NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23615157|emb|CAD52145|]
View 

erythrocyte membrane protein 1, PfEMP1 [Plasmodium falciparum 3D7]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
2930-3346 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


:

Pssm-ID: 317799  Cd Length: 446  Bit Score: 724.29  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2930 TIMWSVGIGFAAISYFLLKKKPKSPV-DLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYMEGDTSGDEKYGFM 3008
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDEKYAFM 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3009 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNT-------LGDDMVPTTNTFTDEEWNELKHDFISQ 3081
Cdd:pfam15445   81 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTpsdtqndIPSDDIPSTNPITDEEWNTLKHDFISN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3082 YIQSEPLNVPQYDVLKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDD-PKYVSNNVYSGIDL 3159
Cdd:pfam15445  161 MLQNTQNDEPNILRSGNVPNNTHPNTLSrDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDiPKYVSNNVYSGIDL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3160 INDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEVLDKLK 3239
Cdd:pfam15445  241 INDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWKNKEERLDKLK 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3240 EQWNKDNDGG------DISSDSNKRLNTDVSIEIDMDDPKGKKEFSN---------MDTILDNIE-----------DDIY 3293
Cdd:pfam15445  321 EEWNKENNHSgdihpsDDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNmdtnpdnstMDTILDDLEkynepyydfyeDDIY 400
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|...
gi 23615157   3294 YDVNDENPSvndiPMDHNKVDVPKKVHVEMKIlNNtsTGSLEQQFPISDVWNI 3346
Cdd:pfam15445  401 YDVNDHDAS----TVDSNNMDVPTKVQIEMDV-NN--TKLVEEKYPISDVWNI 446
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
2370-3346 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 633.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2370 TQWKDTGKSGKHVD---VYLPPRREHICT---SNLEYLLKGNSDqimkVGNNKINHSFLGEVLLAAKYeaefikTNYTrl 2443
Cdd:PTZ00176  508 SEWNNSGVKNKENDnngVLVPPRRRNLCInlfSKKDYKMKDEND----FKEDLLNAAFSQGKLLGKKY------SNYS-- 575
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2444 ngqndNGAKcRAMKYSFADIGDIVRGRDLWehNDFKKLERDLvkifgkikegitdETTKKQYEKDDTDNKqlRCDWWEAN 2523
Cdd:PTZ00176  576 -----NEAY-EAMKFSYADYSDIVKGTDMM--NDLKKLNKEL-------------NTLLKETEKGDISVD--RKTWWDDN 632
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2524 RDQVWEAMQCK-TTIPPVTTSCDTTTVTPLVDYIPQRLRWMMEWAEWYCKYQSKAYSELRKGCEDC---RSWKCMKGDSK 2599
Cdd:PTZ00176  633 KNVVWNAMLCGyKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIvegRKHKSMVDITD 712
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2600 CEnCTKACKDYNSKIEPWKQQWTKIKEKYEELYKkaqnsdTSNSGTTYPKDEkdvvsflsklheknkdnkiyyTAAGYIH 2679
Cdd:PTZ00176  713 VE-CKRLFIDYEEWFRYRYNQWKGLSEKYIKIKK------SKNSGVNIPSEE---------------------CAASYVT 764
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2680 QQAKylDCtqqthFCDKKNGETLPSGRDNDKYAFKKPPKKyerackchekqeppppkVPEDSEDDRERSEPGEDALPVlp 2759
Cdd:PTZ00176  765 KHCN--GC-----ICNLRDMEDIHKNINNQNELMKEMINI-----------------IKFDTDQYRTQLQNISNSMEI-- 818
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2760 peeieqEEEPEETSVDTTQDEEEPASEGGGPSGSPTEESGEPREnsdssdpKPDQNpeanpeqtpiLKPEEEAPPKSKPP 2839
Cdd:PTZ00176  819 ------NPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLG-------KKIQD----------LYNEFMKPVEKKLD 875
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2840 DGDRGVGRSLGPTprsevepeesenedvededdeeeeedpdddpeaeseeededhggqeaeavppqpqapaplppppppl 2919
Cdd:PTZ00176  876 TSSKNLNIYEDPN------------------------------------------------------------------- 888
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2920 pplktalmsstIMWSVGIGFA---AISYFLLKKKPKSPVDLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYME 2996
Cdd:PTZ00176  889 -----------IMVPAGIGVAltlGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLYVE 957
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2997 GDTSgDEKYGFMSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNTLGDDMVPTTNTFTDEEWNELKH 3076
Cdd:PTZ00176  958 GDTD-EEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNTPSYKLTDEEWNQLKD 1036
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3077 DFISQYIQSEPLNVPQYDvlKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDDPKYVSNNVYS 3155
Cdd:PTZ00176 1037 DFISQYLPNTEPNNNYRS--GNSPTNTNNTTTShDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNNVYS 1114
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3156 GIDLINDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEV 3234
Cdd:PTZ00176 1115 GIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENHHER 1194
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3235 LDKLKEQWNKDNDGGDISSDsNKRLNTDVSIEIDMDDPKGKKEFSNMDT-----ILDNIEDDIYYDVND-----ENPSVN 3304
Cdd:PTZ00176 1195 LAKLKEKWENDNDGGNVPSD-NHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDndddnDQPSVY 1273
                         970       980       990      1000
                  ....*....|....*....|....*....|....*....|....
gi 23615157  3305 DIPMDHNK--VDVPKKVHVEMKILNNTSTGSLEQQFPISDVWNI 3346
Cdd:PTZ00176 1274 DIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
13-366 1.04e-105

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 372.45  E-value: 1.04e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    13 KSPSLTESHNSARGVLEEIGKKIKDKTEKESKHVRQLKGKLSNAKFADRLYKeSGGDLRSAYSDACSLTYKFHTNITTDG 92
Cdd:PTZ00176    4 KKGVINESKLSARNVLENIGNEIKDKRENESKYTDKLKGSLWEARFSDGLSS-SFGDVRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    93 GDGRHPCHGRENNRFSESQEYGCSNVYIKGNENNSNGTACVPPRRRHICDQNLEFLDNPHTDDTDDLLGNVLVTAKYEGN 172
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   173 YIVSNHPDKnsngNKSGICTSLARSFADIGDIVRGRDMFKSN--EKVEIGLKKVFEKINNGLKKIGI-NDYNDI-SGNYY 248
Cdd:PTZ00176  163 SIVNNHPDK----DKSSVCTALARSFADIGDIVRGKDMFKRNkhDNVENGLREVFKKIYEGLKNNGArEHYKEVkNGNYI 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   249 KLREAWWTANRDQVWKAITCRAPNGAnYFRK----GLDGKIIFSDNGPCGRKelIVPTYLDYVPQFLRWLNEWSEEFCRI 324
Cdd:PTZ00176  239 KLREDWWTANRDQVWKAMTCVAPENA-YFRKteadGIGISSLILPYSKCGRD--TDPPVVDYIPQRLRWMSEWSEYFCNV 315
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 23615157   325 KNIKIGNIKKSCTGESNNKHCSR--EGYDCNKTNLRLnEIFMDL 366
Cdd:PTZ00176  316 LNKEIDEMNNQCKDCEMSRRCNNdtEGEKCKKCKEQC-QIFKEL 358
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
787-1537 3.78e-66

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 248.80  E-value: 3.78e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   787 NKLEGDIFKVTFRNG-----GVGKNLNGDICKID-KTYSNDSRG-TPTDGPCEGKG-DRFkigtDWQGDSFVNP-QYRG- 856
Cdd:PTZ00176   38 DKLKGSLWEARFSDGlsssfGDVRSGYYDSCSLDhKFHTNINNGyPPARNPCDGRNqNRF----DENGESYCNSdKIRGn 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   857 -------IYMPPRRQHFCTSNLEKLdvsrVIRNGNASNSLLGDVLLAAKYEAERTKNHYVSKkeEHSEACRAVRYSFADL 929
Cdd:PTZ00176  114 ennsnagACAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESIVNNHPDK--DKSSVCTALARSFADI 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   930 GDIIRGKDMWDKNHGEKkTQENLERIFAKIKEQLLNSSIKDKYKDDDKATpkYKQLREDWWEANRSQVWEAMQC-PPKNG 1008
Cdd:PTZ00176  188 GDIVRGKDMFKRNKHDN-VENGLREVFKKIYEGLKNNGAREHYKEVKNGN--YIKLREDWWTANRDQVWKAMTCvAPENA 264
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1009 TF------------------PCKSD-HTPLHDYIPQRLRWMTEWAEWYCKEQSRLYGELVETCGKCMHKGKCKQGN--GH 1067
Cdd:PTZ00176  265 YFrkteadgigisslilpysKCGRDtDPPVVDYIPQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEMSRRCNNDTegEK 344
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1068 CVTCKPACEKYKKFINTWQPQWKQMEQKYSQLYEEAK----KYNDSS---------RKDTTNKDDYVLQFLNKLLTQNKG 1134
Cdd:PTZ00176  345 CKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAStnitKQNSSApergyrrnhRRRGYDDDTNVQLFLKKVIENNEC 424
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1135 NktYDTAEGYVHQEAHisdcqkqtqfCKKRNGEIPSSDTETDNNyAFRPQPHDHDEVCECNTRQKTKVRKKKKKVDACEM 1214
Cdd:PTZ00176  425 K--VESLGKYLDKTSH----------CGNYNFNYDNTPGSNRSN-AFEITPEKFKKACKCKIPNPLEKCPNEENKNVCTR 491
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1215 AKtllhnndgtiRIGQCKRKDEGNaEYPKWDcNSQI---HTTHNGACMPPRRQKLCVYFFanpSQIGSINKQDNLRKAFI 1291
Cdd:PTZ00176  492 FD----------KVYSCTSLSFKN-DLSEWN-NSGVknkENDNNGVLVPPRRRNLCINLF---SKKDYKMKDENDFKEDL 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1292 ISAAaetfrswqYYKSKNGGEnlqtqlKDGTIPDDFKRQMFYTYGDYRDFLFGTDISKGLGEgtaLEKQINILFPNgVRK 1371
Cdd:PTZ00176  557 LNAA--------FSQGKLLGK------KYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKK---LNKELNTLLKE-TEK 618
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1372 IPNEKTREKWWTDHGPEIWKGMLCAltnglsesekktkifddYSHDKVNQSKNGN-PSLEDFAKKPQFFRWFIEWSDEFC 1450
Cdd:PTZ00176  619 GDISVDRKTWWDDNKNVVWNAMLCG-----------------YKTENENQQLNSSwCNVPDDDNIDQFLRWLTEWAQQYC 681
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1451 RERKKKEEEVERDCKDEYEGcEKEKNGKCVT--ACKA----YKEYITNKKEEYDSQKGKFDVEKTEKKQGYEDYSEKQAS 1524
Cdd:PTZ00176  682 KEKLIKAHIINTKCKDIVEG-RKHKSMVDITdvECKRlfidYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAA 760
                         810
                  ....*....|...
gi 23615157  1525 EYLKEKCIKSSCN 1537
Cdd:PTZ00176  761 SYVTKHCNGCICN 773
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1623-1778 1.46e-39

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


:

Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 146.31  E-value: 1.46e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1623 VCIPPRRRRLYVKNLQDLTGEESL----VDLRKAFIKCAAIETFFAWHefkkekereekekneqdvQYKSsvlENLQKQL 1698
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTsnttHDLLEAVILAAKYEGFSLWH------------------KYKK---YNPQYKL 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1699 knGEIDDEFKRQMFYTFADYRDICLGKDI--------GNDVDGINEKIDTILQKNGK---------PNNIEEYKKWWQKH 1761
Cdd:pfam05424   60 --GTIPSEFCRQMAYSFADIGDIVRGKDLylgnnkkkKNKREKLEENLKKIFKKIYEkltsknkddGNYYQLREDWWEAN 137
                          170
                   ....*....|....*..
gi 23615157   1762 GHEIWEGMLCALSYNTE 1778
Cdd:pfam05424  138 REDIWKAMTCALTYGAK 154
PFEMP super family cl03834
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2087-2230 7.63e-32

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


The actual alignment was detected with superfamily member pfam03011:

Pssm-ID: 281064  Cd Length: 154  Bit Score: 122.99  E-value: 7.63e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2087 LFKRWLEHFLEDYNKINDKISHCMKNGEGSTCIKGCEIKCNCVSNWIKKKTLEWEIVRDRFFKQY------NVDSEKSFT 2160
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYklkgltGKTLDEYLD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 23615157   2161 VKSFLEQAPFDSDVQKAIKPFEKLRDFEDSIVCNG-TTSARKEKGTE-KDVVICLLDKLQKQIETCQTKHKE 2230
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGcSAGAESAKNNKnEDAIDKLLDKEEKKANNCKEKHKE 152
PFEMP super family cl03834
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
574-712 7.74e-29

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


The actual alignment was detected with superfamily member pfam03011:

Pssm-ID: 281064  Cd Length: 154  Bit Score: 114.52  E-value: 7.74e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    574 LFKRWLEYFLEDYNKLKEKLNPCMYNVQEIVCINECKQNCECVEKWIKEKREEWKKIKDRYVQQYESK-----DEDVSSK 648
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 23615157    649 LKKFLKQELFTNYVKNALDKDETLDSMKESTECIDPNKPKGKPCNN--NDVINILLNRLEKQIDNC 712
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKNNknEDAIDKLLDKEEKKANNC 146
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
1714-1977 9.99e-14

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 77.77  E-value: 9.99e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1714 TFADYRDICLGKDI--GNDVDGINEKIDTILQK-------NGKPNNIEEYKK---------WWQKHGHEIWEGMLCALSY 1775
Cdd:PTZ00176  183 SFADIGDIVRGKDMfkRNKHDNVENGLREVFKKiyeglknNGAREHYKEVKNgnyiklredWWTANRDQVWKAMTCVAPE 262
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1776 NTETKemdkelrnklteqkngnKNTYDTVTISGGPIGNTKLEKfASRPPF-------FRWLEEWADEFCRKRTHKLEKIQ 1848
Cdd:PTZ00176  263 NAYFR-----------------KTEADGIGISSLILPYSKCGR-DTDPPVvdyipqrLRWMSEWSEYFCNVLNKEIDEMN 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1849 NECKGVSGTNQCDDDGfdcdemcpkkdgsfETFKCLSCAKSCRFYKKWISRKKEEFDKQSKKY-----ENEIDDVKHNS- 1922
Cdd:PTZ00176  325 NQCKDCEMSRRCNNDT--------------EGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynKASTNITKQNSs 390
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23615157  1923 --DNIYGKDFLETLDQQYKSVELFLEKVkgpcsINNNneECKID-FNKPKDTFGHAKN 1977
Cdd:PTZ00176  391 apERGYRRNHRRRGYDDDTNVQLFLKKV-----IENN--ECKVEsLGKYLDKTSHCGN 441
 
Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
2930-3346 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 724.29  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2930 TIMWSVGIGFAAISYFLLKKKPKSPV-DLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYMEGDTSGDEKYGFM 3008
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDEKYAFM 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3009 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNT-------LGDDMVPTTNTFTDEEWNELKHDFISQ 3081
Cdd:pfam15445   81 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTpsdtqndIPSDDIPSTNPITDEEWNTLKHDFISN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3082 YIQSEPLNVPQYDVLKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDD-PKYVSNNVYSGIDL 3159
Cdd:pfam15445  161 MLQNTQNDEPNILRSGNVPNNTHPNTLSrDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDiPKYVSNNVYSGIDL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3160 INDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEVLDKLK 3239
Cdd:pfam15445  241 INDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWKNKEERLDKLK 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3240 EQWNKDNDGG------DISSDSNKRLNTDVSIEIDMDDPKGKKEFSN---------MDTILDNIE-----------DDIY 3293
Cdd:pfam15445  321 EEWNKENNHSgdihpsDDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNmdtnpdnstMDTILDDLEkynepyydfyeDDIY 400
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|...
gi 23615157   3294 YDVNDENPSvndiPMDHNKVDVPKKVHVEMKIlNNtsTGSLEQQFPISDVWNI 3346
Cdd:pfam15445  401 YDVNDHDAS----TVDSNNMDVPTKVQIEMDV-NN--TKLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
2370-3346 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 633.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2370 TQWKDTGKSGKHVD---VYLPPRREHICT---SNLEYLLKGNSDqimkVGNNKINHSFLGEVLLAAKYeaefikTNYTrl 2443
Cdd:PTZ00176  508 SEWNNSGVKNKENDnngVLVPPRRRNLCInlfSKKDYKMKDEND----FKEDLLNAAFSQGKLLGKKY------SNYS-- 575
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2444 ngqndNGAKcRAMKYSFADIGDIVRGRDLWehNDFKKLERDLvkifgkikegitdETTKKQYEKDDTDNKqlRCDWWEAN 2523
Cdd:PTZ00176  576 -----NEAY-EAMKFSYADYSDIVKGTDMM--NDLKKLNKEL-------------NTLLKETEKGDISVD--RKTWWDDN 632
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2524 RDQVWEAMQCK-TTIPPVTTSCDTTTVTPLVDYIPQRLRWMMEWAEWYCKYQSKAYSELRKGCEDC---RSWKCMKGDSK 2599
Cdd:PTZ00176  633 KNVVWNAMLCGyKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIvegRKHKSMVDITD 712
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2600 CEnCTKACKDYNSKIEPWKQQWTKIKEKYEELYKkaqnsdTSNSGTTYPKDEkdvvsflsklheknkdnkiyyTAAGYIH 2679
Cdd:PTZ00176  713 VE-CKRLFIDYEEWFRYRYNQWKGLSEKYIKIKK------SKNSGVNIPSEE---------------------CAASYVT 764
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2680 QQAKylDCtqqthFCDKKNGETLPSGRDNDKYAFKKPPKKyerackchekqeppppkVPEDSEDDRERSEPGEDALPVlp 2759
Cdd:PTZ00176  765 KHCN--GC-----ICNLRDMEDIHKNINNQNELMKEMINI-----------------IKFDTDQYRTQLQNISNSMEI-- 818
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2760 peeieqEEEPEETSVDTTQDEEEPASEGGGPSGSPTEESGEPREnsdssdpKPDQNpeanpeqtpiLKPEEEAPPKSKPP 2839
Cdd:PTZ00176  819 ------NPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLG-------KKIQD----------LYNEFMKPVEKKLD 875
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2840 DGDRGVGRSLGPTprsevepeesenedvededdeeeeedpdddpeaeseeededhggqeaeavppqpqapaplppppppl 2919
Cdd:PTZ00176  876 TSSKNLNIYEDPN------------------------------------------------------------------- 888
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2920 pplktalmsstIMWSVGIGFA---AISYFLLKKKPKSPVDLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYME 2996
Cdd:PTZ00176  889 -----------IMVPAGIGVAltlGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLYVE 957
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2997 GDTSgDEKYGFMSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNTLGDDMVPTTNTFTDEEWNELKH 3076
Cdd:PTZ00176  958 GDTD-EEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNTPSYKLTDEEWNQLKD 1036
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3077 DFISQYIQSEPLNVPQYDvlKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDDPKYVSNNVYS 3155
Cdd:PTZ00176 1037 DFISQYLPNTEPNNNYRS--GNSPTNTNNTTTShDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNNVYS 1114
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3156 GIDLINDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEV 3234
Cdd:PTZ00176 1115 GIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENHHER 1194
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3235 LDKLKEQWNKDNDGGDISSDsNKRLNTDVSIEIDMDDPKGKKEFSNMDT-----ILDNIEDDIYYDVND-----ENPSVN 3304
Cdd:PTZ00176 1195 LAKLKEKWENDNDGGNVPSD-NHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDndddnDQPSVY 1273
                         970       980       990      1000
                  ....*....|....*....|....*....|....*....|....
gi 23615157  3305 DIPMDHNK--VDVPKKVHVEMKILNNTSTGSLEQQFPISDVWNI 3346
Cdd:PTZ00176 1274 DIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
13-366 1.04e-105

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 372.45  E-value: 1.04e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    13 KSPSLTESHNSARGVLEEIGKKIKDKTEKESKHVRQLKGKLSNAKFADRLYKeSGGDLRSAYSDACSLTYKFHTNITTDG 92
Cdd:PTZ00176    4 KKGVINESKLSARNVLENIGNEIKDKRENESKYTDKLKGSLWEARFSDGLSS-SFGDVRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    93 GDGRHPCHGRENNRFSESQEYGCSNVYIKGNENNSNGTACVPPRRRHICDQNLEFLDNPHTDDTDDLLGNVLVTAKYEGN 172
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   173 YIVSNHPDKnsngNKSGICTSLARSFADIGDIVRGRDMFKSN--EKVEIGLKKVFEKINNGLKKIGI-NDYNDI-SGNYY 248
Cdd:PTZ00176  163 SIVNNHPDK----DKSSVCTALARSFADIGDIVRGKDMFKRNkhDNVENGLREVFKKIYEGLKNNGArEHYKEVkNGNYI 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   249 KLREAWWTANRDQVWKAITCRAPNGAnYFRK----GLDGKIIFSDNGPCGRKelIVPTYLDYVPQFLRWLNEWSEEFCRI 324
Cdd:PTZ00176  239 KLREDWWTANRDQVWKAMTCVAPENA-YFRKteadGIGISSLILPYSKCGRD--TDPPVVDYIPQRLRWMSEWSEYFCNV 315
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 23615157   325 KNIKIGNIKKSCTGESNNKHCSR--EGYDCNKTNLRLnEIFMDL 366
Cdd:PTZ00176  316 LNKEIDEMNNQCKDCEMSRRCNNdtEGEKCKKCKEQC-QIFKEL 358
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
131-312 6.44e-70

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 233.37  E-value: 6.44e-70
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    131 ACVPPRRRHICDQNLEFLDNPHTDD--TDDLLGNVLVTAKYEGNYIVSNHPDKN----SNGNKSGICTSLARSFADIGDI 204
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSntTHDLLEAVILAAKYEGFSLWHKYKKYNpqykLGTIPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    205 VRGRDMFKSN--------EKVEIGLKKVFEKINNGLKKIGINDyndisGNYYKLREAWWTANRDQVWKAITCRAPNGANY 276
Cdd:pfam05424   81 VRGKDLYLGNnkkkknkrEKLEENLKKIFKKIYEKLTSKNKDD-----GNYYQLREDWWEANREDIWKAMTCALTYGAKY 155
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 23615157    277 FRKGLDGKIIFSDNGpcgrKELIVPTYLDYVPQFLR 312
Cdd:pfam05424  156 FRKTCGDGNSSSTAG----CNDDVPTYFDYVPQFLR 187
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
787-1537 3.78e-66

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 248.80  E-value: 3.78e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   787 NKLEGDIFKVTFRNG-----GVGKNLNGDICKID-KTYSNDSRG-TPTDGPCEGKG-DRFkigtDWQGDSFVNP-QYRG- 856
Cdd:PTZ00176   38 DKLKGSLWEARFSDGlsssfGDVRSGYYDSCSLDhKFHTNINNGyPPARNPCDGRNqNRF----DENGESYCNSdKIRGn 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   857 -------IYMPPRRQHFCTSNLEKLdvsrVIRNGNASNSLLGDVLLAAKYEAERTKNHYVSKkeEHSEACRAVRYSFADL 929
Cdd:PTZ00176  114 ennsnagACAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESIVNNHPDK--DKSSVCTALARSFADI 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   930 GDIIRGKDMWDKNHGEKkTQENLERIFAKIKEQLLNSSIKDKYKDDDKATpkYKQLREDWWEANRSQVWEAMQC-PPKNG 1008
Cdd:PTZ00176  188 GDIVRGKDMFKRNKHDN-VENGLREVFKKIYEGLKNNGAREHYKEVKNGN--YIKLREDWWTANRDQVWKAMTCvAPENA 264
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1009 TF------------------PCKSD-HTPLHDYIPQRLRWMTEWAEWYCKEQSRLYGELVETCGKCMHKGKCKQGN--GH 1067
Cdd:PTZ00176  265 YFrkteadgigisslilpysKCGRDtDPPVVDYIPQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEMSRRCNNDTegEK 344
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1068 CVTCKPACEKYKKFINTWQPQWKQMEQKYSQLYEEAK----KYNDSS---------RKDTTNKDDYVLQFLNKLLTQNKG 1134
Cdd:PTZ00176  345 CKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAStnitKQNSSApergyrrnhRRRGYDDDTNVQLFLKKVIENNEC 424
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1135 NktYDTAEGYVHQEAHisdcqkqtqfCKKRNGEIPSSDTETDNNyAFRPQPHDHDEVCECNTRQKTKVRKKKKKVDACEM 1214
Cdd:PTZ00176  425 K--VESLGKYLDKTSH----------CGNYNFNYDNTPGSNRSN-AFEITPEKFKKACKCKIPNPLEKCPNEENKNVCTR 491
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1215 AKtllhnndgtiRIGQCKRKDEGNaEYPKWDcNSQI---HTTHNGACMPPRRQKLCVYFFanpSQIGSINKQDNLRKAFI 1291
Cdd:PTZ00176  492 FD----------KVYSCTSLSFKN-DLSEWN-NSGVknkENDNNGVLVPPRRRNLCINLF---SKKDYKMKDENDFKEDL 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1292 ISAAaetfrswqYYKSKNGGEnlqtqlKDGTIPDDFKRQMFYTYGDYRDFLFGTDISKGLGEgtaLEKQINILFPNgVRK 1371
Cdd:PTZ00176  557 LNAA--------FSQGKLLGK------KYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKK---LNKELNTLLKE-TEK 618
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1372 IPNEKTREKWWTDHGPEIWKGMLCAltnglsesekktkifddYSHDKVNQSKNGN-PSLEDFAKKPQFFRWFIEWSDEFC 1450
Cdd:PTZ00176  619 GDISVDRKTWWDDNKNVVWNAMLCG-----------------YKTENENQQLNSSwCNVPDDDNIDQFLRWLTEWAQQYC 681
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1451 RERKKKEEEVERDCKDEYEGcEKEKNGKCVT--ACKA----YKEYITNKKEEYDSQKGKFDVEKTEKKQGYEDYSEKQAS 1524
Cdd:PTZ00176  682 KEKLIKAHIINTKCKDIVEG-RKHKSMVDITdvECKRlfidYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAA 760
                         810
                  ....*....|...
gi 23615157  1525 EYLKEKCIKSSCN 1537
Cdd:PTZ00176  761 SYVTKHCNGCICN 773
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2384-2561 1.26e-52

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 183.68  E-value: 1.26e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2384 VYLPPRREHICTSNLEYLLKGNSdqimkvgNNKINHSFLGEVLLAAKYEAEFIKTNYTRLNGQNDNGAK----CRAMKYS 2459
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNT-------TSNTTHDLLEAVILAAKYEGFSLWHKYKKYNPQYKLGTIpsefCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2460 FADIGDIVRGRDLW------EHNDFKKLERDLVKIFGKIKEGITDEttkkqyEKDDTDNKQLRCDWWEANRDQVWEAMQC 2533
Cdd:pfam05424   74 FADIGDIVRGKDLYlgnnkkKKNKREKLEENLKKIFKKIYEKLTSK------NKDDGNYYQLREDWWEANREDIWKAMTC 147
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 23615157   2534 KTT------------IPPVTTSCDTTTVTPLVDYIPQRLR 2561
Cdd:pfam05424  148 ALTygakyfrktcgdGNSSSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
857-1028 3.30e-52

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 182.52  E-value: 3.30e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    857 IYMPPRRQHFCTSNLEKLDVSRVirNGNASNSLLGDVLLAAKYEAERTKNHYVSKKEE------HSEACRAVRYSFADLG 930
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNT--TSNTTHDLLEAVILAAKYEGFSLWHKYKKYNPQyklgtiPSEFCRQMAYSFADIG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    931 DIIRGKDMWDKNHGEKKT-----QENLERIFAKIKEQLLNssikdkykdDDKATPKYKQLREDWWEANRSQVWEAMQCPP 1005
Cdd:pfam05424   79 DIVRGKDLYLGNNKKKKNkreklEENLKKIFKKIYEKLTS---------KNKDDGNYYQLREDWWEANREDIWKAMTCAL 149
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23615157   1006 KNG---------------TFPCKSDHTPLHDYIPQRLR 1028
Cdd:pfam05424  150 TYGakyfrktcgdgnsssTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1623-1778 1.46e-39

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 146.31  E-value: 1.46e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1623 VCIPPRRRRLYVKNLQDLTGEESL----VDLRKAFIKCAAIETFFAWHefkkekereekekneqdvQYKSsvlENLQKQL 1698
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTsnttHDLLEAVILAAKYEGFSLWH------------------KYKK---YNPQYKL 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1699 knGEIDDEFKRQMFYTFADYRDICLGKDI--------GNDVDGINEKIDTILQKNGK---------PNNIEEYKKWWQKH 1761
Cdd:pfam05424   60 --GTIPSEFCRQMAYSFADIGDIVRGKDLylgnnkkkKNKREKLEENLKKIFKKIYEkltsknkddGNYYQLREDWWEAN 137
                          170
                   ....*....|....*..
gi 23615157   1762 GHEIWEGMLCALSYNTE 1778
Cdd:pfam05424  138 REDIWKAMTCALTYGAK 154
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2087-2230 7.63e-32

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 122.99  E-value: 7.63e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2087 LFKRWLEHFLEDYNKINDKISHCMKNGEGSTCIKGCEIKCNCVSNWIKKKTLEWEIVRDRFFKQY------NVDSEKSFT 2160
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYklkgltGKTLDEYLD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 23615157   2161 VKSFLEQAPFDSDVQKAIKPFEKLRDFEDSIVCNG-TTSARKEKGTE-KDVVICLLDKLQKQIETCQTKHKE 2230
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGcSAGAESAKNNKnEDAIDKLLDKEEKKANNCKEKHKE 152
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
574-712 7.74e-29

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 114.52  E-value: 7.74e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    574 LFKRWLEYFLEDYNKLKEKLNPCMYNVQEIVCINECKQNCECVEKWIKEKREEWKKIKDRYVQQYESK-----DEDVSSK 648
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 23615157    649 LKKFLKQELFTNYVKNALDKDETLDSMKESTECIDPNKPKGKPCNN--NDVINILLNRLEKQIDNC 712
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKNNknEDAIDKLLDKEEKKANNC 146
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1256-1854 2.93e-21

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 102.81  E-value: 2.93e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1256 GACMPPRRQKLCVYFFANPSQIGSINKQDNLRKAFIisaaaetfrswqyyKSKNGGENLQTQLKDGTiPDDFKRQMFYTY 1335
Cdd:PTZ00176  120 GACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLV--------------TAKYEGESIVNNHPDKD-KSSVCTALARSF 184
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1336 GDYRDFLFGTD---------ISKGLGEgtALEKQINILFPNGVRKIPNE-------KTREKWWTDHGPEIWKGMLC-ALT 1398
Cdd:PTZ00176  185 ADIGDIVRGKDmfkrnkhdnVENGLRE--VFKKIYEGLKNNGAREHYKEvkngnyiKLREDWWTANRDQVWKAMTCvAPE 262
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1399 NGLSESEKKTKIfdDYSHDKVNQSKNG---NPSLEDFAkkPQFFRWFIEWSDEFCRERKKKEEEVERDCKDEY------E 1469
Cdd:PTZ00176  263 NAYFRKTEADGI--GISSLILPYSKCGrdtDPPVVDYI--PQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEmsrrcnN 338
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1470 GCEKEKNGKCVTACKAYKEYITNKKEEYDSQKGKF---------------------DVEKTEKKQGYEDYSEKQAseYLK 1528
Cdd:PTZ00176  339 DTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynkastnitkqnssaperGYRRNHRRRGYDDDTNVQL--FLK 416
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1529 EKCIKSSCNC------MKKVTEISNYWTNPHKTYDT----------ENLGIKCECP-PSP------------CTIVDGIL 1579
Cdd:PTZ00176  417 KVIENNECKVeslgkyLDKTSHCGNYNFNYDNTPGSnrsnafeitpEKFKKACKCKiPNPlekcpneenknvCTRFDKVY 496
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1580 SPQNSSSYAEGCKWKygkmsqggtewdcskKSGGEGGNEDGDVVCIPPRRRRL----YVKNLQDLTGEEslvDLRKAFIK 1655
Cdd:PTZ00176  497 SCTSLSFKNDLSEWN---------------NSGVKNKENDNNGVLVPPRRRNLcinlFSKKDYKMKDEN---DFKEDLLN 558
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1656 CAaietffawhefkkekereekekneqdvqYKSSVLenLQKQLKNgeIDDEFKRQMFYTFADYRDICLGKDIGNDVDGIN 1735
Cdd:PTZ00176  559 AA----------------------------FSQGKL--LGKKYSN--YSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLN 606
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1736 EKIDTILQKNGKPNNIEEYKKWWQKHGHEIWEGMLCALSYNTETKEMDKELRNkLTEQKNGNKntydtvtisggpigntk 1815
Cdd:PTZ00176  607 KELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGYKTENENQQLNSSWCN-VPDDDNIDQ----------------- 668
                         650       660       670
                  ....*....|....*....|....*....|....*....
gi 23615157  1816 lekfasrppFFRWLEEWADEFCRKRTHKLEKIQNECKGV 1854
Cdd:PTZ00176  669 ---------FLRWLTEWAQQYCKEKLIKAHIINTKCKDI 698
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1714-1977 9.99e-14

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 77.77  E-value: 9.99e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1714 TFADYRDICLGKDI--GNDVDGINEKIDTILQK-------NGKPNNIEEYKK---------WWQKHGHEIWEGMLCALSY 1775
Cdd:PTZ00176  183 SFADIGDIVRGKDMfkRNKHDNVENGLREVFKKiyeglknNGAREHYKEVKNgnyiklredWWTANRDQVWKAMTCVAPE 262
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1776 NTETKemdkelrnklteqkngnKNTYDTVTISGGPIGNTKLEKfASRPPF-------FRWLEEWADEFCRKRTHKLEKIQ 1848
Cdd:PTZ00176  263 NAYFR-----------------KTEADGIGISSLILPYSKCGR-DTDPPVvdyipqrLRWMSEWSEYFCNVLNKEIDEMN 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1849 NECKGVSGTNQCDDDGfdcdemcpkkdgsfETFKCLSCAKSCRFYKKWISRKKEEFDKQSKKY-----ENEIDDVKHNS- 1922
Cdd:PTZ00176  325 NQCKDCEMSRRCNNDT--------------EGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynKASTNITKQNSs 390
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23615157  1923 --DNIYGKDFLETLDQQYKSVELFLEKVkgpcsINNNneECKID-FNKPKDTFGHAKN 1977
Cdd:PTZ00176  391 apERGYRRNHRRRGYDDDTNVQLFLKKV-----IENN--ECKVEsLGKYLDKTSHCGN 441
 
Name Accession Description Interval E-value
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
2930-3346 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 724.29  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2930 TIMWSVGIGFAAISYFLLKKKPKSPV-DLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYMEGDTSGDEKYGFM 3008
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDEKYAFM 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3009 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNT-------LGDDMVPTTNTFTDEEWNELKHDFISQ 3081
Cdd:pfam15445   81 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTNTpsdtqndIPSDDIPSTNPITDEEWNTLKHDFISN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3082 YIQSEPLNVPQYDVLKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDD-PKYVSNNVYSGIDL 3159
Cdd:pfam15445  161 MLQNTQNDEPNILRSGNVPNNTHPNTLSrDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDiPKYVSNNVYSGIDL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3160 INDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEVLDKLK 3239
Cdd:pfam15445  241 INDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWKNKEERLDKLK 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   3240 EQWNKDNDGG------DISSDSNKRLNTDVSIEIDMDDPKGKKEFSN---------MDTILDNIE-----------DDIY 3293
Cdd:pfam15445  321 EEWNKENNHSgdihpsDDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNmdtnpdnstMDTILDDLEkynepyydfyeDDIY 400
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|...
gi 23615157   3294 YDVNDENPSvndiPMDHNKVDVPKKVHVEMKIlNNtsTGSLEQQFPISDVWNI 3346
Cdd:pfam15445  401 YDVNDHDAS----TVDSNNMDVPTKVQIEMDV-NN--TKLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
2370-3346 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 633.61  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2370 TQWKDTGKSGKHVD---VYLPPRREHICT---SNLEYLLKGNSDqimkVGNNKINHSFLGEVLLAAKYeaefikTNYTrl 2443
Cdd:PTZ00176  508 SEWNNSGVKNKENDnngVLVPPRRRNLCInlfSKKDYKMKDEND----FKEDLLNAAFSQGKLLGKKY------SNYS-- 575
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2444 ngqndNGAKcRAMKYSFADIGDIVRGRDLWehNDFKKLERDLvkifgkikegitdETTKKQYEKDDTDNKqlRCDWWEAN 2523
Cdd:PTZ00176  576 -----NEAY-EAMKFSYADYSDIVKGTDMM--NDLKKLNKEL-------------NTLLKETEKGDISVD--RKTWWDDN 632
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2524 RDQVWEAMQCK-TTIPPVTTSCDTTTVTPLVDYIPQRLRWMMEWAEWYCKYQSKAYSELRKGCEDC---RSWKCMKGDSK 2599
Cdd:PTZ00176  633 KNVVWNAMLCGyKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIvegRKHKSMVDITD 712
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2600 CEnCTKACKDYNSKIEPWKQQWTKIKEKYEELYKkaqnsdTSNSGTTYPKDEkdvvsflsklheknkdnkiyyTAAGYIH 2679
Cdd:PTZ00176  713 VE-CKRLFIDYEEWFRYRYNQWKGLSEKYIKIKK------SKNSGVNIPSEE---------------------CAASYVT 764
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2680 QQAKylDCtqqthFCDKKNGETLPSGRDNDKYAFKKPPKKyerackchekqeppppkVPEDSEDDRERSEPGEDALPVlp 2759
Cdd:PTZ00176  765 KHCN--GC-----ICNLRDMEDIHKNINNQNELMKEMINI-----------------IKFDTDQYRTQLQNISNSMEI-- 818
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2760 peeieqEEEPEETSVDTTQDEEEPASEGGGPSGSPTEESGEPREnsdssdpKPDQNpeanpeqtpiLKPEEEAPPKSKPP 2839
Cdd:PTZ00176  819 ------NPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLG-------KKIQD----------LYNEFMKPVEKKLD 875
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2840 DGDRGVGRSLGPTprsevepeesenedvededdeeeeedpdddpeaeseeededhggqeaeavppqpqapaplppppppl 2919
Cdd:PTZ00176  876 TSSKNLNIYEDPN------------------------------------------------------------------- 888
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2920 pplktalmsstIMWSVGIGFA---AISYFLLKKKPKSPVDLIRVIDIHKGDYGIPTLESKNRYIPYVSDTYKGKTYIYME 2996
Cdd:PTZ00176  889 -----------IMVPAGIGVAltlGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLYVE 957
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2997 GDTSgDEKYGFMSDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKSNGNTLGDDMVPTTNTFTDEEWNELKH 3076
Cdd:PTZ00176  958 GDTD-EEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNTPSYKLTDEEWNQLKD 1036
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3077 DFISQYIQSEPLNVPQYDvlKELPMNIVGNVLD-DGINEKPFITSIHDRDLNSGEEISYNINMSTNSMDDPKYVSNNVYS 3155
Cdd:PTZ00176 1037 DFISQYLPNTEPNNNYRS--GNSPTNTNNTTTShDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNNVYS 1114
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3156 GIDLINDSLSGGKPIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEMWNNKEEV 3234
Cdd:PTZ00176 1115 GIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENHHER 1194
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  3235 LDKLKEQWNKDNDGGDISSDsNKRLNTDVSIEIDMDDPKGKKEFSNMDT-----ILDNIEDDIYYDVND-----ENPSVN 3304
Cdd:PTZ00176 1195 LAKLKEKWENDNDGGNVPSD-NHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDndddnDQPSVY 1273
                         970       980       990      1000
                  ....*....|....*....|....*....|....*....|....
gi 23615157  3305 DIPMDHNK--VDVPKKVHVEMKILNNTSTGSLEQQFPISDVWNI 3346
Cdd:PTZ00176 1274 DIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
13-366 1.04e-105

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 372.45  E-value: 1.04e-105
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    13 KSPSLTESHNSARGVLEEIGKKIKDKTEKESKHVRQLKGKLSNAKFADRLYKeSGGDLRSAYSDACSLTYKFHTNITTDG 92
Cdd:PTZ00176    4 KKGVINESKLSARNVLENIGNEIKDKRENESKYTDKLKGSLWEARFSDGLSS-SFGDVRSGYYDSCSLDHKFHTNINNGY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    93 GDGRHPCHGRENNRFSESQEYGCSNVYIKGNENNSNGTACVPPRRRHICDQNLEFLDNPHTDDTDDLLGNVLVTAKYEGN 172
Cdd:PTZ00176   83 PPARNPCDGRNQNRFDENGESYCNSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGE 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   173 YIVSNHPDKnsngNKSGICTSLARSFADIGDIVRGRDMFKSN--EKVEIGLKKVFEKINNGLKKIGI-NDYNDI-SGNYY 248
Cdd:PTZ00176  163 SIVNNHPDK----DKSSVCTALARSFADIGDIVRGKDMFKRNkhDNVENGLREVFKKIYEGLKNNGArEHYKEVkNGNYI 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   249 KLREAWWTANRDQVWKAITCRAPNGAnYFRK----GLDGKIIFSDNGPCGRKelIVPTYLDYVPQFLRWLNEWSEEFCRI 324
Cdd:PTZ00176  239 KLREDWWTANRDQVWKAMTCVAPENA-YFRKteadGIGISSLILPYSKCGRD--TDPPVVDYIPQRLRWMSEWSEYFCNV 315
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
gi 23615157   325 KNIKIGNIKKSCTGESNNKHCSR--EGYDCNKTNLRLnEIFMDL 366
Cdd:PTZ00176  316 LNKEIDEMNNQCKDCEMSRRCNNdtEGEKCKKCKEQC-QIFKEL 358
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
131-312 6.44e-70

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 233.37  E-value: 6.44e-70
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    131 ACVPPRRRHICDQNLEFLDNPHTDD--TDDLLGNVLVTAKYEGNYIVSNHPDKN----SNGNKSGICTSLARSFADIGDI 204
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSntTHDLLEAVILAAKYEGFSLWHKYKKYNpqykLGTIPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    205 VRGRDMFKSN--------EKVEIGLKKVFEKINNGLKKIGINDyndisGNYYKLREAWWTANRDQVWKAITCRAPNGANY 276
Cdd:pfam05424   81 VRGKDLYLGNnkkkknkrEKLEENLKKIFKKIYEKLTSKNKDD-----GNYYQLREDWWEANREDIWKAMTCALTYGAKY 155
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 23615157    277 FRKGLDGKIIFSDNGpcgrKELIVPTYLDYVPQFLR 312
Cdd:pfam05424  156 FRKTCGDGNSSSTAG----CNDDVPTYFDYVPQFLR 187
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
787-1537 3.78e-66

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 248.80  E-value: 3.78e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   787 NKLEGDIFKVTFRNG-----GVGKNLNGDICKID-KTYSNDSRG-TPTDGPCEGKG-DRFkigtDWQGDSFVNP-QYRG- 856
Cdd:PTZ00176   38 DKLKGSLWEARFSDGlsssfGDVRSGYYDSCSLDhKFHTNINNGyPPARNPCDGRNqNRF----DENGESYCNSdKIRGn 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   857 -------IYMPPRRQHFCTSNLEKLdvsrVIRNGNASNSLLGDVLLAAKYEAERTKNHYVSKkeEHSEACRAVRYSFADL 929
Cdd:PTZ00176  114 ennsnagACAPFRRQNMCDKNLEYL----INKNTENTHDLLGNVLVTAKYEGESIVNNHPDK--DKSSVCTALARSFADI 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   930 GDIIRGKDMWDKNHGEKkTQENLERIFAKIKEQLLNSSIKDKYKDDDKATpkYKQLREDWWEANRSQVWEAMQC-PPKNG 1008
Cdd:PTZ00176  188 GDIVRGKDMFKRNKHDN-VENGLREVFKKIYEGLKNNGAREHYKEVKNGN--YIKLREDWWTANRDQVWKAMTCvAPENA 264
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1009 TF------------------PCKSD-HTPLHDYIPQRLRWMTEWAEWYCKEQSRLYGELVETCGKCMHKGKCKQGN--GH 1067
Cdd:PTZ00176  265 YFrkteadgigisslilpysKCGRDtDPPVVDYIPQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEMSRRCNNDTegEK 344
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1068 CVTCKPACEKYKKFINTWQPQWKQMEQKYSQLYEEAK----KYNDSS---------RKDTTNKDDYVLQFLNKLLTQNKG 1134
Cdd:PTZ00176  345 CKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKAStnitKQNSSApergyrrnhRRRGYDDDTNVQLFLKKVIENNEC 424
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1135 NktYDTAEGYVHQEAHisdcqkqtqfCKKRNGEIPSSDTETDNNyAFRPQPHDHDEVCECNTRQKTKVRKKKKKVDACEM 1214
Cdd:PTZ00176  425 K--VESLGKYLDKTSH----------CGNYNFNYDNTPGSNRSN-AFEITPEKFKKACKCKIPNPLEKCPNEENKNVCTR 491
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1215 AKtllhnndgtiRIGQCKRKDEGNaEYPKWDcNSQI---HTTHNGACMPPRRQKLCVYFFanpSQIGSINKQDNLRKAFI 1291
Cdd:PTZ00176  492 FD----------KVYSCTSLSFKN-DLSEWN-NSGVknkENDNNGVLVPPRRRNLCINLF---SKKDYKMKDENDFKEDL 556
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1292 ISAAaetfrswqYYKSKNGGEnlqtqlKDGTIPDDFKRQMFYTYGDYRDFLFGTDISKGLGEgtaLEKQINILFPNgVRK 1371
Cdd:PTZ00176  557 LNAA--------FSQGKLLGK------KYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKK---LNKELNTLLKE-TEK 618
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1372 IPNEKTREKWWTDHGPEIWKGMLCAltnglsesekktkifddYSHDKVNQSKNGN-PSLEDFAKKPQFFRWFIEWSDEFC 1450
Cdd:PTZ00176  619 GDISVDRKTWWDDNKNVVWNAMLCG-----------------YKTENENQQLNSSwCNVPDDDNIDQFLRWLTEWAQQYC 681
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1451 RERKKKEEEVERDCKDEYEGcEKEKNGKCVT--ACKA----YKEYITNKKEEYDSQKGKFDVEKTEKKQGYEDYSEKQAS 1524
Cdd:PTZ00176  682 KEKLIKAHIINTKCKDIVEG-RKHKSMVDITdvECKRlfidYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAA 760
                         810
                  ....*....|...
gi 23615157  1525 EYLKEKCIKSSCN 1537
Cdd:PTZ00176  761 SYVTKHCNGCICN 773
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
2328-2740 1.39e-57

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 221.45  E-value: 1.39e-57
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2328 GFNPSGLKNVCQITEK-HSYANG---ASKDPCNGKGNGK-DQRFKIETQWKDTGKSGKHVD--VYLPPRREHICTSNLEY 2400
Cdd:PTZ00176   58 GDVRSGYYDSCSLDHKfHTNINNgypPARNPCDGRNQNRfDENGESYCNSDKIRGNENNSNagACAPFRRQNMCDKNLEY 137
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2401 LLKGNSDQimkvgnnkiNHSFLGEVLLAAKYEAEFIKTNYTrlngQNDNGAKCRAMKYSFADIGDIVRGRDLWEHNDFKK 2480
Cdd:PTZ00176  138 LINKNTEN---------THDLLGNVLVTAKYEGESIVNNHP----DKDKSSVCTALARSFADIGDIVRGKDMFKRNKHDN 204
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2481 LERDLVKIFGKIKEGITDETTKKQYEKDDTDNK-QLRCDWWEANRDQVWEAMQC---------KTTIPPVTTSC------ 2544
Cdd:PTZ00176  205 VENGLREVFKKIYEGLKNNGAREHYKEVKNGNYiKLREDWWTANRDQVWKAMTCvapenayfrKTEADGIGISSlilpys 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2545 --DTTTVTPLVDYIPQRLRWMMEWAEWYCKYQSKAYSELRKGCEDCRSWKCMKGDS---KCENCTKACKDYNSKIEPWKQ 2619
Cdd:PTZ00176  285 kcGRDTDPPVVDYIPQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEMSRRCNNDTegeKCKKCKEQCQIFKELVSKWKN 364
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2620 QWTKIKEKYEELYKKA------QNSDTSNSGTTYP------KDEKDVVSFLSKLHEKNKDNkiyytaagyIHQQAKYLDc 2687
Cdd:PTZ00176  365 QFDKQSMKYMELYNKAstnitkQNSSAPERGYRRNhrrrgyDDDTNVQLFLKKVIENNECK---------VESLGKYLD- 434
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|...
gi 23615157  2688 tqQTHFCDKKNGETLPSGRDNDKYAFKKPPKKYERACKCheKQEPPPPKVPED 2740
Cdd:PTZ00176  435 --KTSHCGNYNFNYDNTPGSNRSNAFEITPEKFKKACKC--KIPNPLEKCPNE 483
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2384-2561 1.26e-52

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 183.68  E-value: 1.26e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2384 VYLPPRREHICTSNLEYLLKGNSdqimkvgNNKINHSFLGEVLLAAKYEAEFIKTNYTRLNGQNDNGAK----CRAMKYS 2459
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNT-------TSNTTHDLLEAVILAAKYEGFSLWHKYKKYNPQYKLGTIpsefCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2460 FADIGDIVRGRDLW------EHNDFKKLERDLVKIFGKIKEGITDEttkkqyEKDDTDNKQLRCDWWEANRDQVWEAMQC 2533
Cdd:pfam05424   74 FADIGDIVRGKDLYlgnnkkKKNKREKLEENLKKIFKKIYEKLTSK------NKDDGNYYQLREDWWEANREDIWKAMTC 147
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 23615157   2534 KTT------------IPPVTTSCDTTTVTPLVDYIPQRLR 2561
Cdd:pfam05424  148 ALTygakyfrktcgdGNSSSTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
857-1028 3.30e-52

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 182.52  E-value: 3.30e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    857 IYMPPRRQHFCTSNLEKLDVSRVirNGNASNSLLGDVLLAAKYEAERTKNHYVSKKEE------HSEACRAVRYSFADLG 930
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNT--TSNTTHDLLEAVILAAKYEGFSLWHKYKKYNPQyklgtiPSEFCRQMAYSFADIG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    931 DIIRGKDMWDKNHGEKKT-----QENLERIFAKIKEQLLNssikdkykdDDKATPKYKQLREDWWEANRSQVWEAMQCPP 1005
Cdd:pfam05424   79 DIVRGKDLYLGNNKKKKNkreklEENLKKIFKKIYEKLTS---------KNKDDGNYYQLREDWWEANREDIWKAMTCAL 149
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23615157   1006 KNG---------------TFPCKSDHTPLHDYIPQRLR 1028
Cdd:pfam05424  150 TYGakyfrktcgdgnsssTAGCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1257-1440 1.90e-47

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 169.04  E-value: 1.90e-47
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1257 ACMPPRRQKLCVYFFANPSQIGSINK-QDNLRKAFIISAAAETFRSWQYYKSKNggenlqTQLKDGTIPDDFKRQMFYTY 1335
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSNtTHDLLEAVILAAKYEGFSLWHKYKKYN------PQYKLGTIPSEFCRQMAYSF 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1336 GDYRDFLFGTDISKG-----LGEGTALEKQINILFPNGVRKIPN--------EKTREKWWTDHGPEIWKGMLCALTNGls 1402
Cdd:pfam05424   75 ADIGDIVRGKDLYLGnnkkkKNKREKLEENLKKIFKKIYEKLTSknkddgnyYQLREDWWEANREDIWKAMTCALTYG-- 152
                          170       180       190
                   ....*....|....*....|....*....|....*...
gi 23615157   1403 eSEKKTKIFDDYSHDKVNQSKNGNPSLEDFAkkPQFFR 1440
Cdd:pfam05424  153 -AKYFRKTCGDGNSSSTAGCNDDVPTYFDYV--PQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1623-1778 1.46e-39

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 146.31  E-value: 1.46e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1623 VCIPPRRRRLYVKNLQDLTGEESL----VDLRKAFIKCAAIETFFAWHefkkekereekekneqdvQYKSsvlENLQKQL 1698
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTsnttHDLLEAVILAAKYEGFSLWH------------------KYKK---YNPQYKL 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   1699 knGEIDDEFKRQMFYTFADYRDICLGKDI--------GNDVDGINEKIDTILQKNGK---------PNNIEEYKKWWQKH 1761
Cdd:pfam05424   60 --GTIPSEFCRQMAYSFADIGDIVRGKDLylgnnkkkKNKREKLEENLKKIFKKIYEkltsknkddGNYYQLREDWWEAN 137
                          170
                   ....*....|....*..
gi 23615157   1762 GHEIWEGMLCALSYNTE 1778
Cdd:pfam05424  138 REDIWKAMTCALTYGAK 154
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
2087-2230 7.63e-32

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 122.99  E-value: 7.63e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   2087 LFKRWLEHFLEDYNKINDKISHCMKNGEGSTCIKGCEIKCNCVSNWIKKKTLEWEIVRDRFFKQY------NVDSEKSFT 2160
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYklkgltGKTLDEYLD 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 23615157   2161 VKSFLEQAPFDSDVQKAIKPFEKLRDFEDSIVCNG-TTSARKEKGTE-KDVVICLLDKLQKQIETCQTKHKE 2230
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGcSAGAESAKNNKnEDAIDKLLDKEEKKANNCKEKHKE 152
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
574-712 7.74e-29

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 114.52  E-value: 7.74e-29
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157    574 LFKRWLEYFLEDYNKLKEKLNPCMYNVQEIVCINECKQNCECVEKWIKEKREEWKKIKDRYVQQYESK-----DEDVSSK 648
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 23615157    649 LKKFLKQELFTNYVKNALDKDETLDSMKESTECIDPNKPKGKPCNN--NDVINILLNRLEKQIDNC 712
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKNNknEDAIDKLLDKEEKKANNC 146
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1256-1854 2.93e-21

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 102.81  E-value: 2.93e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1256 GACMPPRRQKLCVYFFANPSQIGSINKQDNLRKAFIisaaaetfrswqyyKSKNGGENLQTQLKDGTiPDDFKRQMFYTY 1335
Cdd:PTZ00176  120 GACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLV--------------TAKYEGESIVNNHPDKD-KSSVCTALARSF 184
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1336 GDYRDFLFGTD---------ISKGLGEgtALEKQINILFPNGVRKIPNE-------KTREKWWTDHGPEIWKGMLC-ALT 1398
Cdd:PTZ00176  185 ADIGDIVRGKDmfkrnkhdnVENGLRE--VFKKIYEGLKNNGAREHYKEvkngnyiKLREDWWTANRDQVWKAMTCvAPE 262
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1399 NGLSESEKKTKIfdDYSHDKVNQSKNG---NPSLEDFAkkPQFFRWFIEWSDEFCRERKKKEEEVERDCKDEY------E 1469
Cdd:PTZ00176  263 NAYFRKTEADGI--GISSLILPYSKCGrdtDPPVVDYI--PQRLRWMSEWSEYFCNVLNKEIDEMNNQCKDCEmsrrcnN 338
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1470 GCEKEKNGKCVTACKAYKEYITNKKEEYDSQKGKF---------------------DVEKTEKKQGYEDYSEKQAseYLK 1528
Cdd:PTZ00176  339 DTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynkastnitkqnssaperGYRRNHRRRGYDDDTNVQL--FLK 416
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1529 EKCIKSSCNC------MKKVTEISNYWTNPHKTYDT----------ENLGIKCECP-PSP------------CTIVDGIL 1579
Cdd:PTZ00176  417 KVIENNECKVeslgkyLDKTSHCGNYNFNYDNTPGSnrsnafeitpEKFKKACKCKiPNPlekcpneenknvCTRFDKVY 496
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1580 SPQNSSSYAEGCKWKygkmsqggtewdcskKSGGEGGNEDGDVVCIPPRRRRL----YVKNLQDLTGEEslvDLRKAFIK 1655
Cdd:PTZ00176  497 SCTSLSFKNDLSEWN---------------NSGVKNKENDNNGVLVPPRRRNLcinlFSKKDYKMKDEN---DFKEDLLN 558
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1656 CAaietffawhefkkekereekekneqdvqYKSSVLenLQKQLKNgeIDDEFKRQMFYTFADYRDICLGKDIGNDVDGIN 1735
Cdd:PTZ00176  559 AA----------------------------FSQGKL--LGKKYSN--YSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLN 606
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1736 EKIDTILQKNGKPNNIEEYKKWWQKHGHEIWEGMLCALSYNTETKEMDKELRNkLTEQKNGNKntydtvtisggpigntk 1815
Cdd:PTZ00176  607 KELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGYKTENENQQLNSSWCN-VPDDDNIDQ----------------- 668
                         650       660       670
                  ....*....|....*....|....*....|....*....
gi 23615157  1816 lekfasrppFFRWLEEWADEFCRKRTHKLEKIQNECKGV 1854
Cdd:PTZ00176  669 ---------FLRWLTEWAQQYCKEKLIKAHIINTKCKDI 698
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
116-367 2.22e-15

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 83.16  E-value: 2.22e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   116 SNVYIKGNENNSNGTaCVPPRRRHICDQNLEFLDNPHTDDTD---DLLGNVLVTAKYEGNyivsnhpdKNSNGNKSGIcT 192
Cdd:PTZ00176  511 NNSGVKNKENDNNGV-LVPPRRRNLCINLFSKKDYKMKDENDfkeDLLNAAFSQGKLLGK--------KYSNYSNEAY-E 580
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   193 SLARSFADIGDIVRGRDMFKSnekveigLKKVFEKINNGLKKigiNDYNDISGNyyklREAWWTANRDQVWKAITCrapn 272
Cdd:PTZ00176  581 AMKFSYADYSDIVKGTDMMND-------LKKLNKELNTLLKE---TEKGDISVD----RKTWWDDNKNVVWNAMLC---- 642
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157   273 ganyfrkgldGKIIFSDNGPCGRKELIVPTYlDYVPQFLRWLNEWSEEFCRIKNIKIGNIKKSCTG-ESNNKHCSRegyd 351
Cdd:PTZ00176  643 ----------GYKTENENQQLNSSWCNVPDD-DNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDiVEGRKHKSM---- 707
                         250
                  ....*....|....*.
gi 23615157   352 CNKTNLRLNEIFMDLE 367
Cdd:PTZ00176  708 VDITDVECKRLFIDYE 723
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1714-1977 9.99e-14

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 77.77  E-value: 9.99e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1714 TFADYRDICLGKDI--GNDVDGINEKIDTILQK-------NGKPNNIEEYKK---------WWQKHGHEIWEGMLCALSY 1775
Cdd:PTZ00176  183 SFADIGDIVRGKDMfkRNKHDNVENGLREVFKKiyeglknNGAREHYKEVKNgnyiklredWWTANRDQVWKAMTCVAPE 262
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1776 NTETKemdkelrnklteqkngnKNTYDTVTISGGPIGNTKLEKfASRPPF-------FRWLEEWADEFCRKRTHKLEKIQ 1848
Cdd:PTZ00176  263 NAYFR-----------------KTEADGIGISSLILPYSKCGR-DTDPPVvdyipqrLRWMSEWSEYFCNVLNKEIDEMN 324
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  1849 NECKGVSGTNQCDDDGfdcdemcpkkdgsfETFKCLSCAKSCRFYKKWISRKKEEFDKQSKKY-----ENEIDDVKHNS- 1922
Cdd:PTZ00176  325 NQCKDCEMSRRCNNDT--------------EGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynKASTNITKQNSs 390
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 23615157  1923 --DNIYGKDFLETLDQQYKSVELFLEKVkgpcsINNNneECKID-FNKPKDTFGHAKN 1977
Cdd:PTZ00176  391 apERGYRRNHRRRGYDDDTNVQLFLKKV-----IENN--ECKVEsLGKYLDKTSHCGN 441
NTS pfam15447
N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part ...
23-57 6.30e-08

N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part of the variant surface antigen family of Plasmodium falciparum, the erythrocyte membrane protein-1 (PfEMP1) proteins. PfEMP1 is an important target for protective immunity and is implicated in the pathology of malaria through its ability to adhere to host endothelial receptors. A structural and functional study of the N-terminal domain of PfEMP1 from the VarO variant comprising the N-terminal segment (NTS) and the first DBL domain (DBL1alpha1), shows this region is directly implicated in rosetting. NTS, previously thought to be a structurally independent component of PfEMP1, forms an integral part of the DBL1alpha domain that is found to be the important heparin-binding site. This family is closely associated with PFEMP, pfam03011, and Duffy_binding, pfam05424.


Pssm-ID: 317801  Cd Length: 36  Bit Score: 50.84  E-value: 6.30e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 23615157     23 SARGVLEEIGKKIKDKTEKESK-HVRQLKGKLSNAK 57
Cdd:pfam15447    1 SAKHVLDRIGKKVHDKVKKEAKkYKSELKGDLSKAK 36
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
2778-2841 2.26e-06

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 49.57  E-value: 2.26e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 23615157   2778 QDEEEPASEGGgPSGSPTEESGEPRENSDSSDPKPDQNPEANPEQTPILKPEEEAPPKSKPPDG 2841
Cdd:pfam05887   61 DDEPEEEEEPE-PEEEGEEEPEPEEEGEEEPEPEETGEEEPEPEPEPEPEPEPEPEPEPEPEPG 123
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
2781-2840 8.82e-06

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 48.03  E-value: 8.82e-06
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 23615157   2781 EEPAS----EGGGPSGSPTEESGEPRENSDSSDPKPDQNPEANPEQTPilkPEEEAPPKSKPPD 2840
Cdd:pfam05887   29 DEPADkgitKGGKGKGEKGTKVGADDTNGTDPDDEPEEEEEPEPEEEG---EEEPEPEEEGEEE 89
Trypan_PARP pfam05887
Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei ...
2777-2832 2.39e-04

Procyclic acidic repetitive protein (PARP); This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of Trypanosoma brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated.


Pssm-ID: 114603  Cd Length: 145  Bit Score: 43.79  E-value: 2.39e-04
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 23615157   2777 TQDEEEPASEGGgPSGSPTEESGEPRENSDSSDPKPDQNPEANPEQTPILKPEEEA 2832
Cdd:pfam05887   70 PEPEEEGEEEPE-PEEEGEEEPEPEETGEEEPEPEPEPEPEPEPEPEPEPEPEPGA 124
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
2659-2839 3.73e-03

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 43.14  E-value: 3.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2659 SKLHEKNKD-----NKIYYTAAGYIHQQAKYLDCTQQTHFCDKKNGETLPSGRDNDKYAFKKPPKKYERAckchekqePP 2733
Cdd:PTZ00449  448 RLVHLRIKDripanNDIYMLKFDEYWTRISKIQFTQEIKKLIKKSKKKLAPIEEEDSDKHDEPPEGPEAS--------GL 519
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23615157  2734 PPKVPEDSEDDRERSEPGEdalpvlppeeieqeeepeetsvdttqdEEEPASEGGGPsgspteesGEPRENSDSSDPKPD 2813
Cdd:PTZ00449  520 PPKAPGDKEGEEGEHEDSK---------------------------ESDEPKEGGKP--------GETKEGEVGKKPGPA 564
                         170       180
                  ....*....|....*....|....*.
gi 23615157  2814 QnpEANPEQTPILKPEEEAPPKSKPP 2839
Cdd:PTZ00449  565 K--EHKPSKIPTLSKKPEFPKDPKHP 588
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH