NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23499282|emb|CAD51362|]
View 

erythrocyte membrane protein 1, PfEMP1 [Plasmodium falciparum 3D7]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
1649-2858 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 904.79  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1649 IRKESGKKSDNSLKGNGNTYNNNCNNS-----MREEYANQNGETCKFNETFWSKKKPSIEECDINAKERFQIQKYWDCNG 1723
Cdd:PTZ00176   28 DKRENESKYTDKLKGSLWEARFSDGLSssfgdVRSGYYDSCSLDHKFHTNINNGYPPARNPCDGRNQNRFDENGESYCNS 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1724 -KTPDGKNTF----CIPPRRKDMCLKQLEEINSADVNNSKKLLQKIQDVAKKEGDDIIKKLLPKypcNEDVICKAMKYSF 1798
Cdd:PTZ00176  108 dKIRGNENNSnagaCAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGESIVNNHPDK---DKSSVCTALARSF 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1799 ADLADIVRGIDKYKgPNGTNVLEKELKSVFETIYTKWKSENTnnKSKYTDVAS-----FRSAWWDANRKDIWNAMTCNAP 1873
Cdd:PTZ00176  185 ADIGDIVRGKDMFK-RNKHDNVENGLREVFKKIYEGLKNNGA--REHYKEVKNgnyikLREDWWTANRDQVWKAMTCVAP 261
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1874 YDAKIYITK-EGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYC-LAQKDLLETMKNCENC-MKKNKNADce 1950
Cdd:PTZ00176  262 ENAYFRKTEaDGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCnVLNKEIDEMNNQCKDCeMSRRCNND-- 339
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1951 qTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNATTTNRDNNNIV----------------DENTKNFVKKL 2014
Cdd:PTZ00176  340 -TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSApergyrrnhrrrgyddDTNVQLFLKKV 418
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2015 QENcrtdrNE-SLDTADKYLENASVCRRFKFG--NKDSRHLNYAFHTDPPSYEEHCKCaKDFDPLDECPVDNNE--CKKY 2089
Cdd:PTZ00176  419 IEN-----NEcKVESLGKYLDKTSHCGNYNFNydNTPGSNRSNAFEITPEKFKKACKC-KIPNPLEKCPNEENKnvCTRF 492
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2090 G-IGSCPKKNFHKKLEEWTNYVLNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYR 2168
Cdd:PTZ00176  493 DkVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKEDLLNAAFSQGKLLGKKYS 572
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2169 ENPAKALQAIKYSFADIGNIIKGDDIIGNV--ISVQLNKLINGNKKINTST---LWWEANKEKIWNAMMCYYTGDEKTAT 2243
Cdd:PTZ00176  573 NYSNEAYEAMKFSYADYSDIVKGTDMMNDLkkLNKELNTLLKETEKGDISVdrkTWWDDNKNVVWNAMLCGYKTENENQQ 652
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2244 SCPSHGNI---DKEDQFLLWFQEWGENFCaRQKELYEHV-QAECSHVicVNGTGN------IDSKCTEACKNYSNFISET 2313
Cdd:PTZ00176  653 LNSSWCNVpddDNIDQFLRWLTEWAQQYC-KEKLIKAHIiNTKCKDI--VEGRKHksmvdiTDVECKRLFIDYEEWFRYR 729
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2314 KNVYQSLKKQY----NDNHNSIKVGGKE-VHHYMKEKCkDKCEC-------LSEKFNSDNNWEKPYDT---FDDTVLKNK 2378
Cdd:PTZ00176  730 YNQWKGLSEKYikikKSKNSGVNIPSEEcAASYVTKHC-NGCICnlrdmedIHKNINNQNELMKEMINiikFDTDQYRTQ 808
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2379 CQCKKPDSPILPVEPSVPAETEKE-----------------------KKKDSPLKPHTEPKPAPPKKPEVPppppvqppp 2435
Cdd:PTZ00176  809 LQNISNSMEINPKSVKTAVDTTKDivsyglagtmgvaaiglqagdflGKKIQDLYNEFMKPVEKKLDTSSK--------- 879
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2436 anqpfNRDILEK---TIPFGIALALGSIAFLF-IKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYI 2511
Cdd:PTZ00176  880 -----NLNIYEDpniMVPAGIGVALTLGLLLFkMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYL 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2512 YMEGDSDSGHYY--EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDT----PSSDAPMNKFTDDEWNQL 2585
Cdd:PTZ00176  955 YVEGDTDEEKYMfmSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTqndiPSDNTPSYKLTDEEWNQL 1034
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2586 KQDFISGILENEQkdlPKNNI-SGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDDTSYVSNN 2664
Cdd:PTZ00176 1035 KDDFISQYLPNTE---PNNNYrSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNN 1111
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2665 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEKWKSK 2743
Cdd:PTZ00176 1112 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENH 1191
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2744 EDILHKLNEQWNKDNDGGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDT-----ILDDIEDDIYYDVNDDEN----PS 2814
Cdd:PTZ00176 1192 HERLAKLKEKWENDNDGGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDNDDdndqPS 1271
                        1290      1300      1310      1320
                  ....*....|....*....|....*....|....*....|....*.
gi 23499282  2815 VDNIPMDHNK--VDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI 2858
Cdd:PTZ00176 1272 VYDIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-404 7.21e-75

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 276.53  E-value: 7.21e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    12 SDVKNESHNSARNVFENIAEIIYNRVKEDAEKRGKsLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGS 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESKYTDK-LKGSLWEARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    92 YDRDPCHLRDTNRFSDKGDAICTNNKI--NCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMAKREGDS 169
Cdd:PTZ00176   84 PARNPCDGRNQNRFDENGESYCNSDKIrgNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGES 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   170 IVNSHGHTGkgiyKSGICTSLARSFADIGDIIRGKDLFLGHNHkkkpllDNLEK-IFNRFQKIYEDINNLPIDD------ 242
Cdd:PTZ00176  164 IVNNHPDKD----KSSVCTALARSFADIGDIVRGKDMFKRNKH------DNVENgLREVFKKIYEGLKNNGAREhykevk 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   243 ------IREYWWALNRNDVWEALTCSAPYYAdYFKKKSGNTYNFT----TEGYCGRNEGAPPtnLDYVPQFLRWFDEWAE 312
Cdd:PTZ00176  234 ngnyikLREDWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISslilPYSKCGRDTDPPV--VDYIPQRLRWMSEWSE 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   313 EFCRIKNIKIGNIKKSCTgesnnkhcsregyDCNKTNlRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEE 392
Cdd:PTZ00176  311 YFCNVLNKEIDEMNNQCK-------------DCEMSR-RCNNDTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMEL 376
                         410
                  ....*....|..
gi 23499282   393 INESKPGVNSEH 404
Cdd:PTZ00176  377 YNKASTNITKQN 388
PTZ00176 super family cl31413
erythrocyte membrane protein 1 (PfEMP1); Provisional
853-1567 1.19e-64

erythrocyte membrane protein 1 (PfEMP1); Provisional


The actual alignment was detected with superfamily member PTZ00176:

Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 243.79  E-value: 1.19e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   853 GHRDYKGPCTGKDGHKKMFQVEKGWENGSKIGTEND----VFLPPRREHFCTSNVEHLYRsasglQGTTASHSLLGDVLL 928
Cdd:PTZ00176   81 GYPPARNPCDGRNQNRFDENGESYCNSDKIRGNENNsnagACAPFRRQNMCDKNLEYLIN-----KNTENTHDLLGNVLV 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   929 AANKEAGFIKERYKTQKTSEgfkdeatVCRAIKYSFADIADIIKGTDLWKANSgKKNTQDKLVKIFQKIKDNLPVN-IKG 1007
Cdd:PTZ00176  156 TAKYEGESIVNNHPDKDKSS-------VCTALARSFADIGDIVRGKDMFKRNK-HDNVENGLREVFKKIYEGLKNNgARE 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1008 KYNEDE--KHLELRKDWWFANRDKVWEAMKC-----------EQNGI----------TCSGPT--PLDDYIPQRLRWMTE 1062
Cdd:PTZ00176  228 HYKEVKngNYIKLREDWWTANRDQVWKAMTCvapenayfrktEADGIgisslilpysKCGRDTdpPVVDYIPQRLRWMSE 307
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1063 WAEWYCKAQKEAYDKLK-VCEKCMDNGKC---TQGnGECAKCKTACENYKKFINTWQPQWKQMEQKYESLYKEAQEN--- 1135
Cdd:PTZ00176  308 WSEYFCNVLNKEIDEMNnQCKDCEMSRRCnndTEG-EKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNitk 386
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1136 GNSS---------HKSTTEQDKYMVEFLSQLQKANNGDKTgddkvystaagyvhqEATMNCEKQTQFCKNKNGVKAANDA 1206
Cdd:PTZ00176  387 QNSSapergyrrnHRRRGYDDDTNVQLFLKKVIENNECKV---------------ESLGKYLDKTSHCGNYNFNYDNTPG 451
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1207 EDVNYTFKDTPNGYDVVCKCK-DRPEQQIKKKEVEDACKIAQDIFkgkdenTTVGLCKKKDFGRTPYPDWKCEKNSKlvt 1285
Cdd:PTZ00176  452 SNRSNAFEITPEKFKKACKCKiPNPLEKCPNEENKNVCTRFDKVY------SCTSLSFKNDLSEWNNSGVKNKENDN--- 522
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1286 gNGECMPPRRQKLCLYFLAHKieTPNLNTQEDLRKAFIKCAAAETFFswyYFKKINDKLNKLDEKLKegeippqflrsmf 1365
Cdd:PTZ00176  523 -NGVLVPPRRRNLCINLFSKK--DYKMKDENDFKEDLLNAAFSQGKL---LGKKYSNYSNEAYEAMK------------- 583
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1366 YTFGDYKDICLDTDISlktenGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNdkatvQK 1445
Cdd:PTZ00176  584 FSYADYSDIVKGTDMM-----NDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGYKTENENQ-----QL 653
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1446 TLTTKTIYDYDTVTfdgttkledfskrpQFLRWMTEWGEEFCKKRKEQLENLKDKCPD------YTCSFDTKKQECENHC 1519
Cdd:PTZ00176  654 NSSWCNVPDDDNID--------------QFLRWLTEWAQQYCKEKLIKAHIINTKCKDivegrkHKSMVDITDVECKRLF 719
                         730       740       750       760
                  ....*....|....*....|....*....|....*....|....*...
gi 23499282  1520 KVYEEWLKGWKDQYKKQSEKFTtdKEKPEYKDDPDVASSENAHKYLSK 1567
Cdd:PTZ00176  720 IDYEEWFRYRYNQWKGLSEKYI--KIKKSKNSGVNIPSEECAASYVTK 765
PFEMP super family cl03834
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
566-706 2.19e-26

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


The actual alignment was detected with superfamily member pfam03011:

Pssm-ID: 281064  Cd Length: 154  Bit Score: 107.20  E-value: 2.19e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    566 FIKRWLESFLKDYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIE-----DNNSSNS 640
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 23499282    641 LNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEEC--KSNDVIKILLSKLKEKIELCKK 706
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKnnKNEDAIDKLLDKEEKKANNCKE 148
 
Name Accession Description Interval E-value
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1649-2858 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 904.79  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1649 IRKESGKKSDNSLKGNGNTYNNNCNNS-----MREEYANQNGETCKFNETFWSKKKPSIEECDINAKERFQIQKYWDCNG 1723
Cdd:PTZ00176   28 DKRENESKYTDKLKGSLWEARFSDGLSssfgdVRSGYYDSCSLDHKFHTNINNGYPPARNPCDGRNQNRFDENGESYCNS 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1724 -KTPDGKNTF----CIPPRRKDMCLKQLEEINSADVNNSKKLLQKIQDVAKKEGDDIIKKLLPKypcNEDVICKAMKYSF 1798
Cdd:PTZ00176  108 dKIRGNENNSnagaCAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGESIVNNHPDK---DKSSVCTALARSF 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1799 ADLADIVRGIDKYKgPNGTNVLEKELKSVFETIYTKWKSENTnnKSKYTDVAS-----FRSAWWDANRKDIWNAMTCNAP 1873
Cdd:PTZ00176  185 ADIGDIVRGKDMFK-RNKHDNVENGLREVFKKIYEGLKNNGA--REHYKEVKNgnyikLREDWWTANRDQVWKAMTCVAP 261
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1874 YDAKIYITK-EGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYC-LAQKDLLETMKNCENC-MKKNKNADce 1950
Cdd:PTZ00176  262 ENAYFRKTEaDGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCnVLNKEIDEMNNQCKDCeMSRRCNND-- 339
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1951 qTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNATTTNRDNNNIV----------------DENTKNFVKKL 2014
Cdd:PTZ00176  340 -TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSApergyrrnhrrrgyddDTNVQLFLKKV 418
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2015 QENcrtdrNE-SLDTADKYLENASVCRRFKFG--NKDSRHLNYAFHTDPPSYEEHCKCaKDFDPLDECPVDNNE--CKKY 2089
Cdd:PTZ00176  419 IEN-----NEcKVESLGKYLDKTSHCGNYNFNydNTPGSNRSNAFEITPEKFKKACKC-KIPNPLEKCPNEENKnvCTRF 492
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2090 G-IGSCPKKNFHKKLEEWTNYVLNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYR 2168
Cdd:PTZ00176  493 DkVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKEDLLNAAFSQGKLLGKKYS 572
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2169 ENPAKALQAIKYSFADIGNIIKGDDIIGNV--ISVQLNKLINGNKKINTST---LWWEANKEKIWNAMMCYYTGDEKTAT 2243
Cdd:PTZ00176  573 NYSNEAYEAMKFSYADYSDIVKGTDMMNDLkkLNKELNTLLKETEKGDISVdrkTWWDDNKNVVWNAMLCGYKTENENQQ 652
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2244 SCPSHGNI---DKEDQFLLWFQEWGENFCaRQKELYEHV-QAECSHVicVNGTGN------IDSKCTEACKNYSNFISET 2313
Cdd:PTZ00176  653 LNSSWCNVpddDNIDQFLRWLTEWAQQYC-KEKLIKAHIiNTKCKDI--VEGRKHksmvdiTDVECKRLFIDYEEWFRYR 729
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2314 KNVYQSLKKQY----NDNHNSIKVGGKE-VHHYMKEKCkDKCEC-------LSEKFNSDNNWEKPYDT---FDDTVLKNK 2378
Cdd:PTZ00176  730 YNQWKGLSEKYikikKSKNSGVNIPSEEcAASYVTKHC-NGCICnlrdmedIHKNINNQNELMKEMINiikFDTDQYRTQ 808
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2379 CQCKKPDSPILPVEPSVPAETEKE-----------------------KKKDSPLKPHTEPKPAPPKKPEVPppppvqppp 2435
Cdd:PTZ00176  809 LQNISNSMEINPKSVKTAVDTTKDivsyglagtmgvaaiglqagdflGKKIQDLYNEFMKPVEKKLDTSSK--------- 879
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2436 anqpfNRDILEK---TIPFGIALALGSIAFLF-IKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYI 2511
Cdd:PTZ00176  880 -----NLNIYEDpniMVPAGIGVALTLGLLLFkMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYL 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2512 YMEGDSDSGHYY--EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDT----PSSDAPMNKFTDDEWNQL 2585
Cdd:PTZ00176  955 YVEGDTDEEKYMfmSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTqndiPSDNTPSYKLTDEEWNQL 1034
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2586 KQDFISGILENEQkdlPKNNI-SGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDDTSYVSNN 2664
Cdd:PTZ00176 1035 KDDFISQYLPNTE---PNNNYrSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNN 1111
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2665 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEKWKSK 2743
Cdd:PTZ00176 1112 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENH 1191
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2744 EDILHKLNEQWNKDNDGGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDT-----ILDDIEDDIYYDVNDDEN----PS 2814
Cdd:PTZ00176 1192 HERLAKLKEKWENDNDGGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDNDDdndqPS 1271
                        1290      1300      1310      1320
                  ....*....|....*....|....*....|....*....|....*.
gi 23499282  2815 VDNIPMDHNK--VDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI 2858
Cdd:PTZ00176 1272 VYDIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
2448-2858 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 689.24  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2448 TIPFGIALALGSIAFLFIKKKPKSPV-DLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSGH---YY 2523
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDEkyaFM 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2524 EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDT----------PSSDAPM-NKFTDDEWNQLKQDFISG 2592
Cdd:pfam15445   81 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTntpsdtqndiPSDDIPStNPITDEEWNTLKHDFISN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2593 ILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDD-TSYVSNNVYSGIDL 2671
Cdd:pfam15445  161 MLQNTQNDEPNILRSGNVPNNTHPNTLSRDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDiPKYVSNNVYSGIDL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2672 INDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLN 2751
Cdd:pfam15445  241 INDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWKNKEERLDKLK 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2752 EQWNKDNDGG-------NVPIDNRSLNTDVWIEIDMDDPKGKKEFSN---------MDTILDDIEDDIYY---------- 2805
Cdd:pfam15445  321 EEWNKENNHSgdihpsdDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNmdtnpdnstMDTILDDLEKYNEPyydfyeddiy 400
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....
gi 23499282   2806 -DVNDDenpsvDNIPMDHNKVDVPKKVHVEMKIlNNTsnGSLEPEFPISDVWNI 2858
Cdd:pfam15445  401 yDVNDH-----DASTVDSNNMDVPTKVQIEMDV-NNT--KLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-404 7.21e-75

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 276.53  E-value: 7.21e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    12 SDVKNESHNSARNVFENIAEIIYNRVKEDAEKRGKsLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGS 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESKYTDK-LKGSLWEARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    92 YDRDPCHLRDTNRFSDKGDAICTNNKI--NCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMAKREGDS 169
Cdd:PTZ00176   84 PARNPCDGRNQNRFDENGESYCNSDKIrgNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGES 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   170 IVNSHGHTGkgiyKSGICTSLARSFADIGDIIRGKDLFLGHNHkkkpllDNLEK-IFNRFQKIYEDINNLPIDD------ 242
Cdd:PTZ00176  164 IVNNHPDKD----KSSVCTALARSFADIGDIVRGKDMFKRNKH------DNVENgLREVFKKIYEGLKNNGAREhykevk 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   243 ------IREYWWALNRNDVWEALTCSAPYYAdYFKKKSGNTYNFT----TEGYCGRNEGAPPtnLDYVPQFLRWFDEWAE 312
Cdd:PTZ00176  234 ngnyikLREDWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISslilPYSKCGRDTDPPV--VDYIPQRLRWMSEWSE 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   313 EFCRIKNIKIGNIKKSCTgesnnkhcsregyDCNKTNlRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEE 392
Cdd:PTZ00176  311 YFCNVLNKEIDEMNNQCK-------------DCEMSR-RCNNDTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMEL 376
                         410
                  ....*....|..
gi 23499282   393 INESKPGVNSEH 404
Cdd:PTZ00176  377 YNKASTNITKQN 388
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
853-1567 1.19e-64

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 243.79  E-value: 1.19e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   853 GHRDYKGPCTGKDGHKKMFQVEKGWENGSKIGTEND----VFLPPRREHFCTSNVEHLYRsasglQGTTASHSLLGDVLL 928
Cdd:PTZ00176   81 GYPPARNPCDGRNQNRFDENGESYCNSDKIRGNENNsnagACAPFRRQNMCDKNLEYLIN-----KNTENTHDLLGNVLV 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   929 AANKEAGFIKERYKTQKTSEgfkdeatVCRAIKYSFADIADIIKGTDLWKANSgKKNTQDKLVKIFQKIKDNLPVN-IKG 1007
Cdd:PTZ00176  156 TAKYEGESIVNNHPDKDKSS-------VCTALARSFADIGDIVRGKDMFKRNK-HDNVENGLREVFKKIYEGLKNNgARE 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1008 KYNEDE--KHLELRKDWWFANRDKVWEAMKC-----------EQNGI----------TCSGPT--PLDDYIPQRLRWMTE 1062
Cdd:PTZ00176  228 HYKEVKngNYIKLREDWWTANRDQVWKAMTCvapenayfrktEADGIgisslilpysKCGRDTdpPVVDYIPQRLRWMSE 307
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1063 WAEWYCKAQKEAYDKLK-VCEKCMDNGKC---TQGnGECAKCKTACENYKKFINTWQPQWKQMEQKYESLYKEAQEN--- 1135
Cdd:PTZ00176  308 WSEYFCNVLNKEIDEMNnQCKDCEMSRRCnndTEG-EKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNitk 386
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1136 GNSS---------HKSTTEQDKYMVEFLSQLQKANNGDKTgddkvystaagyvhqEATMNCEKQTQFCKNKNGVKAANDA 1206
Cdd:PTZ00176  387 QNSSapergyrrnHRRRGYDDDTNVQLFLKKVIENNECKV---------------ESLGKYLDKTSHCGNYNFNYDNTPG 451
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1207 EDVNYTFKDTPNGYDVVCKCK-DRPEQQIKKKEVEDACKIAQDIFkgkdenTTVGLCKKKDFGRTPYPDWKCEKNSKlvt 1285
Cdd:PTZ00176  452 SNRSNAFEITPEKFKKACKCKiPNPLEKCPNEENKNVCTRFDKVY------SCTSLSFKNDLSEWNNSGVKNKENDN--- 522
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1286 gNGECMPPRRQKLCLYFLAHKieTPNLNTQEDLRKAFIKCAAAETFFswyYFKKINDKLNKLDEKLKegeippqflrsmf 1365
Cdd:PTZ00176  523 -NGVLVPPRRRNLCINLFSKK--DYKMKDENDFKEDLLNAAFSQGKL---LGKKYSNYSNEAYEAMK------------- 583
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1366 YTFGDYKDICLDTDISlktenGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNdkatvQK 1445
Cdd:PTZ00176  584 FSYADYSDIVKGTDMM-----NDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGYKTENENQ-----QL 653
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1446 TLTTKTIYDYDTVTfdgttkledfskrpQFLRWMTEWGEEFCKKRKEQLENLKDKCPD------YTCSFDTKKQECENHC 1519
Cdd:PTZ00176  654 NSSWCNVPDDDNID--------------QFLRWLTEWAQQYCKEKLIKAHIINTKCKDivegrkHKSMVDITDVECKRLF 719
                         730       740       750       760
                  ....*....|....*....|....*....|....*....|....*...
gi 23499282  1520 KVYEEWLKGWKDQYKKQSEKFTtdKEKPEYKDDPDVASSENAHKYLSK 1567
Cdd:PTZ00176  720 IDYEEWFRYRYNQWKGLSEKYI--KIKKSKNSGVNIPSEECAASYVTK 765
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
127-305 3.54e-63

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 213.72  E-value: 3.54e-63
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    127 ACAPYRRIQLCDYNLEYINEYNINS--THDLLGNLLVMAKREGDSIVNSHGH----TGKGIYKSGICTSLARSFADIGDI 200
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSntTHDLLEAVILAAKYEGFSLWHKYKKynpqYKLGTIPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    201 IRGKDLFLGHNHKKK----PLLDNLEKIfnrFQKIYEDINNLPIDD-----IREYWWALNRNDVWEALTCSAPYYADYFK 271
Cdd:pfam05424   81 VRGKDLYLGNNKKKKnkreKLEENLKKI---FKKIYEKLTSKNKDDgnyyqLREDWWEANREDIWKAMTCALTYGAKYFR 157
                          170       180       190
                   ....*....|....*....|....*....|....
gi 23499282    272 KKSGNTYNFTTEGycgrNEGAPPTNLDYVPQFLR 305
Cdd:pfam05424  158 KTCGDGNSSSTAG----CNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1290-1477 3.30e-42

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 153.63  E-value: 3.30e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1290 CMPPRRQKLCLYFLaHKIETPNLN--TQEDLRKAFIKCAAAETFFSWYYFKKINdklnkldEKLKEGEIPPQFLRSMFYT 1367
Cdd:pfam05424    2 CAPPRRLHLCVKNL-EKINSTNTTsnTTHDLLEAVILAAKYEGFSLWHKYKKYN-------PQYKLGTIPSEFCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1368 FGDYKDICLDTDISL---KTENGDITKAKSNIDRIIPK---------KSAKNPDEERKIWWDGIKEDVWEGMLCGLSHav 1435
Cdd:pfam05424   74 FADIGDIVRGKDLYLgnnKKKKNKREKLEENLKKIFKKiyekltsknKDDGNYYQLREDWWEANREDIWKAMTCALTY-- 151
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|..
gi 23499282   1436 snNDKATVQKTLTTKTIYDYDTVTFDGTtkleDFSKRPQFLR 1477
Cdd:pfam05424  152 --GAKYFRKTCGDGNSSSTAGCNDDVPT----YFDYVPQFLR 187
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
566-706 2.19e-26

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 107.20  E-value: 2.19e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    566 FIKRWLESFLKDYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIE-----DNNSSNS 640
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 23499282    641 LNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEEC--KSNDVIKILLSKLKEKIELCKK 706
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKnnKNEDAIDKLLDKEEKKANNCKE 148
 
Name Accession Description Interval E-value
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1649-2858 0e+00

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 904.79  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1649 IRKESGKKSDNSLKGNGNTYNNNCNNS-----MREEYANQNGETCKFNETFWSKKKPSIEECDINAKERFQIQKYWDCNG 1723
Cdd:PTZ00176   28 DKRENESKYTDKLKGSLWEARFSDGLSssfgdVRSGYYDSCSLDHKFHTNINNGYPPARNPCDGRNQNRFDENGESYCNS 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1724 -KTPDGKNTF----CIPPRRKDMCLKQLEEINSADVNNSKKLLQKIQDVAKKEGDDIIKKLLPKypcNEDVICKAMKYSF 1798
Cdd:PTZ00176  108 dKIRGNENNSnagaCAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGESIVNNHPDK---DKSSVCTALARSF 184
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1799 ADLADIVRGIDKYKgPNGTNVLEKELKSVFETIYTKWKSENTnnKSKYTDVAS-----FRSAWWDANRKDIWNAMTCNAP 1873
Cdd:PTZ00176  185 ADIGDIVRGKDMFK-RNKHDNVENGLREVFKKIYEGLKNNGA--REHYKEVKNgnyikLREDWWTANRDQVWKAMTCVAP 261
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1874 YDAKIYITK-EGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYC-LAQKDLLETMKNCENC-MKKNKNADce 1950
Cdd:PTZ00176  262 ENAYFRKTEaDGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCnVLNKEIDEMNNQCKDCeMSRRCNND-- 339
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1951 qTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNATTTNRDNNNIV----------------DENTKNFVKKL 2014
Cdd:PTZ00176  340 -TEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSApergyrrnhrrrgyddDTNVQLFLKKV 418
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2015 QENcrtdrNE-SLDTADKYLENASVCRRFKFG--NKDSRHLNYAFHTDPPSYEEHCKCaKDFDPLDECPVDNNE--CKKY 2089
Cdd:PTZ00176  419 IEN-----NEcKVESLGKYLDKTSHCGNYNFNydNTPGSNRSNAFEITPEKFKKACKC-KIPNPLEKCPNEENKnvCTRF 492
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2090 G-IGSCPKKNFHKKLEEWTNYVLNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYR 2168
Cdd:PTZ00176  493 DkVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKEDLLNAAFSQGKLLGKKYS 572
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2169 ENPAKALQAIKYSFADIGNIIKGDDIIGNV--ISVQLNKLINGNKKINTST---LWWEANKEKIWNAMMCYYTGDEKTAT 2243
Cdd:PTZ00176  573 NYSNEAYEAMKFSYADYSDIVKGTDMMNDLkkLNKELNTLLKETEKGDISVdrkTWWDDNKNVVWNAMLCGYKTENENQQ 652
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2244 SCPSHGNI---DKEDQFLLWFQEWGENFCaRQKELYEHV-QAECSHVicVNGTGN------IDSKCTEACKNYSNFISET 2313
Cdd:PTZ00176  653 LNSSWCNVpddDNIDQFLRWLTEWAQQYC-KEKLIKAHIiNTKCKDI--VEGRKHksmvdiTDVECKRLFIDYEEWFRYR 729
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2314 KNVYQSLKKQY----NDNHNSIKVGGKE-VHHYMKEKCkDKCEC-------LSEKFNSDNNWEKPYDT---FDDTVLKNK 2378
Cdd:PTZ00176  730 YNQWKGLSEKYikikKSKNSGVNIPSEEcAASYVTKHC-NGCICnlrdmedIHKNINNQNELMKEMINiikFDTDQYRTQ 808
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2379 CQCKKPDSPILPVEPSVPAETEKE-----------------------KKKDSPLKPHTEPKPAPPKKPEVPppppvqppp 2435
Cdd:PTZ00176  809 LQNISNSMEINPKSVKTAVDTTKDivsyglagtmgvaaiglqagdflGKKIQDLYNEFMKPVEKKLDTSSK--------- 879
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2436 anqpfNRDILEK---TIPFGIALALGSIAFLF-IKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYI 2511
Cdd:PTZ00176  880 -----NLNIYEDpniMVPAGIGVALTLGLLLFkMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYL 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2512 YMEGDSDSGHYY--EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDT----PSSDAPMNKFTDDEWNQL 2585
Cdd:PTZ00176  955 YVEGDTDEEKYMfmSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTqndiPSDNTPSYKLTDEEWNQL 1034
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2586 KQDFISGILENEQkdlPKNNI-SGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDDTSYVSNN 2664
Cdd:PTZ00176 1035 KDDFISQYLPNTE---PNNNYrSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDDPKYVSNN 1111
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2665 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLT-NSDPIMNQLDLLHKWLDRHRDMCEKWKSK 2743
Cdd:PTZ00176 1112 VYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHRDMCEKWENH 1191
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  2744 EDILHKLNEQWNKDNDGGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDT-----ILDDIEDDIYYDVNDDEN----PS 2814
Cdd:PTZ00176 1192 HERLAKLKEKWENDNDGGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVNDNDDdndqPS 1271
                        1290      1300      1310      1320
                  ....*....|....*....|....*....|....*....|....*.
gi 23499282  2815 VDNIPMDHNK--VDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI 2858
Cdd:PTZ00176 1272 VYDIPMDHNKvdVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1317
ATS pfam15445
acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and ...
2448-2858 0e+00

acidic terminal segments, variant surface antigen of PfEMP1; ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.


Pssm-ID: 317799  Cd Length: 446  Bit Score: 689.24  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2448 TIPFGIALALGSIAFLFIKKKPKSPV-DLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSGH---YY 2523
Cdd:pfam15445    1 TIPWSVGIAFAAFTYFFLKKKTKSSVgNLFQILQIPKGDYDIPTLKSKNRYIPYASDRYKGKTYIYMEGDSSGDEkyaFM 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2524 EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDT----------PSSDAPM-NKFTDDEWNQLKQDFISG 2592
Cdd:pfam15445   81 SDTTDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKNNTntpsdtqndiPSDDIPStNPITDEEWNTLKHDFISN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2593 ILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDD-TSYVSNNVYSGIDL 2671
Cdd:pfam15445  161 MLQNTQNDEPNILRSGNVPNNTHPNTLSRDNMEEKPFIMSIHDRNLYSGEEYSYNINMSTNSMDDiPKYVSNNVYSGIDL 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2672 INDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLN 2751
Cdd:pfam15445  241 INDTLSGNQHIDIYDEVLKRKENELFGTNHTKHTSTNSVAKNTNSDPILNQLNLFHKWLDRHRDMCEKWKNKEERLDKLK 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2752 EQWNKDNDGG-------NVPIDNRSLNTDVWIEIDMDDPKGKKEFSN---------MDTILDDIEDDIYY---------- 2805
Cdd:pfam15445  321 EEWNKENNHSgdihpsdDIPSDNKVLNTDVSIQIDMDNPKPKNEFTNmdtnpdnstMDTILDDLEKYNEPyydfyeddiy 400
                          410       420       430       440       450
                   ....*....|....*....|....*....|....*....|....*....|....
gi 23499282   2806 -DVNDDenpsvDNIPMDHNKVDVPKKVHVEMKIlNNTsnGSLEPEFPISDVWNI 2858
Cdd:pfam15445  401 yDVNDH-----DASTVDSNNMDVPTKVQIEMDV-NNT--KLVEEKYPISDVWNI 446
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
12-404 7.21e-75

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 276.53  E-value: 7.21e-75
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    12 SDVKNESHNSARNVFENIAEIIYNRVKEDAEKRGKsLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGS 91
Cdd:PTZ00176    5 KGVINESKLSARNVLENIGNEIKDKRENESKYTDK-LKGSLWEARFSDGLSSSFGDVRSGYYDSCSLDHKFHTNINNGYP 83
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    92 YDRDPCHLRDTNRFSDKGDAICTNNKI--NCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMAKREGDS 169
Cdd:PTZ00176   84 PARNPCDGRNQNRFDENGESYCNSDKIrgNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKYEGES 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   170 IVNSHGHTGkgiyKSGICTSLARSFADIGDIIRGKDLFLGHNHkkkpllDNLEK-IFNRFQKIYEDINNLPIDD------ 242
Cdd:PTZ00176  164 IVNNHPDKD----KSSVCTALARSFADIGDIVRGKDMFKRNKH------DNVENgLREVFKKIYEGLKNNGAREhykevk 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   243 ------IREYWWALNRNDVWEALTCSAPYYAdYFKKKSGNTYNFT----TEGYCGRNEGAPPtnLDYVPQFLRWFDEWAE 312
Cdd:PTZ00176  234 ngnyikLREDWWTANRDQVWKAMTCVAPENA-YFRKTEADGIGISslilPYSKCGRDTDPPV--VDYIPQRLRWMSEWSE 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   313 EFCRIKNIKIGNIKKSCTgesnnkhcsregyDCNKTNlRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEE 392
Cdd:PTZ00176  311 YFCNVLNKEIDEMNNQCK-------------DCEMSR-RCNNDTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMEL 376
                         410
                  ....*....|..
gi 23499282   393 INESKPGVNSEH 404
Cdd:PTZ00176  377 YNKASTNITKQN 388
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
853-1567 1.19e-64

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 243.79  E-value: 1.19e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   853 GHRDYKGPCTGKDGHKKMFQVEKGWENGSKIGTEND----VFLPPRREHFCTSNVEHLYRsasglQGTTASHSLLGDVLL 928
Cdd:PTZ00176   81 GYPPARNPCDGRNQNRFDENGESYCNSDKIRGNENNsnagACAPFRRQNMCDKNLEYLIN-----KNTENTHDLLGNVLV 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   929 AANKEAGFIKERYKTQKTSEgfkdeatVCRAIKYSFADIADIIKGTDLWKANSgKKNTQDKLVKIFQKIKDNLPVN-IKG 1007
Cdd:PTZ00176  156 TAKYEGESIVNNHPDKDKSS-------VCTALARSFADIGDIVRGKDMFKRNK-HDNVENGLREVFKKIYEGLKNNgARE 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1008 KYNEDE--KHLELRKDWWFANRDKVWEAMKC-----------EQNGI----------TCSGPT--PLDDYIPQRLRWMTE 1062
Cdd:PTZ00176  228 HYKEVKngNYIKLREDWWTANRDQVWKAMTCvapenayfrktEADGIgisslilpysKCGRDTdpPVVDYIPQRLRWMSE 307
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1063 WAEWYCKAQKEAYDKLK-VCEKCMDNGKC---TQGnGECAKCKTACENYKKFINTWQPQWKQMEQKYESLYKEAQEN--- 1135
Cdd:PTZ00176  308 WSEYFCNVLNKEIDEMNnQCKDCEMSRRCnndTEG-EKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNitk 386
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1136 GNSS---------HKSTTEQDKYMVEFLSQLQKANNGDKTgddkvystaagyvhqEATMNCEKQTQFCKNKNGVKAANDA 1206
Cdd:PTZ00176  387 QNSSapergyrrnHRRRGYDDDTNVQLFLKKVIENNECKV---------------ESLGKYLDKTSHCGNYNFNYDNTPG 451
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1207 EDVNYTFKDTPNGYDVVCKCK-DRPEQQIKKKEVEDACKIAQDIFkgkdenTTVGLCKKKDFGRTPYPDWKCEKNSKlvt 1285
Cdd:PTZ00176  452 SNRSNAFEITPEKFKKACKCKiPNPLEKCPNEENKNVCTRFDKVY------SCTSLSFKNDLSEWNNSGVKNKENDN--- 522
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1286 gNGECMPPRRQKLCLYFLAHKieTPNLNTQEDLRKAFIKCAAAETFFswyYFKKINDKLNKLDEKLKegeippqflrsmf 1365
Cdd:PTZ00176  523 -NGVLVPPRRRNLCINLFSKK--DYKMKDENDFKEDLLNAAFSQGKL---LGKKYSNYSNEAYEAMK------------- 583
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1366 YTFGDYKDICLDTDISlktenGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNdkatvQK 1445
Cdd:PTZ00176  584 FSYADYSDIVKGTDMM-----NDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGYKTENENQ-----QL 653
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1446 TLTTKTIYDYDTVTfdgttkledfskrpQFLRWMTEWGEEFCKKRKEQLENLKDKCPD------YTCSFDTKKQECENHC 1519
Cdd:PTZ00176  654 NSSWCNVPDDDNID--------------QFLRWLTEWAQQYCKEKLIKAHIINTKCKDivegrkHKSMVDITDVECKRLF 719
                         730       740       750       760
                  ....*....|....*....|....*....|....*....|....*...
gi 23499282  1520 KVYEEWLKGWKDQYKKQSEKFTtdKEKPEYKDDPDVASSENAHKYLSK 1567
Cdd:PTZ00176  720 IDYEEWFRYRYNQWKGLSEKYI--KIKKSKNSGVNIPSEECAASYVTK 765
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
127-305 3.54e-63

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 213.72  E-value: 3.54e-63
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    127 ACAPYRRIQLCDYNLEYINEYNINS--THDLLGNLLVMAKREGDSIVNSHGH----TGKGIYKSGICTSLARSFADIGDI 200
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTTSntTHDLLEAVILAAKYEGFSLWHKYKKynpqYKLGTIPSEFCRQMAYSFADIGDI 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    201 IRGKDLFLGHNHKKK----PLLDNLEKIfnrFQKIYEDINNLPIDD-----IREYWWALNRNDVWEALTCSAPYYADYFK 271
Cdd:pfam05424   81 VRGKDLYLGNNKKKKnkreKLEENLKKI---FKKIYEKLTSKNKDDgnyyqLREDWWEANREDIWKAMTCALTYGAKYFR 157
                          170       180       190
                   ....*....|....*....|....*....|....
gi 23499282    272 KKSGNTYNFTTEGycgrNEGAPPTNLDYVPQFLR 305
Cdd:pfam05424  158 KTCGDGNSSSTAG----CNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1733-1914 2.36e-52

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 182.91  E-value: 2.36e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1733 CIPPRRKDMCLKQLEEINSADVNNSKK--LLQKIQDVAKKEGDDIIKKLLPKYPCNEDV-----ICKAMKYSFADLADIV 1805
Cdd:pfam05424    2 CAPPRRLHLCVKNLEKINSTNTTSNTThdLLEAVILAAKYEGFSLWHKYKKYNPQYKLGtipseFCRQMAYSFADIGDIV 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1806 RGIDKYKGPNGTNV-----LEKELKSVFETIYTKWKSENTNNKSKYTdvasFRSAWWDANRKDIWNAMTCNAPYDAKIYI 1880
Cdd:pfam05424   82 RGKDLYLGNNKKKKnkrekLEENLKKIFKKIYEKLTSKNKDDGNYYQ----LREDWWEANREDIWKAMTCALTYGAKYFR 157
                          170       180       190
                   ....*....|....*....|....*....|....
gi 23499282   1881 TKEGGYISPLTFtknkCGHNDDPPDYDYIPQPFR 1914
Cdd:pfam05424  158 KTCGDGNSSSTA----GCNDDVPTYFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
1290-1477 3.30e-42

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 153.63  E-value: 3.30e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1290 CMPPRRQKLCLYFLaHKIETPNLN--TQEDLRKAFIKCAAAETFFSWYYFKKINdklnkldEKLKEGEIPPQFLRSMFYT 1367
Cdd:pfam05424    2 CAPPRRLHLCVKNL-EKINSTNTTsnTTHDLLEAVILAAKYEGFSLWHKYKKYN-------PQYKLGTIPSEFCRQMAYS 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   1368 FGDYKDICLDTDISL---KTENGDITKAKSNIDRIIPK---------KSAKNPDEERKIWWDGIKEDVWEGMLCGLSHav 1435
Cdd:pfam05424   74 FADIGDIVRGKDLYLgnnKKKKNKREKLEENLKKIFKKiyekltsknKDDGNYYQLREDWWEANREDIWKAMTCALTY-- 151
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|..
gi 23499282   1436 snNDKATVQKTLTTKTIYDYDTVTFDGTtkleDFSKRPQFLR 1477
Cdd:pfam05424  152 --GAKYFRKTCGDGNSSSTAGCNDDVPT----YFDYVPQFLR 187
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
889-1058 1.17e-40

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 149.39  E-value: 1.17e-40
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    889 VFLPPRREHFCTSNVEHLYRSASGlqgTTASHSLLGDVLLAANKEAGFIKERYKTQK-TSEGFKDEATVCRAIKYSFADI 967
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKINSTNTT---SNTTHDLLEAVILAAKYEGFSLWHKYKKYNpQYKLGTIPSEFCRQMAYSFADI 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    968 ADIIKGTDLWKANSGKKNT-----QDKLVKIFQKIKDNLPvnikGKYNEDEKHLELRKDWWFANRDKVWEAMKCE----- 1037
Cdd:pfam05424   78 GDIVRGKDLYLGNNKKKKNkreklEENLKKIFKKIYEKLT----SKNKDDGNYYQLREDWWEANREDIWKAMTCAltyga 153
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 23499282   1038 --------------QNGITCSGPTPLdDYIPQRLR 1058
Cdd:pfam05424  154 kyfrktcgdgnsssTAGCNDDVPTYF-DYVPQFLR 187
PFEMP pfam03011
PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been ...
566-706 2.19e-26

PFEMP DBL domain; PfEMP1 (Plasmodium falciparum erythrocyte membrane protein) has been identified as the rosetting ligand of the malaria parasite P. falciparum. Rosetting is the adhesion of infected erythrocytes with uninfected erythrocytes in the vasculature of the infected organ, and is associated with severe malaria. PfEMP1 interacts with Complement Receptor One on uninfected erythrocytes to form rosettes. The extreme variation within these proteins and the grouping of var genes implies that var gene recombination preferentially occurs within var gene groups. These groups reflect a functional diversification that has evolved to cope with the varying conditions of transmission and host immune response met by the parasite. A recombination hotspot was uncovered between Duffy-binding-like (DBL) subdomains. Solution of the crystal structure of the N-terminal and first DBL region of PfEMP1 from the VarO variant of the PfEMP1 protein is found to be directly implicated in rosetting as the heparin-binding site.


Pssm-ID: 281064  Cd Length: 154  Bit Score: 107.20  E-value: 2.19e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282    566 FIKRWLESFLKDYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIE-----DNNSSNS 640
Cdd:pfam03011    1 LFKRWVEYFLEDSIKWRKKLKSCINNGKGKCCKKECKNDCECFKKWVEKKKEEWKKIKEHFLKQYKLKgltgkTLDEYLD 80
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 23499282    641 LNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEEC--KSNDVIKILLSKLKEKIELCKK 706
Cdd:pfam03011   81 LKSFLETFLFYIDIKEAYGDVKELKKLEEILDEEGCSAGAESAKnnKNEDAIDKLLDKEEKKANNCKE 148
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
1280-1924 3.85e-26

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 118.21  E-value: 3.85e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1280 NSKLVTGN------GECMPPRRQKLCLYFLAHKIETpNLNTQEDLRKAFIKCAAAETFFSwyyfkkINDKLNKldeklKE 1353
Cdd:PTZ00176  106 NSDKIRGNennsnaGACAPFRRQNMCDKNLEYLINK-NTENTHDLLGNVLVTAKYEGESI------VNNHPDK-----DK 173
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1354 GEIPPQFLRSmfytFGDYKDICLDTDISLKTENGDITKAKSNIDRII----PKKSAKNPDEE---------RKIWWDGIK 1420
Cdd:PTZ00176  174 SSVCTALARS----FADIGDIVRGKDMFKRNKHDNVENGLREVFKKIyeglKNNGAREHYKEvkngnyiklREDWWTANR 249
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1421 EDVWEGMLCglshavSNNDKATVQKTLT-----TKTIYDYDTVTFDGTTKLEDFSkrPQFLRWMTEWGEEFCKKRKEQLE 1495
Cdd:PTZ00176  250 DQVWKAMTC------VAPENAYFRKTEAdgigiSSLILPYSKCGRDTDPPVVDYI--PQRLRWMSEWSEYFCNVLNKEID 321
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1496 NLKDKCPD----YTCSFDT---KKQECENHCKVYEEWLKGWKDQYKKQSEKF------------TTDKEKPE-------- 1548
Cdd:PTZ00176  322 EMNNQCKDcemsRRCNNDTegeKCKKCKEQCQIFKELVSKWKNQFDKQSMKYmelynkastnitKQNSSAPErgyrrnhr 401
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1549 ---YKDDPDVA--------SSENAHKYLSKKLKQIFHNGSTTEKCDYTcmeyasrqpqtsacsqqqqqqnkssTQNHFPE 1617
Cdd:PTZ00176  402 rrgYDDDTNVQlflkkvieNNECKVESLGKYLDKTSHCGNYNFNYDNT-------------------------PGSNRSN 456
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1618 AFDYPPKEIGDRCTCpKLPEPkycVDKTAYDIRKESGKKSDNslkgngntYNNNCNNSMREEYANQNGETCKFNETfwsk 1697
Cdd:PTZ00176  457 AFEITPEKFKKACKC-KIPNP---LEKCPNEENKNVCTRFDK--------VYSCTSLSFKNDLSEWNNSGVKNKEN---- 520
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1698 kkpsieecdinakerfqiqkywDCNGktpdgkntFCIPPRRKDMCLKQL--EEINSADVNNSKkllQKIQDVAKKEGddi 1775
Cdd:PTZ00176  521 ----------------------DNNG--------VLVPPRRRNLCINLFskKDYKMKDENDFK---EDLLNAAFSQG--- 564
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282  1776 iKKLLPKYPCNEDVICKAMKYSFADLADIVRGIDKYkgpNGTNVLEKELKSVFEtiytkwksentnnKSKYTDVASFRSA 1855
Cdd:PTZ00176  565 -KLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMM---NDLKKLNKELNTLLK-------------ETEKGDISVDRKT 627
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 23499282  1856 WWDANRKDIWNAMTCNapydakiYITKEGGYisplTFTKNKCghndDPPDYDYIPQPFRWLSEWSETYC 1924
Cdd:PTZ00176  628 WWDDNKNVVWNAMLCG-------YKTENENQ----QLNSSWC----NVPDDDNIDQFLRWLTEWAQQYC 681
Duffy_binding pfam05424
Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium ...
2121-2240 2.67e-15

Duffy binding domain; This domain is found in Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade human erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa. This family is closely associated on PfEMP1 proteins with PFEMP, pfam03011.


Pssm-ID: 336112 [Multi-domain]  Cd Length: 187  Bit Score: 76.21  E-value: 2.67e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   2121 AIVPPRRRQLCLQNLTR---NLSRLNKEKSFKEGILISAASEAKMLTEQY-RENPAKALQAIK--------YSFADIGNI 2188
Cdd:pfam05424    1 ACAPPRRLHLCVKNLEKinsTNTTSNTTHDLLEAVILAAKYEGFSLWHKYkKYNPQYKLGTIPsefcrqmaYSFADIGDI 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 23499282   2189 IKGDDII--------GNVISVQLN------KLINGNKKINTSTL--------WWEANKEKIWNAMMCYYTGDEK 2240
Cdd:pfam05424   81 VRGKDLYlgnnkkkkNKREKLEENlkkifkKIYEKLTSKNKDDGnyyqlredWWEANREDIWKAMTCALTYGAK 154
PTZ00176 PTZ00176
erythrocyte membrane protein 1 (PfEMP1); Provisional
116-401 1.29e-13

erythrocyte membrane protein 1 (PfEMP1); Provisional


Pssm-ID: 140204 [Multi-domain]  Cd Length: 1317  Bit Score: 77.38  E-value: 1.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   116 NKINCNNGgcgACAPYRRIQLCdYNLEYINEYNINSTHDLLGNLLVMAKREGDSIVNSHGHTGKGIYKSgictsLARSFA 195
Cdd:PTZ00176  517 NKENDNNG---VLVPPRRRNLC-INLFSKKDYKMKDENDFKEDLLNAAFSQGKLLGKKYSNYSNEAYEA-----MKFSYA 587
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   196 DIGDIIRGKDLflghnhkkkplLDNLEKIFNRFQKIYEDINNLPIDDIREYWWALNRNDVWEALTCSApyyadyfkkKSG 275
Cdd:PTZ00176  588 DYSDIVKGTDM-----------MNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNVVWNAMLCGY---------KTE 647
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23499282   276 NTYNFTTEGYCGRNEGapptnlDYVPQFLRWFDEWAEEFCRIKNIKIGNIKKSCTG-ESNNKHCSREGydcnktnlrlne 354
Cdd:PTZ00176  648 NENQQLNSSWCNVPDD------DNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDiVEGRKHKSMVD------------ 709
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 23499282   355 iFMDLECPRCADDcksYETWVENKKKEFNKQKEKYKEEINESKPGVN 401
Cdd:PTZ00176  710 -ITDVECKRLFID---YEEWFRYRYNQWKGLSEKYIKIKKSKNSGVN 752
NTS pfam15447
N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part ...
21-56 2.56e-08

N-terminal segments of PfEMP1; This family, the N-terminal segment, is the most variable part of the variant surface antigen family of Plasmodium falciparum, the erythrocyte membrane protein-1 (PfEMP1) proteins. PfEMP1 is an important target for protective immunity and is implicated in the pathology of malaria through its ability to adhere to host endothelial receptors. A structural and functional study of the N-terminal domain of PfEMP1 from the VarO variant comprising the N-terminal segment (NTS) and the first DBL domain (DBL1alpha1), shows this region is directly implicated in rosetting. NTS, previously thought to be a structurally independent component of PfEMP1, forms an integral part of the DBL1alpha domain that is found to be the important heparin-binding site. This family is closely associated with PFEMP, pfam03011, and Duffy_binding, pfam05424.


Pssm-ID: 317801  Cd Length: 36  Bit Score: 51.61  E-value: 2.56e-08
                           10        20        30
                   ....*....|....*....|....*....|....*.
gi 23499282     21 SARNVFENIAEIIYNRVKEDAEKRGKSLKGDYKRAK 56
Cdd:pfam15447    1 SAKHVLDRIGKKVHDKVKKEAKKYKSELKGDLSKAK 36
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH