 9.57e-15

ATP-binding cassette domain of the histidine and glutamine transporters; HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, respectively. Histidine permease is a multi-subunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryotic extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.


Pssm-ID: 213229 [Multi-domain]  Cd Length: 213  Bit Score: 74.10  E-value: 9.57e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 576 IRFENVSFSYNhydkerKKSVLKNINLEIKASEKVAIIGKSGSGKSTLwkLLTCNFSYE---GNIFIDNLNI----KNIH 648
Cdd:cd03262   1 IEIKNLHKSFG------DFHVLKGIDLTVKKGEVVVIIGPSGSGKSTL--LRCINLLEEpdsGTIIIDGLKLtddkKNIN 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 649 NhfLKRNIlsvseqeccifnrtiyenliyGLVplyiknnnnnnnnnyyyqylskciFQNMN--PgnniHKKILNniqstk 726
Cdd:cd03262  73 E--LRQKV---------------------GMV------------------------FQQFNlfP----HLTVLE------ 95
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 727 ynsqcyqknkhNITSNFITQSYRTQDEdphnisnhkhIDNTSRNiyqnyytdflnsydeyklniinssinvLCEELDLKQ 806
Cdd:cd03262  96 -----------NITLAPIKVKGMSKAE----------AEERALE---------------------------LLEKVGLAD 127
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541 807 FINSMPHnihsniqynNMSSGQKQRLSIIRSLMKDTPIYIFDEITSFLDEGNIHK-LHKLIDLLIPNKTIIYITHSIHIL 885
Cdd:cd03262 128 KADAYPA---------QLSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVGEvLDVMKDLAEEGMTMVVVTHEMGFA 198
                       330
                ....*....|....*
gi 23615541 886 NKM-DKIIILDDGKI 899
Cdd:cd03262 199 REVaDRVIFMDDGRI 213
PRK11174 PRK11174
cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
594-916 1.08e-14

cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed


Pssm-ID: 236870 [Multi-domain]  Cd Length: 588  Bit Score: 77.96  E-value: 1.08e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  594 KSVLKNINLEIKASEKVAIIGKSGSGKSTLWKLLTCNFSYEGNIFIDNLNIKNIHNHFLKRNILSVSeQECCIFNRTIYE 673
Cdd:PRK11174 363 KTLAGPLNFTLPAGQRIALVGPSGAGKTSLLNALLGFLPYQGSLKINGIELRELDPESWRKHLSWVG-QNPQLPHGTLRD 441
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  674 NLIYGlvplyiknnnnnnnnnyyyqylskcifqnmnpgnnihkkilnniqstkynsqcyqknKHNITsnfitqsyrtqDE 753
Cdd:PRK11174 442 NVLLG---------------------------------------------------------NPDAS-----------DE 453
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  754 DphnisnhkhidntsrniyqnyytdflnsydeyklniinssINVLCEELDLKQFINSMPHNIHSNIQYNN--MSSGQKQR 831
Cdd:PRK11174 454 Q----------------------------------------LQQALENAWVSEFLPLLPQGLDTPIGDQAagLSVGQAQR 493
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615541  832 LSIIRSLMKDTPIYIFDEITSFLDEGNIHKLHKLIDLLI